current user: public

If you have questions about the server, please let us know.

Query: sp|B5MD39|GGTL3_HUMAN Putative gamma-glutamyltransferase light chain 3 OS=Homo sapiens GN=GGTLC3 PE=5 SV=1, from H.sapiens

Results of PSI-BLAST search in nr85s
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .
# E-value Template Links and tools%idFirst MTSEFFAAQLRSQISDHTTHPISYYKPEFYTPDDGGTAHLSVVAEDGSAVSATSTINLYFGSKVCSPVSGILFNNEWTTSALPAFTNEFGAPPSPANFIQPGKQPLLSMCPTIMVGQDGQVRMVVGAAGGTQITTDTALAIIYNLWFGYDVKRAVEEPRLHNKLLPNVTTVERNIDQAVTAALETRHHHTQIASTFIAVVQAIVRTAGGWAAASDSRKGGEPAGYLast
1 0.000e+00UniRef50_A0A0L7QZ87 Gamma-glutamyltranspeptidase 1 n=4 Tax=Apidae TaxID=7458 RepID=A0A0L7QZ87_9HYME  ali  41  435LTSRSHAQKTRMKIDDHKTWDPTHYGASTSSAKDQGTAHVSVLAPNGDAVSATSTINFYFGSGVVSENTGILLNNAMNDFGIPSTISFFGIPPSPNNYIAPGKRPLSSMVPSILIDSNNEVKMVVGASGGTKITTTVSQIMAKIIWMGQTVKEAVDAPRIHHQLFPAGMSYEYGVPKQVIDGLKKIGHKTARYRVRGSVACVIFVKNETVHANADFRKGGDVYG. 660
2 0.000e+00UniRef50_A0A0L8FW22 Uncharacterized protein n=3 Tax=Octopus bimaculoides TaxID=37653 RepID=A0A0L8FW22_OCTBM  ali  41  354ITDRGYGDEIRSRINDSRTFNYSYYGPAFTIRDYIGTSHLCLLGPNGDAVSMTSTVNSYFGSKVLGKRTGIVFNDEMDDFSTPNKTNEFGIPSSKTNYIAPGKMPMSSMSPAIIVDQNGDVISVLGASGGSRITTGTAYVFAESMWFNKSLAKSISFPRLHHQLIPPYIEMEKNFPQDITEKLKEMGHKIHKISIANSRVQGILVKD-KIHAAADRRKCGSVDGW 577
3 0.000e+00UniRef50_A0A1F9KRI1 Gamma-glutamyltransferase n=10 Tax=unclassified Deltaproteobacteria (miscellaneous) TaxID=122706 RepID=A0A1F9KRI1_9DELT  ali  37  334LISKDYAASIRGRISSTKTYPPKHYGSGASPPEKGGTTHFSVVDRFGNAVACSLTINTQFGSKVFVPEAGIVFNNEMDDFAIPGTPNTFGLVGGEANSLQPRKRPLSSMAPTVILEGD-QAALVVGASGGPRIISAMLQTILNVLDFRMPIKQAVESPRIHHQWMPDELVVEGKISENSKKSLERLGHKVKERNS-LGLVEAVSVQKSKVVGAADPRQE...... 551
4 0.000e+00UniRef50_A9V609 Predicted protein n=1 Tax=Monosiga brevicollis TaxID=81824 RepID=A9V609_MONBE  ali  46  461..........RDKIFDNQTHDPSYYGAHYDVEPTPGTTHLSVIGPDGDAVGVTSTVNLLWGSKVLTED-GILLNNEMDDFSSPNLTNAFGVRPSPANFIRPGKRPLSSSAPTIVLDKEGRVRLVAGAAGGTRITTATAQVILLALGMDKSIEEAIANPRVHHQLLPDYILGEADFDSSIRRGLEALGHKWQTPESMISVAQAVLRPNGRLHAASDPRKGGKAAGY 677
5 0.000e+00UniRef50_UPI000C142062 glutathione hydrolase 1 proenzyme-like isoform X2 n=2 Tax=Spodoptera litura TaxID=69820 RepID=UPI000C142062  ali  38  406.TTPEYGTEIRLRINDTSTSDTATYGAETYNQPDAGTAHISIIAGNGDAVSVTSSINFYYGAGFSTLKTGIVMNNVMDDFSSPGITNYFGLKPSPANFIAPHKRPMSSMSPSIIVDRNGNAKLVIGASGGTKITTAVALVTIRKLWFDQSIKEAVDEARIHHQITPMHVEYEFGVTEDIVQGLRAKGHGMVRYRSRGSIICALYRNRTAIYANADFRKGGDVAG. 629
6 0.000e+00UniRef50_A0A1X2GFW9 Gamma-glutamyltranspeptidase n=1 Tax=Hesseltinella vesiculosa TaxID=101127 RepID=A0A1X2GFW9_9FUNG  ali  41  374..SKDWADEVRGNLTDNETHDPLYYNPKYDHISNHGTMHLSVVDSNEGAVALTSTVNLMFGSRVIDPVTGIILNDEMDDFSIPGVPNDFGLYPSADNYIAPGKRPLSSITPVIVE-QDGHFELALGGSGGSQIATASLNVLLNVLDFGMELYDAVESPRLHHQLMPNRASLELGFDRALTEQLVQRNHKIYWRNDTVSAVQAVQRPDGTVQAASDPRKYGLGAAY 598
