current user: public

If you have questions about the server, please let us know.

Query: sp|P36268|GGT2_HUMAN(removed signalp:1-30) Gamma-glutamyltranspeptidase 2 OS=Homo sapiens GN=GGT2 PE=1 SV=3, from H.sapiens

Results of FFAS03 search in VFDB
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380    .  390    .  400    .  410    .  420    .  430    .  440    .  450    .  460    .  470    .  480    .  490    .  500    .  510    .  520    .  530    .
# Score Template Links and tools%idFirst KEPDNHVYTRAAMAADAKQCLEIGRDTLRDGGSAVDAAIAALLCVGLMNAHSMGIGVGLFLTIYNSTTGKAEVINAREVAPRLAFASMFNSSEQSQKGGLSVAVPGEIRGYELAHQRHGRLPWARLFQPSIQLARQGFPVGKGLAAVLENKRTVIEQQPVLWYVFCRDRKVLREGERLTLPRLADTYEMLAIEGAQAFYNGSLMAQIVKDIQAAGGIVTAEDLNNYRAELIEHPLNISLGDAVLYMPSARLSGPVLALILNILKGYNFSRESVETPEQKGLTYHRIVEAFRFAYAKRTLLGDPKFVDVTEVVRNMTSEFFAAQLRSQISDHTTHPISYYKPEFYTPDDGGTAHLSVVAEDGSAVSATSTINLYFGSKVCSPVSGILFNNEWTTSALPAFTNEFGAPPSPANFIQPGKQPLLSMCLTIMVGQDGQVRMVVGAAGGTQITTDTALAIIYNLWFGYDVKRAVEEPRLHNKLLPNVTTVERNIDQAVTAALETRHHHTQIASTFIAVVQAIVRTAGGWAAALDSRKGGEPAGYLast
1 -128.000[E] KOG2410 Gamma-glutamyltransferase  ali follow..  36  95SGSLFAHYKKAAVTSDHGLCSEIGRDVLIEGGNAVDAMIASLLCIGTVNPQSSGIGGGFVMTLYNASTGMCQTINARETAPAAATETMFVDNKESVMGYKSIATPSELHGFWTVFNMYGKVSWARLFQPSITLAHDGFPVSSNLAMRKFSRDIFV---------NPKTNRVYEEGDILKRQRLASTYALLANDPVELFYKGGMAQTIAGEITDNGGFVNESDLASYETTIDDAPLLSPGDYEMCGPPPPSSFVITQNIIQVMAQYYKDGQVDLDD----PLVYHRLIEAEKFAYAQRTKLGDVKFVESATLVDEMMTEEYTKKIASLIKDTAQTLDYYGGEKKDMAPDHGTSHVSIIDSHGNAVSCTSTVNQILGSMRASPTLGIVWNDQMDDFSTPGMKNSFGYAPSETNFIQPGKRPMSSMSPMIIYNNENRVEMVTGASGGSYIISATAQTVIRTLLFNQTVKAAVDAPRFHNQYLPETTETEEAMPLALREVLVEQKQNFTVVPRQKSVVQALISLEGFVEGNSDFRRKTAPAGY 633
2 -126.000[E] COG0405 Gamma-glutamyltransferase  ali follow..  24  2..NKSVIGTKQMVVSPHYLASQAGNRILDKGGNAFDAAVAVSACLAVVYPHMTGLGGDSFWLTFHQETKAVKVYNGSGRSGKNVTRDVYKGKSALRGIDSAITVPGMVDSWDAVLKEYGRLSLADVLEPARDYAQNGFPVSADQCRHTEKNIELLASTPYTADIFTRRGKAPVPGERFVQKELADSLNLIAEKGRSAFYEGDLAQRIVSHLQNNGSYMTIDDFKAHRGEWAAPVSSDYRGYSVYQA-PPNSQGFTGLLTLNILENYDFTQIEHGSFE----YYHVLVEALKKSFLDRAVLTDPAFADIP--LERLLDKRYAKQLAEEIGYLAIPAESR-------PVGSDTAYAAVIDADGNAVSFIQSLYFEFGSAVTAGDTGILLQNRGSFFS---------LDENHVNTLEPRKRTFHTLMPAMVC-KGGKPKILYGTQGGEGQPQTQTAIITRMLDYGMHPQQAISEPRWVWGRTWEGLRVEGRFTDKTIQKLKDSGHLVEVVDPLMGQAAAIKVDEGFLQGGADPRGDGAAVGI 525
