current user: public

If you have questions about the server, please let us know.

Query: sp|B5MD39|GGTL3_HUMAN Putative gamma-glutamyltransferase light chain 3 OS=Homo sapiens GN=GGTLC3 PE=5 SV=1, from H.sapiens

Results of FFAS03 search in SCOP207
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .
# Score Template Links and tools%idFirst MTSEFFAAQLRSQISDHTTHPISYYKPEFYTPDDGGTAHLSVVAEDGSAVSATSTINLYFGSKVCSPVSGILFNNEWTTSALPAFTNEFGAPPSPANFIQPGKQPLLSMCPTIMVGQDGQVRMVVGAAGGTQITTDTALAIIYNLWFGYDVKRAVEEPRLHNKLLPNVTTVERNIDQAVTAALETRHHHTQIASTFIAVVQAIVRTAGGWAAASDSRKGGEPAGYLast
1 -67.400g2dg5.1 d.153.1.6 (A:37-387,B:391-580) Gamma-glutamyltranspeptidase, GGT {Escherichia coli [TaxId: 562]}  ali 3D-neighbors follow..  31  318LTNKAYAKSIADQIDINKAKPSSEIRPG-KLAPYEXTTHYSVVDKDGNAVAVTYTLNTTFGTGIVAGESGILLNNQMDDFSAPGVPNVYGLVGGDANAVGPNKRPLSSMSPTIVV-KDGKTWLVTGSPGGSRIITTVLQMVVNSIDYGLNVAEATNAPRFHHQWLPDELRVEKGFSPDTLKLLEAKGQKVALKEAMGSTQSIMVGPDGELYGASDPRSDDLTAGY 542
2 -54.000d2nlza1 d.153.1.6 (A:3-539) Cephalosporin acylase {Bacillus halodurans [TaxId: 86665]}  ali model 3D-neighbors follow..  25  326LLSDEYATERRKEIGEQALTPEPGT------PPRGGTVYLATADGDGNMVSFIQSNYMGFGSGVVVPGTGIAMQNRGHNFS---------LDPNHDNALKPGKRTYHTIIPGFLT-KNDQPIGPFGVMGGFMQPQGHMQVMMNTIDFGLNPQAALDAPRWQWT-NGKQVQVEPTFPVDIAQALVRRGHKIQVVLGAFGRGQIIWRTTGVLAGGTEPRTDGQVAAW 537
3 -50.400d2i3oa1 d.153.1.6 (A:1-516) Hypothetical protein Ta0994 {Thermoplasma acidophilum [TaxId: 2303]}  ali model 3D-neighbors follow..  18  326...............................NDIGDTTYFSISDSEGRSVSIIQSNYMGFGSGIVPKGTGFVLQNRGSYFT---------LQRDHPNALMPGKRTFHTLAACMVE-KEHDLYASLGSMGGDIQPQVQMQILMEILKDNTDPQAILDKPRWTEPYTPGAVYVESELYRNVSKQISGRKVVLRDVSQEFGTAQITTLRGDVVVGAADPRGDGIAIPY 515
4 -7.000d1g8kb_ b.33.1.1 (B:) Arsenite oxidase Rieske subunit {Alcaligenes faecalis [TaxId: 511]}  ali model 3D-neighbors follow..  12  4LAYPATAVSVAKNLAANEPVSFTYPDTSSPCVAVKLGAPVPGGVGPDDDIVAYSVLCTHMGCPTS-------YDSSSKTFSCPCHFTEFDAEKAGQMICGEATADLPRVL--LRYDAASDALTAVGVDG................................................................................................ 123
5 -6.050d2f4da_ c.45.1.1 (A:) VH1-related dual-specificity phosphatase, VHR {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  17  26...........NEVTPRIYVGNASVAQDIPKLQKLGITHVLNAAEGRSFMHVNTNANFYKDSGIT------YLGIKANDTQEFNLSAYF---ERAADFIDQALA------------QKNGRVLVHCREGYSRSPTLVIAYLMMR--QKMDVKSALSIVRQNREIGPN.......................................................... 158
6 -6.050d1jm1a_ b.33.1.1 (A:) Rieske protein II (SoxF) {Sulfolobus acidocaldarius [TaxId: 2285]}  ali model 3D-neighbors follow..  13  69................................PLGQIQTIKGVGPNGTIFAF-SDVCVHLGCQLVSSESDPGLYAKGADLHCPCHGSIYALKDGGVVVSGPAPRPLPIV--ILDYDSSTGDIYAVGTNA................................................................................................ 167
7 -5.770d2f0ca1 b.21.1.3 (A:63-163) Baseplate protein (bpp), C-terminal domain {Lactococcus phage tp901-1 [TaxId: 35345]}  ali model 3D-neighbors follow..  13  2..................................................TKSWSGELGGGIILSLRKKGYSIGGEISSSILANSNLVNRSVPN-------EFCPRNRCS-HIDIPSSGVCQWFGPTASSGTPRGTGTYPI.................................................................................... 100
8 -5.700d2g30a1 b.1.10.1 (A:705-824) Beta2-adaptin AP2 ear domain, N-terminal subdomain {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  15  6....................................PKAVWLPAVKAKGLEISGTFTHRQGHIYMEMNFTNKALQHMTDFAIQFNKNSFGVIPSTPLAIHTPLMPNQSIDVSLPLNTLGPVM----KMEPLNNLQVAVKNNIDVFYFSCLIPLNV...................................................................... 120
9 -5.670d5hkea_ d.153.1.0 (A:) automated matches {Lactobacillus salivarius [TaxId: 1624]}  ali model 3D-neighbors follow..  13  106LGQCSDVNEARNLVE-----KINLINLSFSEQLPLAGLHWLIADREKSIV----VEVTKSGVHIYDNPIGILTNNPEFNYQMYNLNKYRNLSISTPQNTFSDSVDLKVDG-----TGFGGIGLPGDVSPESRFVRATF--SKLNSSKGMTVEEDITQ.................................................................... 246
10 -5.670d3cj1a1 c.55.1.15 (A:36-178) NTPDase2 {Norway rat (Rattus norvegicus) [TaxId: 10116]}  ali model 3D-neighbors follow..  12  2....................................ALKYGIVLDAG---SSHTSMFVYKWPADKENDTGIVGQHSSCDVQGGGISSYANDPSKAGQSLVR----LEQALRDVPRDRHASTPLYLGATAGMRLLNLTSPEAT................................................................................... 101

FFAS is supported by the NIH grant R01-GM087218-01
1 3 6 9 2 8   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Slabinski L, Jaroszewski L, Rychlewski L, Wilson IA, Lesley SA, Godzik A. XtalPred: a web server for prediction of protein crystallizability. Bioinformatics. 2007 Dec 15;23(24):3403-5. Epub 2007 Oct 5.