7 0.000e+00UniRef50_UPI000C254A49 glutathione hydrolase 1 proenzyme-like n=1 Tax=Leptinotarsa decemlineata TaxID=7539 RepID=UPI000C254A49  ali  38  311ITSVKYAVQTRKKIFDNRTQDPSYYGAFTENHNDHGTAHICVVAPNGDVVSVTSSINYIFGAKFMSESTGIILNDSMDDFSIPGEPNIFGLPPSPTNYIEPGKRPMSSMCPSIILD-NGNVFMVIGGAGGSRITSNVLQVIINRLFYRFDLIQASNEERIHHQLFPMILQLENDFLQDIVDGLREIGHKLTFSDPGFAAVTCISRDNGRLLGVTDKRRGGSVA.. 538
8 0.000e+00UniRef50_UPI000D62D5D3 uncharacterized protein LOC107268717 n=1 Tax=Cephus cinctus TaxID=211228 RepID=UPI000D62D5D3  ali  42 1120LTSKDYARSIREKINDNRTNDPGHYGASTAGDGDHGTAHISVLAPNGDAVSVTSTINIYFGSGIVSQSTGILMNSGMDDFGIPSRYSYFGLPPSPNNYIQPGKRALSSMAPTILVENNGEVRMVIGAAGGTKITTALAYTIARQLWMNNTIKQAVDAARIHHQLFPMKIIYEFGVPAQVIDGLKKLGHQTARYRNRGSVVCVLVQQNGTVYANADFRKGGDVYG. 1345
9 0.000e+00UniRef50_UPI000B8F1137 gamma-glutamyltranspeptidase 1-like n=1 Tax=Folsomia candida TaxID=158441 RepID=UPI000B8F1137  ali  43  377LTSIDYINEIRSLILDHITNNYEYYGAEFYMPENHGTSHLSIVGANGDAIAVTSTVNLHFGAAIRSRRTGIIYNDEMDDFSAPNITNSFGVPPSPNNFIMPGKRPVSSMAPSIFVDPTGRARLVIGAAGGTQITTSIAYATMRNIWLGQTIKEAIDAPRLHHQLYPMELKYESTFPQEYVAEFRAKNHTSVSMDPGSSIVVGVTRENGTLFANSDFRKGGAIAGY 603
10 0.000e+00UniRef50_UPI000BA7E964 gamma-glutamyltranspeptidase 1-like n=1 Tax=Limulus polyphemus TaxID=6850 RepID=UPI000BA7E964  ali  38  251.......KQVRQKISDVETFPPENYGGFFYGVEDHGTAQVTVVDAEGNAVSASSTINTQFGCKRRSSSTGIILNNEMDDFSSPNVTNFFGILPSPANFIKPGKRPLSSMSPSVVLDKAGQLKTVIGGAGGSRIITAVSQVLLRSMWLNNSIKEAIDALRIHHQLYPDTVFHEKHFPQIYLDGLTRLGHN-TALDSEHTQVQGIVKENGKLSANIDYRKDASMIGF 468
11 0.000e+00UniRef50_A0A2B4R6F0 Gamma-glutamyltranspeptidase 1 n=2 Tax=Stylophora pistillata TaxID=50429 RepID=A0A2B4R6F0_STYPI  ali  44  297MMSTKLAEDIRHRITDTMTHSRDYYGSRYHVPIKTGTTSLSVLAANGDAVSLTSTVNGYFGAKFLSNKLGFVYNNEMDDFSAPHVTNEFGLPPSPVNFIKPGKRPQSSAVPAIVLDKKGNVLMTIGAAGGTIITTSVAQAIMNYFWFKKNLQTAITMPRVHEQLYPNFVFAETRFPTEVVNGLISLGHKVNVSDISHGVVQGIVRNPHKIYAESDYRKGGQPAGY 541
12 0.000e+00UniRef50_T2MH65 Gamma-glutamyltranspeptidase 1 n=2 Tax=Cnidaria TaxID=6073 RepID=T2MH65_HYDVU  ali  41  371LLDESLAKKIRNQINDSRTYNISHYGGKYFQKVTTGTTHLVVVGPNGDAVTVMSTVNGYLGAKFRSCKLGFIYNNEMDDFSTPGISNEFGLPPSEENFIKPDKRPMSSSVPVILLDSHKNVRLVTGGSGGSIITTAVAQVIMNHLWFGMSMRDAVQQPRVHSQLVPSVVYVEPRMPEKVLEELKKRGHNVRVTDESHAVVQAIARVDSQWFAESDFRKGGTPAGF 623
13 0.000e+00UniRef50_A0A1W7R8L0 Putative gamma-glutamyltransferase n=30 Tax=Neoptera TaxID=33340 RepID=A0A1W7R8L0_AEDAL  ali  41  371MTSPNYGKEIRESIDDYNTHNPHDYGGHFFIKDSHGTAHISLIGPNGDAVSVTSSINFYFGAALSGKRTGIIVNSGMDDFSSPGLQNYFGLPGSKRNYIQPQKRALSSMSPTIVVGSDGNVKLIVGAAGGTKITTAVAMTIIKYLWFGHDIKEAVDSPRIHHQLIPMTLQYEFGNLEDVILGLEAKGHATKRYRERGSIVCGIAQNKTGVYANADFRKGGDVVGF 596
14 0.000e+00UniRef50_A0A2E7C8E6 Gamma-glutamyltransferase n=21 Tax=cellular organisms TaxID=131567 RepID=A0A2E7C8E6_9GAMM  ali  32  353LIDKAYAERQRALIKPGRATPSSEVAPGEVLVDSHDTTHYTVADRFGNVVSNTYTLNFSFGSHIAVPGTGMLLNNEMADFAAPGQPNPFGLVEGEANSIEGGKRPLSSMSPTMVF-RDGKPWLATGSPGGSLIITSVLQTILNAMAFDMNIATAAAEPRVHHQWLPDKLVVEQGISPDTLELLRALGHNVDVAGRTLGRTQSIMLERGYLLGATDTRRGGHVAGY 579
