current user: public

If you have questions about the server, please let us know.

Query: sp|P02100|HBE_HUMAN Hemoglobin subunit epsilon OS=Homo sapiens GN=HBE1 PE=1 SV=2, from H.sapiens

Results of FFAS03 search in VFDB
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .
# Score Template Links and tools%idFirst MVHFTAEEKAAVTSLWSKMNVEEAGGEALGRLLVVYPWTQRFFDSFGNLSSPSAILGNPKVKAHGKKVLTSFGDAIKNMDNLKPAFAKLSELHCDKLHVDPENFKLLGNVMVIILATHFGKEFTPEVQAAWQKLVSAVAIALAHKYHLast
1 -42.800[C] COG1017 Hemoglobin-like flavoprotein  ali follow..  16  2...LDAQTIATVKATIPLLTGPKLTAHFYDRMFTHNPELKEIFN-----------MSNQRNGDQREALFNAIAAYASNIENLPALLPAVIAQKHTSFQIKPEQYNIVGTHLLATLDEMFN--PGQEVLDAWGKAYGVLANVFIHREA 136
2 -25.200[C] KOG3378 Globins and related hemoproteins  ali follow..  17  256MDRITERQKHIFTETFPVIFKERNGLVLFAKYFSEFPHYKNIWPQFRTLQD-SALLASNELANHCSVYMSGLKV......................................................................... 330
3 -7.950[S] KOG4654 Uncharacterized conserved protein  ali follow..  14..RPKEKVVYIYELLCRGEDPSSESPEFWNEFFLLQPNFEALENEIGKLNNEQLQLVKPNLNTLFQRCIEMLDTLCNSLHTLCSLFYGIFKKSNAEPTLN-EKMDEWLKLLMQYCNRILLGDVPENARFMCLKLLQVLVTGTDNVNQ 170
4 -6.960[R] COG2346 Truncated hemoglobins  ali follow..  18..TMSSETVTLYEAIGGDATVRALTRRFYELM-DTLPEAARCRAI-----------HPADLSGSEAKFYDYLTGYLGGPPVYVE--HPMLRRRHFVAPIGPAERDEWLLCFRRAMDET---IENAKLREIIWAPVERLAFHMQNQ.. 146
5 -6.330[L] KOG2994 Uracil DNA glycosylase  ali follow..  12  100..CYVPLSELLVEESWLKALPGEFHKPYAKSL-LIYPPQHLIFNALNTTPFDRKTVIIGQDPYHGPGQAMGLSFSVPEGEKLPSSLLNIFKELHKDVGCSIPRHGNLGVLLLNAVLTVRSKQPNSHAKKGWEQFTDAVIQSISQQKE 265
6 -5.890[O] COG0576 Molecular chaperone GrpE (heat shock protein)  ali follow..  12  55.................................EVENRYLRMQADFENVKKRHIADRDASQKYRSQSLAQDLLPALDSFEKALATTSDQEEVKQILKGM-----EMVYNQILVAFEPAVGEQFDPNFHQAVMQD-NEITAELQKGY. 175
7 -5.750[O] KOG3003 Molecular chaperone of the GrpE family  ali follow..  10  71.................................ELMDKYKRSLADSENMRNRLNKQISDAKIFGIQSFCKDLLEVADTLGHATQAVPKDKLSGNADLKNLYEGLTMTRASLLQVFKRHINQKFDPNQHEALFQK-NTVVEVTKLGY. 196
8 -5.480[L] COG0692 Uracil DNA glycosylase  ali follow..  11  2.............KNWTDVIGTEKAQPYFQHTLQIYPPQEDVFNAFKYTAFEDKVVILGQDPYHGPNQAHGLAFSVKSLLNIYKELTQDISGFQMPSNGYLVKWAEQGVLLLNTVLTVERGMAHSHANLGWERFTDKVIAVLNEHRE 154
9 -5.460[P] COG0598 Mg2+ and Co2+ transporters  ali follow..  12  169....NASATKKTRDLQSLIEQIGQKGDLLTVIRESLVSIGRLVAYHVAIEGSTPRKAAKESRQRIKLVQRDAASLGDHALFLSNKINFLLDATLGLINLEQNQFSVAAVVFLTLVASIYGMNFEVMPELTWRFGYPYALILMI.... 313
10 -5.110[Z] KOG0031 Myosin regulatory light chain, EF-Hand protein superfamily  ali follow..  15  20FSMFDQTQIQEFKEAFTVIDQNRDG-------IIDKEDLRDTFAAMGRLNVKNEELDAMMKEASGTVFLTMFGEKLKGADPEDVITGAFK--------LDPEGKGTIKKKFLEELLTTQCDRFSQEIKNMWAAFYKNICYVITHGDA 166

FFAS is supported by the NIH grant R01-GM087218-01
1 4 0 1 8 1   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Li W, Wooley JC, Godzik A. Probing metagenomics by rapid cluster analysis of very large datasets. PLoS ONE. 2008;3(10):e3375. Epub 2008 Oct 10.