3 -6.000[O] COG2192 Predicted carbamoyl transferase, NodU family  ali follow..  11  134...............................AHAASAFFPSPFASAAV--TMDGVGEWCTTSLGHGRGKDLDIL---KEIRFPHSLGLLYSAFTYYTGFKVNSGEYKVMGL----APYGR---QKILDHLIDLKEDG----RLDQRYFDYCAGLTMTSPAFHELFGAEPRRPESPLTQREMDLAASVQAVTEEVVLKLARFARQETGERHLCLAGGVA-------LNCVANGKLLKKRIFDDIWIQPAAGDAGGAVGSALKRLTASGAVYTVLSDDDLIARTVDAIMEFGPRALGGRSILGDPRSPIMQKTLNLKVKYDVLDRHRLPLGAGEAALFGIDRLNVPRSGIPAVTH---VDYSARVQTVHRDTNPRYWELLFKQRTGCLVNTSFNVRGEP-------IVCTPEDAFR-----MGTEIECLVVGN............................................................................................................ 587
4 -5.290[R] COG1574 Predicted metal-dependent hydrolase with the TIM-barrel fold  ali follow..  12  25...........AADPNQTGVDTMHPDLILHNGRTLDRTNPNATAIAIKDGLFLEVGSDSEVMALAGSGTKIVDLKGKGVLPGLIDNHTHV-----VRGGLNYNMELRWDGVRSLADAMDMLKRQVAITPA-QFAEKRLPTIEEINAVAPDTPVFLLNGAALRAVGYTRDTPNPPGGEITRDANGNPTGLLLAKPNAGILYSTLADYQVNSTRHF-GVTGVIDYEVIQKLSDENQMTVRLAYNLFTQKPKEGAGEMLVFSAADFEDFRQPRPEMAPEMEGELE-EVLRVLAENRWPWRLHTYDETISRALDVFEKVNKDIPLEGLNWFFDHAETISDRYFAERYGHGVAEATPPIRRMLDKGVNVSAGTTGKTVGGMQLYPRANCLDRETALRMWTEKVTWFSN--EEGKKGRIEKGQ-----FADLVVPDKDSFIVSELTMVGGKIVYGA......................................................................................... 571
5 -4.920[F] KOG4171 Adenylate/guanylate kinase  ali follow..  10  250........................................................................................................................LPYHFVIDESCKLVQCGSELHNHIPNELLQPGTPILRIFEINRPQIP----LDFENICNFINAVFVLQVKTSPLKKKHMDAMSQEELKQEMETLDEDATNELTQGHHLKLKGQMMLLASKKHIIYLCSPYVTSINELMQYGMLHDATRDLILLNQQRLSDVEVNLQLEANNEQLETMTRELELERQKTDSILKDMLPRRIAQQLLS----GEHIEACEHEATVMFCDLPAFQQAIPQCSPKDIVNMLNEIFRKLDR----------IVVIRGVYKVETVSDSYMAVSGIPDYTPEHAENMCHVALGMMWESKTPFLLRIGIHSGTITAGVVGTVHPKYCLFGETVTLA---SQMESLGMAGKIQCSKWAYQKAMEEFSPRG...................................... 627
6 -4.800[S] COG5546 Small integral membrane protein  ali follow..  13  16..........AILGAIFLLAQQLGIKLPSNIADIANTAVTLLVLLGVVDPTTKGLSDSEQALTYHEPKK...................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 75
7 -4.760[C] COG1454 Alcohol dehydrogenase, class IV  ali follow..  11  72.DPTLSVVRKGAELANSFKPDVI---IALGGGSPMDAAKIMWVMYEIAVTTTSGTGSTPFAVVTDDATGQKYPLADYALTPDMAIVDANLVMDMPKSLCAFGGLDAVTHALEAYVSVLASEFSDGQALQALKL------LKENLPASYHEGSKNPVARERVHSAATIAGIAFANAFLGVCHSMAHKL-----GSQFHIPHGLANALLICNVIRYNANDNPTKQTAFSQYDRPQARRRYLGLSAPGDRTAAKIEKLLAWLESIKAELGIPKSIREAGVQEADFLAHVDKLSEDAFDDQCTGANPRYPLISE-LKQILLDTY........................................................................................................................................................................................................................... 415