15 0.000e+00UniRef50_A0A165JP85 Gamma-glutamyltranspeptidase n=2 Tax=Agaricomycetes TaxID=155619 RepID=A0A165JP85_EXIGL  ali  41  274...KEYAEHIAPNITDDTTHTFEYYKPVFDVPEDHGTMHLSVVDKDHMAVSVTSTVNLVFGSRVLDTNTGVILNDELDDFSRPGIPNYFGLWPSPYNYPEARKRPLSSTCPTIIENADGSLYAVLGGSGGSRIFPSVAQVIVG-LDVGRTISEAVEGPRAHDQLFPAVLDLDSTFPAEHVAALQERRHNVSVTNGIKAVVQGIMVDDGVIWAAADSRKNGIAAGY 497
16 0.000e+00UniRef50_A0A261KLP6 Gamma-glutamyltranspeptidase n=2 Tax=Hydrocoleum sp. CS-953 TaxID=1671698 RepID=A0A261KLP6_9CYAN  ali  31  357LTSLSYAQKRREEINLEKVRRSSEVEPVSPEVESPDTTHLTVVDAERNVISMTYTINGSFGAGVVTAGTGILLNNEMDDFAVPGVPNLYGLVGGEANAIAPRKTPLSSMTPTIVT-ENGRLIMATGAPGGSTIITTVLQVVLNVLEYQMNAAEAVSAPRFHHQWLPDKLMLETGFSEVTVNELKQRGHNVVMRRGW-GNANVIVMDEGILEGAADPRGEGEAMG. 587
17 0.000e+00UniRef50_A0A2E7UKY7 Gamma-glutamyltranspeptidase (Fragment) n=1 Tax=Deltaproteobacteria bacterium TaxID=2026735 RepID=A0A2E7UKY7_9DELT  ali  37  27LLSGERIDAVREAIVPGRTFRADYYGMPVDPGTDGGTLHLSTLDADGMAVALTTTINTSFGSRVTVPGWGLVLNNEMDDFARPGVPNAYGLVGSEANAVAPGARPLSSMSPTVLLSPDRKQRIVVGASGGPFIITSTLQVILNIVDFGHDPSEAVAAPRFHHQWQPESLFLDQGFTADTVRALESYGHEVREME-FFSAVQVIHQTGDTMLGASDPRKGGWPAG. 251
18 0.000e+00UniRef50_A0A2V6L0K3 Gamma-glutamyltransferase (Fragment) n=3 Tax=Verrucomicrobia bacterium TaxID=2026799 RepID=A0A2V6L0K3_9BACT  ali  31  131LIEKAYAERQRSTINPERASLSSEIGAGPTGYESTQTTHFTIVDAAGNAVSNTYTLNTSFGSGVVAKGTGVLLNNEMDDFSKPGQPNSYGAIQSERNAIAPRKRPLSSMTPTFVLRPDGGLYFGIGARGGTTITNTVLLIISNVIDHGMNLQEAIDSPRIHHQWLPDEIRDEPGLSADTRRALEAHGHKFATKLSYMGDAQGIMIEDKTRLGASDARDDGAAVGY 360
19 0.000e+00UniRef50_A0A2A4J4U1 Uncharacterized protein n=6 Tax=Noctuidae TaxID=7100 RepID=A0A2A4J4U1_HELVI  ali  38  278.TTPEYGTEVRMRINDTATSDTATYGAETYNQPDAGTAHISIIAGNGDAVSVTSSINYYYGAGFSTLKTGIVMNNVMDDFSSPGITNFFGLKPSPANFIAPHKRPMSSMSPSIIVDRNGNAKLVIGASGGTKITTAVALVTIRKLWFDQSIKEAVDEARIHHQITPMHVEYEFGITEDIVKGLRAKGHGMVRYRGRGSIICALFRNKTAIYANADFRKGGDVAG. 501
20 0.000e+00UniRef50_A0A2S2PJM4 Gamma-glutamyltranspeptidase 1 (Fragment) n=2 Tax=Aphidinae TaxID=133076 RepID=A0A2S2PJM4_SCHGA  ali  38  19..SDSYMDKIRSKISDDFTSDPKYYGADFDMPENHGTANMVVIDSMGNVVISTSTINTYFGSGFTSPSTGILLNNEMDDFSTPGAVNSYGIPSSPANYIEPGKRPMSSMCPTIITDKNGDFFLAAGAAGGSKITLATAYVSALKLWYNKTLKEAIDKPRIFHQLVPMQIQYEYGTTRDVIQKLKDIGHLVTRLPNGFSAVTAISKSFGTIEAMPDFRRPGNSSGY 244
21 0.000e+00UniRef50_A0A0C9M4U8 DNA polymerase alpha catalytic subunit n=1 Tax=Mucor ambiguus TaxID=91626 RepID=A0A0C9M4U8_9FUNG  ali  41 2374MIQKEYAADIRQKITDDTTHDPLYYNPRFDHVESHGTMHLSVVDENDGAVALTSTVNLIFGSHIMDPSTGVILNDEMDDFSIPGIPNMFGLYPSEYNYAGPRKRPLSSITPTIIE-KDARFEMAIGGSGGSIIPTATLNAIVNVLDYGQDLYTAIAAPRVHHQLLPNVAILENGYSKSKQAELATKKHDLFILPKSISAVQAVRRPDGTLEAASDPRKMGIAAAY 2600
