current user: public

If you have questions about the server, please let us know.

Query: sp|Q9NPG2|NGB_HUMAN Neuroglobin OS=Homo sapiens GN=NGB PE=1 SV=1, from H.sapiens

Results of FFAS03 search in PfamA32U
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150
# Score Template Links and tools%idFirst MERPEPELIRQSWRAVSRSPLEHGTVLFARLFALEPDLLPLFQYNCRQFSSPEDCLSSPEFLDHIRKVMLVIDAAVTNVEDLSSLEEYLASLGRKHRAVGVKLSSFSTVGESLLYMLEKCLGPAFTPATRAAWSQLYGAVVQAMSRGWDGELast
1 -38.500PF00042.22; GLB8_CHITH/9-115; Globin  ali follow..  17  1....QLALFKSSWNTVKHN----EVDILYAVFKANPDIQAKFPQF--AGKDLDSIKDSADFAVHSGRIVGFFSEVIGLIGNPEALKTLIDGLASSHKARGIEKAQFEEFRASLV..................................... 107
2 -15.200PF11563.8; F0XJU9_GROCL/20-199; Protoglobin  ali follow..  14FSSTDIDHLVAGAKYIKVLIPAVTNIVYRKLLQ-YDITARAFRSTSFEGPLDAVPAEDSPQILHRKMFLRAYLARLCSDPSQMTFWEYLDKVGMMHVGLGRAHPLHSLIQDVLTEAVLSHPRLSMGRGLVKALGKVIWIQNDLFAKWYVRD 177
3 -8.130PF01152.21; Q7CX73_AGRFC/7-127; Bacterial-like globin  ali follow..  9................DATVRALTRRFYELM-DTLPEAARCRA------------IHPADLSGSEAKFYDYLTGYLGGPPVYVE-----PMLRRRHFVAPIGPAERDEWLLCFRRAMDET---IENAKLREIIWAPVERLAFHMQN..... 121
4 -7.260PF05194.12; UREE_RHOFT/78-166; UreE urease accessory protein, C-terminal domain  ali follow..  11  13...............................................................................GTAFDLTRAAYHLGNRHVPIELKPDHLKIEPDHVLADMLRAMHLTVLAVNE..................... 63
5 -6.300PF00502.19; APCD_SYNP2/6-160; Phycobilisome protein  ali follow..  11  13PSSGELSGIKRIAEALADNEKKIVDQAQKQLFSIHPEYRT-------SGGNAATTKQYNQCLRDYGWYLRLVTYGI--AGDKDPIERGLIGVKEMYNALGVPVPGMVDAIRCLKDAALGVLDSEEARIAAPYFDFITQAM........... 155
6 -5.890PF11075.8; Q089B5_SHEFN/10-184; Protein of unknown function VcgC/VcgE (DUF2780 topsan)  ali follow..  60LGLSQTQAEGGLGSLLSLAQTNLGENDFSQLSDSIPNADGLL-----------AAVPALSSDSGMSGLLSQAGNLGSALQGSAMVYDAFEKLG-------ISKEYITPMVDIAKNYLQQSGGDGTVDLLMKG................... 173
7 -5.890PF16727.5; A0A194XQL3_9HELO/1150-1239; DNA repair protein REV1 C-terminal domain  ali follow..  11  1...........................................................ELRDTLSAWHSEFVDDGPHPDDVAAMERYLRRVILDERDMS----------VNVVRWLAWLIDESDDNEGTRIWSEALEGIKFKVQAAVQER 85
8 -5.770PF13979.6; W0HT23_9GAMM/530-697; SopA-like catalytic domain  ali follow..  13  46LDEGFYARLMQLALLVDRSPAERGQVMFC--------LAALFAKCASNSLFGTEEDSPYALRSLACAFLDRACTLQSRIHAARDFTVWKNALLGRQGEATCA----AVVASEMLGYGTTHFPEVLKQVMPVEWR................. 168
9 -5.680PF12335.8; K1RYJ6_CRAGI/418-667; Myotubularin protein  ali follow..  17.NARRLEVLRNCINFVFDNKISDARIIFPAVLRKSRVARLALTQELSYHIRSNRAVLEHQQFDLVVKLLNCCLQNDSSMDENGVAAAILP----------LATTFYRRLCTGIIQFAYTCVQEHAVWQNMQFWEAAF.............. 144
10 -5.620PF06021.11; F7BVP0_HORSE/2-206; Aralkyl acyl-CoA:amino acid N-acyltransferase  ali follow..  14  172LDVTHAALVNKFWH----GGNERSQRFIERCIRNFPN.................................................................................................................. 205

FFAS is supported by the NIH grant R01-GM087218-01
1 4 1 5 6 8   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Li W, Jaroszewski L, Godzik A. Sequence clustering strategies improve remote homology recognitions while reducing search times. Protein Eng. 2002 Aug;15(8):643-9.