current user: public

If you have questions about the server, please let us know.

Query: sp|B5MD39|GGTL3_HUMAN Putative gamma-glutamyltransferase light chain 3 OS=Homo sapiens GN=GGTLC3 PE=5 SV=1, from H.sapiens

Results of FFAS03 search in VFDB
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .
# Score Template Links and tools%idFirst MTSEFFAAQLRSQISDHTTHPISYYKPEFYTPDDGGTAHLSVVAEDGSAVSATSTINLYFGSKVCSPVSGILFNNEWTTSALPAFTNEFGAPPSPANFIQPGKQPLLSMCPTIMVGQDGQVRMVVGAAGGTQITTDTALAIIYNLWFGYDVKRAVEEPRLHNKLLPNVTTVERNIDQAVTAALETRHHHTQIASTFIAVVQAIVRTAGGWAAASDSRKGGEPAGYLast
1 -78.700[E] KOG2410 Gamma-glutamyltransferase  ali follow..  36  405MMTEEYTKKIASLIKDTAQTLDYYGGEKKDMAPDHGTSHVSIIDSHGNAVSCTSTVNQILGSMRASPTLGIVWNDQMDDFSTPGMKNSFGYAPSETNFIQPGKRPMSSMSPMIIYNNENRVEMVTGASGGSYIISATAQTVIRTLLFNQTVKAAVDAPRFHNQYLPETTETEEAMPLALREVLVEQKQNFTVVPRQKSVVQALISLEGFVEGNSDFRRKTAPAGY 633
2 -52.100[E] COG0405 Gamma-glutamyltransferase  ali follow..  22  310LLDKRYAKQLAEEIGYLAIPAESR-------PVGSDTAYAAVIDADGNAVSFIQSLYFEFGSAVTAGDTGILLQNRGSFFS---------LDENHVNTLEPRKRTFHTLMPAMVC-KGGKPKILYGTQGGEGQPQTQTAIITRMLDYGMHPQQAISEPRWVWGRTWEGLRVEGRFTDKTIQKLKDSGHLVEVVDPLMGQAAAIKVDEGFLQGGADPRGDGAAVGI 525
3 -6.710[C] KOG1758 Mitochondrial F1F0-ATP synthase, subunit delta/ATP16  ali follow..  16  23..............................................AEAAAASSGLKL----QFALPHETLYSGSEVTQVNLPAKSGRIGVLANHVPTV-------EQLLPGVVEVMEGSNSKKFFISGG--FATVQPDSQLCVTAIEAFPLESFSQENIKNLLAEAKKNVSSSDAREAAEA........................................... 145
4 -6.580[F] KOG4171 Adenylate/guanylate kinase  ali follow..  442ILKDMLPRRIAQQLLSGEHIEACEHEATVMFCDLPAFQQAIPQCSPKDIVNMLNEIFRKLDRIV----------VIRGVYKVETVSDSYMAVSGIPDYTPEHAENMCHVALGMMWESKTPFLLRIGIHSGTITAGVVGTVHPKYCLFGETVTLA---SQMESLGMAGKIQCSKWAYQKAMEEFSPRG...................................... 627
5 -6.030[O] KOG0840 ATP-dependent Clp protease, proteolytic subunit  ali follow..  10  122....................................ISQLVTLASIDDKSDILMYLNCPGGSTY----SVLAIYDCMSWIKPKVGTVAFGVAASQGALLEKGMRYAMPNTRVMIHQPQTG---CGGHVEDVRRQVNEAIEARQKIDRMYAAFTGQPLEKVQQYTERDRLSASEALEFGLIDGLLETEY..................................... 271
6 -5.710[D] KOG3022 Predicted ATPase, nucleotide-binding  ali follow..  17  62.......................................ILVLSGKGGVGKSTFSAQLSFALAGMDHQVGLM------DICGPSIPKMLGLEGQEIHQSNLGWSPLGVMSIGFMLPNSDEAVI------GPRKNGLIKQFLKDVYWGEIDY--VVDAP-------PGTSDEHISIVQYLLPT---------------GIDGAIIVTTPQEVSLIDVRKE...... 216
7 -5.510[O] COG5227 Ubiquitin-like protein (sentrin)  ali follow..  14  2...SESPSANISDADKSAITPTTGDTSQQDVKPSTEHINLKVVGQDNNEVFFKIKKTT--------------FSKLMKIYC-----ARQGKSMNSLRFLVDGERIRPDQTPAELDMEDGDIEAVLEQLGGCTHLC.......................................................................................... 116
8 -5.260[S] COG3124 Uncharacterized protein conserved in bacteria  ali follow..  5.....................................AHLHLAHLAESSLSGNLLADFVRGNPEES-VAGIHMHRRIDVLT-----DNLPEVREAREWFRSETRRVAPITLDVMWDH------FLSRHWSQLSPDFPLQEFVCYAREQVMTILPDSPPRFINYLWSEQWLVRYRDMDFIQNVLNGMASRRPRLDALRDSWYDLDAHYAALET............. 175
9 -5.200[S] COG1912 Uncharacterized conserved protein  ali follow..  13  46........HLTHDITPYNIFEGSYRLFQTVDYWPEGTTFVSVVDPGVGSKRKSVVAKTAKNQYIVTPDNGTLISEVANRRQNTEHSYTFDVYAYTGAKLASGHITFEEVGPELSVEQIVELPVVATIIEDHLVKGAIDIL..................................................................................... 194
10 -5.180[OU] COG0740 Protease subunit of ATP-dependent Clp proteases  ali follow..  16  45....................................VAQLLFLESEDPTKDINIYINSPGGSVT----AGMAIYDTMQFIKPDIRTLCIGQACSMGAFLTAGKRAALPNARVMIHQPLGG---FRGQASDIQIHAQEILKIKHTLNDRLAFHTGQGIERIRDNFMSAEEAQAYGLVDEVLV............................................ 191

FFAS is supported by the NIH grant R01-GM087218-01
1 3 6 9 2 8   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Slabinski L, Jaroszewski L, Rychlewski L, Wilson IA, Lesley SA, Godzik A. XtalPred: a web server for prediction of protein crystallizability. Bioinformatics. 2007 Dec 15;23(24):3403-5. Epub 2007 Oct 5.