22 0.000e+00UniRef50_A0A015IUX8 Gamma-glutamyltransferase n=21 Tax=Fungi incertae sedis TaxID=112252 RepID=A0A015IUX8_9GLOM  ali  36  371IMTKDYAAKIRKNISDSITFEPSYYNPLYDVSEDHGTTHISTVDKNNQAVALSSTVNLIWGSQVMDLETGILLNDEMDDFSIPGVPNYFGLYPSPYNFIIPRKKPLSSCAPAIVEN-NGEFEMAIGGSGGSRILSSVLQVLLNVYDFEQDLLTSIHTPRVHHQLIPNEITAETGYSKELLDELKGKNHSIKIIEYKLGVIQAVMRPNGLINAASDYRKHGIAAGY 597
23 0.000e+00UniRef50_UPI000719DEE9 gamma-glutamyltranspeptidase 1-like n=1 Tax=Priapulus caudatus TaxID=37621 RepID=UPI000719DEE9  ali  44  275.TSSDYAAGLRARITDGSTHDPEYYGVKTGGGDDHGTSDVAVVASNGDAVSVTSTINTLFGAMRRSPSTGVILNNEMDDFSSPNSTNFFDLPPSPSNFIRPGARPVSSMCPAILVDRHGDVRLVVGASGGSLIPSATTWAFAHNHWFEQPLNVAIDTKRLHHQLIPNELTYEAGFSKSILRGLATRGHQLREFSVGDSVVQAIEVEQRSLLACSDWRKGGLPDGY 502
24 0.000e+00UniRef50_A0A0C3AWH8 Uncharacterized protein n=2 Tax=Agaricomycetidae TaxID=452333 RepID=A0A0C3AWH8_9HOMO  ali  40  396...KNYADTIAANLTDDRTHPTEYYNPEFDIQTDHGTSHTSTVDKDGMAVSLTTTINLVFGSRLMDPETGIIFNDEMDDFSTPGVPNGFGLWPSPYNYPEPGKRPLSSTVPTIMEYEDGSFYLAIGGSGGPRILSSVFQVILNLIW-GLDVSQAVEYGRVHDQLLPAEVETDDIVAAALLDSLRDRGHNVTGEFSLYGVVQTVLQRDGIIYAASDSRKNGIAAGY 639
25 0.000e+00UniRef50_UPI0009369D33 gamma-glutamyltransferase light chain 1-like n=1 Tax=Aedes albopictus TaxID=7160 RepID=UPI0009369D33  ali  41  1MTSPNYGKEIRESIDDYNTHNPHDYGGHFFIKDSHGTAHISLIGPNGDAVSVTSSINFYFGAALSGKRTGIIVNSGMDDFSSPGLQNYFGLPGSKRNYIQPQKRALSSMSPTIVVGSDGNVKLIVGAAGGTKITTAVAMTIIKYLWFGHDIKEAVDSPRIHHQLIPMTLQYEFGNLEGVILGLEAKGHATKRYRERGSIVCGIAQNKTGVYANADFRKGGDVVGF 226
26 0.000e+00UniRef50_K8GQL5 Gamma-glutamyltransferase 1 n=7 Tax=Cyanobacteria TaxID=1117 RepID=K8GQL5_9CYAN  ali  37  335LISPAYAQQRRQEINLQKARPSNQVRLFNWVKESNDTSHLSVVDADGNAVSLTFTVNLGFGAGVVASGTGIVLNNEMDDFAIPGVPNAFGLVGRDANAIAPGKTPLSSMTPTIVT-ENGQLRLVVGAPGGSTIITTVLQIVLNVLVYEMDVEKAVAAPRLHHQWLPDTVMVENGFGTLTLEELRRRGHRLQERVGW-GNAMAIFRTDGLLKGVADPRGEGTASGF 568
27 0.000e+00UniRef50_A0A1C7BSP5 Gamma-glutamyltranspeptidase n=98 Tax=Bacteria TaxID=2 RepID=A0A1C7BSP5_AGGAC  ali  32  364LTSKKYADQLAQGISEAAVKPAAEIKPGQPQPESDQTTHFSVMDKNGNAVAVTYTLNFNFGSGIVAAGTGILLNDEMDDFSKPGVPNGFGLIGGEANAIAPQKRPLSSMTPTLVM-KDNKPWLVTGSPGGARIITTVLQSIVNTVDHKMNPAEAIVTPRVHHQWLPDELRVEEGLSPDTLAILKAQGYTIKEKAPM-GRVQIIQAREDGFYGYSDPRNEGKTVGY 589
28 0.000e+00UniRef50_A0A1Q7WRU2 Gamma-glutamyltransferase n=2 Tax=Alphaproteobacteria TaxID=28211 RepID=A0A1Q7WRU2_9PROT  ali  33  313MLSQQHATAIRAAIDPDKAAASAALGPGLAPHERAETTHYSVADGEGNAVAVTYTLNGNFGAAIVAPGTGFLLNNEMDDFAVPGAPNLFGLVQGTANAIAPGKRPLSSMTPTIVE-RDGRPVLVLGSPGGPRITTAVLETLTNIVDFGLAPDQAVAMPRFHHQWLPDTLYYERGFSPDVLAGLAERGHKLTEQPPW-GAVELIAIGPDRLFGVNDPRRPGAAAGY 539
29 0.000e+00UniRef50_P18956 Glutathione hydrolase proenzyme n=2271 Tax=root TaxID=1 RepID=GGT_ECOLI  ali  32  354LTNKAYAKSIADQIDINKAKPSSEIRPGLAPYESNQTTHYSVVDKDGNAVAVTYTLNTTFGTGIVAGESGILLNNQMDDFSKPGVPNVYGLVGGDANAVGPNKRPLSSMSPTIVV-KDGKTWLVTGSPGGSRIITTVLQMVVNSIDYGLNVAEATNAPRFHHQWLPDELRVEKGFSPDTLKLLEAKGQKVALKEAMGST-QSIMVPDGELYGASDPRSDDLTAGY 580