8 -4.750[EH] COG0028 Thiamine pyrophosphate-requiring enzymes [acetolactate synthase, pyruvate dehydrogenase (cytochrome), glyoxylate carboligase, phosphonopyruvate decarboxylase]  ali follow..  10  38................................TTAQLMVQCLENEGV--EYIFGLPGEENIRFVDAGDSTIRFIVVRHEQGASFMADIYGRVTGKAGVCISTLGPGALLGTADAFETHQVVDLLNMFKPVTKWAEMIIGSAAIPEMMREAFEKAQTSRPGAVYLCVPEDVESISGLTGLRPQITRAAQVLQEATKPIILAG-------------HGAVAGDALVRFSERLRIPVATTFMGKGIFPDDHPNSLGTI--VIVCVGYDLQEFDPVRINPNADKKILHLHRYPAEIDAHYPVTVS-----NLSAALDGLAAIITPKEGLDAEDRKIRNLLREELEYGARADAYPVKPQRLVSDIRAAMGDSDIALVDTGALKMWMARLYPTYQPNTCVISNGLATAFAVPGAGAKLAYPDR-------KVLAVTGDGSFLMNS-----QELETAIRERIFVVLVWVDDAYGLIKWKMDLELGRHSFVDFGNPDLVKYAESFGARGYRIEVAADLLPTLKKALAEDV................. 556
9 -4.740[V] COG0841 Cation/multidrug efflux pump  ali follow..  10  42...........SIIITATYPGASAKTLDDAVTSIIEQEMNGADGLLYIESVSQAGNGQATITVT-GTDPALAQVDVQNRLPSSVTQQGVQVDKTRSNFLLFATLISKVPGVGQA-VLFGTERAMRIWIDPAKLVGYKLTPTD------------------VYNAIRNQNALVSAGTLGDLPSTSDQPIAATVVVEGQMTTTEQFGNIVLVSKPDGSQVRIKDVARLELGGQTYTSARINGQPISAIGVQLSPT---GNALGTAKAVKAKLDELSKYFPAGVEYKIPYDTSKFVQISIEEVVKTLFEAM--ALVFLVMLVFLQNIRYTLIPSIVVPISLLGA------------FATMNALGFSINVLTMFGLVLAIGILVDDAIVVVEN------VERIMSQEGLPPREATRKAMGQITGAIIGITLVL----PMAFFSGSVGSLSMVASIFFSALMALTLTPALCSTLLKPI.................................................................. 501
10 -4.720[G] KOG0747 Putative NAD+-dependent epimerases  ali follow..  10  1..................MASYTPKNILITGA--------------------AGFIASHVALIRSYPDYKIVVLDKLDYCSNLKNLNPSKHSPNFKF------VKGDIASADLVNHLLITEGIDTIMH---------FAAQTHVDNSFGNSFEFTKNN------------IYGTHVLLEACKVTGQIRRFIHVSTDEVY-GETDEDALVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGLVYGPNQFPEKLIPKFILLAMRGQVLPIHGDGSNVRSYLYCEDVAEAFEVVLHKGENIGTKKERRVNDVAKDICKNMDPEANIKFVDNRPFNDQRYFLDDQKLKKLGWSERTTWEEGLKKTMDWYTQ-NPEWWGDVSGALLPHPRMLMMPGGRHFDGSEDNSLAATLSEKPSQTHMVVPSQRSNGTPQKPSLKFLIYGKTGGGLLGKICDKQGIAYEYGKGRLEDRSSLLQDIQSVKPTHVTGRPNVDWCESHKTETIRANVAGTLTLADVLLMMNFATGCIFEYDDKHPEGSGIGF 503

FFAS is supported by the NIH grant R01-GM087218-01
1 3 6 9 2 8   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Slabinski L, Jaroszewski L, Rychlewski L, Wilson IA, Lesley SA, Godzik A. XtalPred: a web server for prediction of protein crystallizability. Bioinformatics. 2007 Dec 15;23(24):3403-5. Epub 2007 Oct 5.