current user: public
If you have questions about the server, please let us know.

Query: sp|P56385|ATP5I_HUMAN ATP synthase subunit e, mitochondrial OS=Homo sapiens GN=ATP5I PE=1 SV=2, from H.sapiens

Results of FFAS03 search in SCOP207
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .
# Score Template Links and tools%idFirst MVPPVQVSPLIKLGRYSALFLGVAYGATRYNYLKPRAEEERRIAAEEKKKQDELKRIARELAEDDSILKLast
1 -5.780d1npya2 c.58.1.5 (A:1-102) Shikimate 5-dehydrogenase-like protein HI0607 {Haemophilus influenzae [TaxId: 727]}  ali model 3D-neighbors follow..  16  13SGRPSNFGTTFHNYLYDKLGLNFIYKAFTTQDIEHAIKGVRA........................... 54
2 -5.350d1dkca_ g.3.4.2 (A:) Antifungal peptide PAFP-S {Pokeweed (Phytolacca americana) [TaxId: 3527]}  ali model 3D-neighbors follow..  19  13.....SAGPPYCCSSYCFQIAGQSYGVCKNR...................................... 38
3 -5.100d3wu2e_ f.23.38.1 (E:) Cytochrome b559 subunit alpha, PsbE {Thermosynechococcus vulcanus [TaxId: 32053]}  ali model 3D-neighbors follow..  17  25........PALFIAGWLFVSTGLAYDVFGTPRPDSYYAQEQR........................... 58
4 -5.100d2lzua2 g.39.1.0 (A:69-107) automated matches {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  23  6.......HTKLSLGSYAAL--GEFYCKPHFQQLFKSKGNYDE........................... 39
5 -4.410d4gyva1 a.87.1.0 (A:536-747) automated matches {Mouse (Mus musculus) [TaxId: 10090]}  ali model 3D-neighbors follow..  14  147......LKPVQRLVHYRLLLSRLC------AHYSPGHRDYADCHEALKAITEVTTELQQSLTRLENLQK 203
6 -4.360d1sz7a_ d.278.1.2 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  25  100LVDFVELPDNHSSLIYSNLLCGVLRGALEMVQMAVE................................. 135
7 -4.260d1ofcx3 a.187.1.1 (X:697-798) HAND domain of the nucleosome remodeling ATPase ISWI {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}  ali model 3D-neighbors follow..  15  66....................................SDATKVQREEQRKIDEAEPLTEEEIQEKENLLS 98
8 -4.240d3n6qa_ c.1.7.0 (A:) automated matches {Escherichia coli [TaxId: 668369]}  ali model 3D-neighbors follow..  6  209...DTLQNNGVGCIAFTPLAQGLLTGKYLNGIPQDSRMHREGNKVRGLTPKMLTEANLNSLRLLNEMAQ 274
9 -4.210d1lqaa_ c.1.7.1 (A:) Tas protein {Escherichia coli [TaxId: 562]}  ali model 3D-neighbors follow..  15  221...EVSQYEGVELLAYSCLGFGTLTGKYLNGAKPAGARNTLFSRFTRYSGEQTQKAVAAYVDIARR... 283
10 -4.180d3v0sa1 c.1.7.0 (A:1-305) automated matches {Rauvolfia serpentina [TaxId: 4060]}  ali model 3D-neighbors follow..  10  192...PLCRQLGIGIVPYSPIGRGLFWGKAIKESLPENSVLTENLEKNKQIYYRIEALSQKHGCTPVQLA. 263
FFAS is supported by the NIH grant R01-GM087218-01
1 4 7 9 4 0   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster
Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Li W, Jaroszewski L, Godzik A. Tolerating some redundancy significantly speeds up clustering of large protein databases. Bioinformatics. 2002 Jan;18(1):77-82.