30 0.000e+00UniRef50_B0XE48 Gamma glutamyl transpeptidases n=3 Tax=Culicinae TaxID=43817 RepID=B0XE48_CULQU  ali  44  353LTSKAYAEGVRERITADRTHDFAHYGAEFVQPDDHGTAHVSVLAPNGDAVALTATVNTYFGCKRRSPSTGMILNNIMDDFATPGVINSFGVPASPVNFVAPGKRPLSSMTPTIVTDANGDVRLVLGAAGGTRITTSTVLLILRAIFFGQDLDTAMNAPRLHHQLAPETLDVERAFADEVVQGLTERGHQVRLVSG-IGTATAIAREDDSITAAFDPKRGGS.... 574
31 0.000e+00UniRef50_A0A0E1RNS7 Gamma-glutamyltranspeptidase n=4 Tax=root TaxID=1 RepID=A0A0E1RNS7_HAEPR  ali  30  193LTSKEYAKSLIQGIDEEKARPASDIKPGQPQSESDQTTHYSVMDKEGNAVAVTYTLNLNFGSGIVAEGTGILLNNEMDDFSKPGVANAFGLIGGDVNAVEGKKRPLSSMTPTLVLKED-KPWLVTGSLGGARIITTVLQSILNTVDHGMNPAEAIVTPRVHHQWLPDELRIEEGISPDTLKLLEQKGHKINVKAPM-GRIQIIQAREDGFYGYSDPRNDGRTIGF 418
32 0.000e+00UniRef50_A0A1Y2FWG4 Gamma-glutamyltranspeptidase-domain-containing protein n=1 Tax=Leucosporidium creatinivorum TaxID=106004 RepID=A0A1Y2FWG4_9BASI :  ali  40  440...KAYSAQIRANITDDRTHTLDYYHPRFDVQEDHGTTHLSVVDQYGSAVSLTSTVNLLFGSRVMDKDTGIILNDEMDDFATPGIPDAFGLTPSPYNYPAPGKRSLSSTAPLIMDSPEGEVYVALGGSGGSRIFGSVAQVLLN-LDWGFDISNAVEQQRVHHQLSPAYVSVESGFRADIVEELKSRGHNVTLFDVNLGIVQAVLRQPGRIFATSDSRKNGVPAAY 663
33 0.000e+00UniRef50_A0A1B6J9Q8 Uncharacterized protein (Fragment) n=9 Tax=Neoptera TaxID=33340 RepID=A0A1B6J9Q8_9HEMI  ali  38  373LMSDEYANHIRAKILDNETSEPEHYGAVYYNQEDSGTAHISILAPNGDAVSVTSTVNLYFGGGVTSERLGIVLNSGMDDFSVPGVVNYYGVYPSPSNFIVPGKRAMSSVSPTIIVNSDGDVTMVIGASGGTKIITSVSSVIMRYLWLGNSIKEAVDASRVHHQLYPMEVSYEYGVIAPLIRSLQAIGHKTKRYRDRGSIVCALARQDDKIYANADYRKGGEVYG. 597
34 0.000e+00UniRef50_A0A2V6P4V7 Gamma-glutamyltransferase (Fragment) n=1 Tax=Verrucomicrobia bacterium TaxID=2026799 RepID=A0A2V6P4V7_9BACT  ali  35  112LVSKDYAARLAAQIRLDRVLPGAEHGTPDRADEDKHTTHFSTADAAGNWVACTATVNTSFGCKIVVPDTGVVLNNQMDDFSAPGATNYFGLVGAEANAIAPGKRPLSSMSPTIVL-KDGRPILSVGAAGGPTIISQTVLAIINTIDFGMSPESALAQPRFHHQWKPDELLVEKRIGEKVLRELEERGHKLKVVDS-LGAAQAVGVNPNGFVGAHDPRVEGRAAGW 340
35 0.000e+00UniRef50_A0A1J5PR00 Gamma-glutamyltranspeptidase n=1 Tax=mine drainage metagenome TaxID=410659 RepID=A0A1J5PR00_9ZZZZ  ali  33  8LLSPDHAAKIRAQIRPDQATPSAQVQGSLGADEGMHTTHYSIVDAQGNAVSVTYTLNFFFGNAKIAGDTGFFLNDEMDDFSKPGVPNAFGLVQGSTNAVAPGKRPLSSMAPTIVL-KDGQLFMVTGSPGGSTIISTVLESILNVVDFGMNMQQAVDAPRLHHQWLPDEVSVEPGYTPQSQAALTAMGYTFKERSPWGAD-EAILRDPGVLEGANDDRRPGLAEGY 235
36 0.000e+00UniRef50_A0A158QAQ6 Uncharacterized protein n=1 Tax=Enterobius vermicularis TaxID=51028 RepID=A0A158QAQ6_ENTVE  ali  43  396IISAEYAAKIRRLITD-KAHPSSYYGGDFEPVEDHGTTHISVLDSQGNAVSVTSTINLIFGSGVASPSTGIIWNDEMDDFSSPGRPNYFGLLPSKANFIKPKKRPMSSASPLIIYSKDPEEVFVIGAAGGSRIISGVAGVAMRVLWLNEDVKRAVDAPRILNQLTPNVTYYEEGLLQKYRIGLEKRGHTM-VLRSNLSVVTSVERKGDNLYANSDYRKGSSPAG. 621
37 0.000e+00UniRef50_A0A2A3EAH9 Gamma-glutamyltranspeptidase n=1 Tax=Apis cerana cerana TaxID=94128 RepID=A0A2A3EAH9_APICC  ali  47  352.................TSNDPTYYGAITVPPDDSGTSHVSVLAPDGSAVSVTSTINQVFGAMIRSESTGIIFNDEMDDFSSPNITNAFGVPPSPANFIKPGKRPLSSMSPTIVVDEDEHVRLVIGAAGGTKITTSIATAMILNLWSGYDIKQAVDVPRIHHQLLPMIVQYEQGFSTDILNYLSNIGHNITAYTGIGSAITAISKQNGEIFASSDFRREGKTAGF 559
38 0.000e+00UniRef50_A0A2G5BKI1 Gamma-glutamyltranspeptidase 1 n=1 Tax=Coemansia reversa (strain ATCC 12441 / NRRL 1564) TaxID=763665 RepID=A0A2G5BKI1_COERN  ali  39  399.ISKDFATEIRANISDIQTFNVSHYDPEYDVLENHGTTHISVVDADEMAVALTSTINLEFGSRIMDPNTGIILNDEMDDFSTTNATNGFGLRPSPNNKIVPKKRPLSSTSATVIEN-NGHVELVIGGSGGSRILTAVFQVIANVLDFGMRLDVAIDKPRLHHQLMPDQLSIDPLFLSSMTHALAAFGHKIAPLRHASSVVQAVHRSDGLLHAVSDARKHGLAAGY 622
39 0.000e+00UniRef50_A0A1S3KH40 glutathione hydrolase 1 proenzyme isoform X1 n=2 Tax=Lingula unguis TaxID=7574 RepID=A0A1S3KH40_LINUN  ali  44  432LSSKNHAAVTRAKINDDTTQVVDYYGAVFSETDPGGTSHVSILDSQGDAVSVTSTINFYLGSLVRGNITGIVYNDEMNDFSLPSTPNAFGLPPSAANFIHPQKRPMSSMAPAILVDKHGDVQLVLGAAGGSKITSTLAEIIMRCVWFDEDIKQAVDYPRLHDQLIPTTVFYEKNMPSTILASLVERGHNMTLSNPRFSVVEGIQRKDGKVYANCDFRKGGNPAGY 659
40 0.000e+00UniRef50_A0A2N1UTV2 Gamma-glutamyltransferase n=2 Tax=Bacteria TaxID=2 RepID=A0A2N1UTV2_9BACT  ali  38  343LISKTYAQSLQPKLQQARTLHRDQYGLKAAPPSDHGTTHYSIMDRFGNVVAATETINTYFGSQVVIPGTGIVMNNEMDDFSKPGVPNAFGLIGTEANAIAPGKRPLSSMTPTIVL-RDGKPFLALGASGGPRIITGTLQTLLNVVDFGMDVEAAVSAPRFHHQWVPETLYIEREMPFDVRSALMAKGHQL-ASGTAENVVQAVMFRDGVFTGAADPRKGGRPEGY 578
41 0.000e+00UniRef50_UPI00084B7DC3 gamma-glutamyltranspeptidase 1-like isoform X1 n=3 Tax=Hyalella azteca TaxID=294128 RepID=UPI00084B7DC3  ali  41  392LSSESYAAQVRAVLTTSSTHDPHDYGAVAAPPPDHGTSHFSLLAPNGDAVAVTSTINVYFGAGFRGQRTGIIFNDEMDDFSSPNITNYFGIPPSTANFIRPGKRPLSSMAPTVIVDARGDVRLVLGAAGGSKIPSGIANVVMHNLWFGSNIKQAIDARRFHHQLYPMALMYEHGFNQTLMQQLSALGHELQEFSVGGSVVCAVSVEGRALYANSDFRKAGQVAGY 618
42 0.000e+00UniRef50_A0A0E9NB70 Uncharacterized protein n=2 Tax=Taphrinomycotina TaxID=451866 RepID=A0A0E9NB70_9ASCO  ali  40  394LLTKEWAAKARANISSDETYGWEHYGPKYDFIENHGTTHLSVVDEDGMAASITSTVNLYFGSRLMEPTTGIILNDQMDDFSQPGVSNAFNLTPSIYNFIRPFKRPLSSSAPAIIVH-DGDFELALGSSGGSRIVTAVFEAIVRTYDWGFNLLDVVEAPRLHHQLLPASVSVESGVSEDIVNGLKERGHEVDIFPRPRAEVQVVRRTTGWVEGVSDSRKGGVAAGY 627
43 0.000e+00UniRef50_A0A1R1XCA3 Gamma-glutamyltranspeptidase 1 n=5 Tax=Smittium culicis TaxID=133412 RepID=A0A1R1XCA3_9FUNG  ali  42  447..DKEFGNSLRARITDDLTHSYQYYDLKNEIKNDRGTTHLAILDKDDMAVSFTSTINLHFGSKVIDFNTGVIFNNEMDDFGTPGLINAFGLPPSPSNFIAPGKRPMSSTAATIVE-KDGKVEFVLGAAGGSKIITSTTQVLLNVIEFNKSLKQSVDMPRIHNQLLPEITEYEKGYPQFVLDSLEMKKHNLTVMSPGSSIVQGIRRSDGRINAVSDGRRFGIPAAY 669
44 0.000e+00UniRef50_A0A267ERW4 Uncharacterized protein n=2 Tax=Macrostomum lignano TaxID=282301 RepID=A0A267ERW4_9PLAT  ali  43  1MTSSSYASELRSRITDDATHDINYYGPMFEWKEDSGTTHVSLVDSDGNAVAVTSTINTYFGSLVRGEKTGIVYNNEMDDFSQPNRTNYYGLPPSPTNFIAANKRPMSSMAPVIVVNADGHVQFVSGASGGSRITTAVAYTLARQLYLNETVKAAVDSYRLHHQLLPNVLNYNPDPPESIKQRLRQKGHKVQPFSS-TSVVEGIQRSGGQLQANADFRKPSKTGGF 228
45 0.000e+00UniRef50_T1IXD1 Uncharacterized protein n=1 Tax=Strigamia maritima TaxID=126957 RepID=T1IXD1_STRMM  ali  45  308LTSKDYADSLRTKITDNTTFGPEYYGAIFYQPDDYGTAHVSIVAPNGDGVSVTSSINHYFGAKVRSSSTGIIMNDVMCDFANPDILHTSGWPPSPINMIQPGKRPLSSMCPAIFVDRNGDVALVIGSAGGTRITTGTCLVSLRYLRFKEDLQTAIDSLRLHHQLLPNEILYERGFDETILQGLEKLGHCVTEYHLGGPIVVAISKDNGKFYAYSDTRKGGGTSGF 533
46 0.000e+00UniRef50_A0A226EV70 Gamma-glutamyltranspeptidase 1 n=1 Tax=Folsomia candida TaxID=158441 RepID=A0A226EV70_FOLCA  ali  43  637LTSIDYINEIRSLILDHITNNYEYYGAEFYMPENHGTSHLSIVGANGDAIAVTSTVNLHFGAAIRSRRTGIIYNDEMDDFSAPNITNSFGVPPSPNNFIMPGKRPVSSMAPSIFVDPTGRARLVIGAAGGTQITTSIAYATMRNIWLGQTIKEAIDAPRLHHQLYPMELKYESTFPQEYVAEFRAKNHTSVSMDPGSSIVVGVTRENGTLFANSDFRKGGAIAGY 863
47 0.000e+00UniRef50_A0A2R7WF77 Uncharacterized protein n=1 Tax=Oncopeltus fasciatus TaxID=7536 RepID=A0A2R7WF77_ONCFA  ali  43  261LTSPRYAEETRLRINDSMAFDPKHYGAVFYNQEDHGTAHISVLSGDGDAVSVTSSINLYFGAGATSPSTGIVLNSVMDDFSIPGVLNYFNLPPSPNNFLQPRKRPLSSSCPTVVVGADGEVKLVLGASGGTKITTAVSWVIMRNLWFNEDVKQALDASRIHHQLTPMEVSYEFGNLQQVIKGLQKLGHKTTRYRERGSVVCAISKKEGKVFGNADFRKGGEVAG. 499
48 0.000e+00UniRef50_UPI000C6DE506 LOW QUALITY PROTEIN: glutathione hydrolase 1 proenzyme-like n=2 Tax=Centruroides sculpturatus TaxID=218467 RepID=UPI000C6DE506  ali  39  402LLDNKYAQEIRTKIKDDRTMDPKYYGSDYGLLKDGGTGHVSVVSPNGDAVSVTSSINLYFGCKRVSPSTGIVLNNHMNDFSIPNVTNFFGLPPSEKNRIESDKRPMSSMSPAIVTDDMGKVWLVIGGNGGSRITSGIALVTMQLLWLDKNVKEAIDMLRVHHQLFPEYISYENNFPKAILRKLEKLGHKTKKREGIMSVIMAIHRDKGKWHSNADYRKNGESDGF 629
49 0.000e+00UniRef50_A0A257B8A4 Gamma-glutamyltransferase n=7 Tax=Acidobacteria TaxID=57723 RepID=A0A257B8A4_9BACT  ali  30  350LISKDYARARRATIDPCRATPSDAIQPGLEAPEASETTHFTVVDVEGNIVTNTYTLNGPYGSGVTAPGTGVLLNNEMDDFAKPGSPNAFQLIQGESNAIAPGKRPLSSMTPAIVL-KDGKPWLAVGSPGGPTIISTVIQVVINVIDHQMNLQQAIDAPRLHHQWRPDVVMWEPGMTADTRRALEAKGHRLDVIPRYNGDVEAVMIDTGVRLGASDPRNDALAIGY 579
50 0.000e+00UniRef50_A0A0J7KXJ8 Gamma-glutamyltranspeptidase 1 n=1 Tax=Lasius niger TaxID=67767 RepID=A0A0J7KXJ8_LASNI  ali  41  281LTSGSFARAIRKRISDEKTQDPRHYGSSYAGAEDHGTAHVSVLGQNGDAVSVTSTINYYFGSGIVSRRTGIVLNNAMDDFGIPSKMSYFGIPPSPNNYIAPKKQPLSSMVPSVLVDRYGDVKMVVGAAGGTRITTAVSQVTAKILWMKQTVKEAVDSARIHHQLYPPKITYEYGVPKQVIDGLKRLGHATKRYKERGSVVCVIMYENSTIFANADYRKGGDVYG. 506
51 0.000e+00UniRef50_A0A160VDM7 Gamma-glutamyltranspeptidase n=2 Tax=root TaxID=1 RepID=A0A160VDM7_9ZZZZ  ali  30  58LLSESYAIERASNIDLSRATSSQDVKHGGPIKESEETTHYSVVDKEGNAVAVTTTINWGWGNGVTVTGAGFLLNNEMDDFSIPGMPNAYGLLGNEANAIEPTKRPLSSMTPTIVL-KHDKPFLVLGTPGGSTIITSVLQNILNVTLHDMNIKEAVSSPRFHSQWQPDMVFYEKGLSHDVIENLKSRGHNI-ILRGNIGEANGIMINEKGYWGGADSRGENTAIGY 282
52 0.000e+00UniRef50_UPI0001CBABC8 gamma-glutamyltranspeptidase 1-like n=1 Tax=Saccoglossus kowalevskii TaxID=10224 RepID=UPI0001CBABC8  ali  42  543......AEELRSRITDTMTHKTQYYGGIYSQIDDAGTSHICILDEHGNAVSMTSTINYDFGSQVVGNVTGIIYNDEMDDFSTPGLTNTWGYEPSPANYITPGKRPLSSMSPSIIVDKTGDVVMMAGASGGSRIISSMSLAIINAMWFGDSLEEAIMRPRIHHQLLPTEAGYQPQLNQQIIEGLQSKGHVMYVMSDAEQAVQGILRRGGWIYGFSDERKGGKSAGY 762
53 0.000e+00UniRef50_A0A2P6KTC4 Ggt1 n=12 Tax=Arachnida TaxID=6854 RepID=A0A2P6KTC4_NEPCL  ali  39  401LTSDEYADSIRKRIDDEKTYSPDHYGVNVTVHEDHGTAHVSIIAPNGDAVSVT------FGSMVLSPSTGILLNNEMDDFSSPNITNSFDIPPTHKNHVKPGRRPFSSMSPAIITDSNGDVKLTLGGNGGTQITTSIAQIIIRTLWFDEDIKKAIDAPRFHHQLLPNYIEHEERFPKDLLAELKKKGHYLHLLSGMLGIIMGVLRDDGFLYANSDYRKG...... 615
54 0.000e+00UniRef50_UPI00094794B2 gamma-glutamyltranspeptidase 1-like n=2 Tax=Branchiostoma belcheri TaxID=7741 RepID=UPI00094794B2  ali  49  312MTSDDYAESLRLRITDSTTHDYRYYGPSFVLPEDGGTSHVSVLAPNGDAVSVTSTVNLFFGSKLRSASTGVILNNLMDDFSSPNLTNSFGVPPSPANFIRPGKRPMSSMNPTVVVDGNGDVRLVTGASGGTKITTATAYVLMQHLWFGLDLGPAVEKPRLHHQLLPDRVDTERSFPEAVLEGLRQKNHVTNVAGS--AIVNGVARNGDVISAACDSLKGGFPVGF 537
55 0.000e+00UniRef50_T1J7U9 Uncharacterized protein n=1 Tax=Strigamia maritima TaxID=126957 RepID=T1J7U9_STRMM  ali  40  365LTKPETADWIRSQISLDKTFPPSHYGLDNVRQDDYGTAHMSVVSPQGDAVSVTSTVNFWFGAGLMSPSTGIILNNEMDDFTFPKESKIVEEMPMLANKLEPKKRPLSSMCPTIIINGTGHPVLVIGAAGGSRIITGTAMVVARILWWDTDIKDAIDAPRLHHQLIPNHVEYENGIPKTVLQGLVKIGHQLKLRGAYGSVVVGIHRNKDELISNYDFRKGGSVAGF 590
56 0.000e+00UniRef50_UPI000BAF9CE6 gamma-glutamyltranspeptidase 1-like n=1 Tax=Crassostrea virginica TaxID=6565 RepID=UPI000BAF9CE6  ali  41  163LTSTKFANLVRKMITDNATHSTPYYGPVFNHKLKTSTAHLSLLGHDGIAVSVTTTVNLLFGSGVTGKRTGILFNDEMDDFSSPNITNAFGIPPSPTNYIKAGKRPMSSMCPAVLADKSKKTKMVVGAAGGSRITTSTAYVAAHALWFGYNIKEAIDARRLHHQLIPQTTFYEPDFPQFFLNGLEEKGHNITLTELGHSIVNGIVQGKEWIYANNDFRRPGGSSG. 386
57 0.000e+00UniRef50_Q8EFL9 Gamma-glutamyltransferase GgtA n=420 Tax=Bacteria TaxID=2 RepID=Q8EFL9_SHEON  ali  33  354LTDKDYAQKIASQIALNKTTPSEEIKPGNLAPESDQTTHFSVVDRWGNAVSNTYTLNFSYGSGLVAKGTGILLNNEMDDFSKPGSPNGYGLVGGEANSVEGNKRPLSSMSPTIVM-KDGKPFLVTGSPGGSRIITTTLQIIMNVIDHGLNIAEASNAARVHHQWLPDELRVETSLNRDTISLLEAKGHKVNVQSAMGST-QSIMVTEQGIFGASDLRHSGSAVGY 579
58 0.000e+00UniRef50_G3QKH2 Uncharacterized protein n=4 Tax=Catarrhini TaxID=9526 RepID=G3QKH2_GORGO  ali  91  319MTSEFFAAQLRAQISDNTTHPISYYKPEFYTPDDRGTAHLSVITEDGSAVSATSTINLYFGSKVCSLVSGILFNNE--------WTTSFGVPPSPANFIQPGKQPLSSMFPTIMVGQDGQVRMVVGAAGGTQITTATALTIIYNLWFSYDVKRAVEEPQLHNQLLPNITTVERNIDQAVTAALETRHHHTQIVSTFIAVVQAIVRTAGGWAAASDSRKGGEPAGY 535
59 0.000e+00UniRef50_A0A1B6LHD1 Uncharacterized protein (Fragment) n=22 Tax=Neoptera TaxID=33340 RepID=A0A1B6LHD1_9HEMI  ali  42  371LTSPEYISAIRSKIVDTSTSDPRDYGGHYDVLEDHGTANIVVLAPSGDAVSVTSTVNLLFGSQFVSPSTGIILNDEMDDFSAPAITNYFGLPPSPANYIAPGKRPLSSMCPSLVVDSNGDVRLAVGSAGGTKITTSTALVTILNLWFGKSIKEAIDHARYHHQLMPMIFAYEYGLEKDVVDSMRRIGHKVKRMPTWRSCVTAIAKNGSTITSNSDNRRPGRSAGF 597
60 0.000e+00UniRef50_UPI0003EAF65C inactive glutathione hydrolase 2 isoform X1 n=6 Tax=Homo sapiens TaxID=9606 RepID=UPI0003EAF65C  ali  99  188MTSEFFAAQLRSQISDHTTHPISYYKPEFYTPDDGGTAHLSVVAEDGSAVSATSTINLYFGSKVCSPVSGILFNNEWTTSALPAFTNEFGAPPSPANFIQPGKQPLLSMCLTIMVGQDGQVRMVVGAAGGTQITTDTAQAIIYNLWFGYDVKRAVEEPRLHNKLLPNVTTVERNIDQAVTAALETRHHHTQIASTFIAVVQAIVRTAGGWAAASDSRKGGEPAGY 439
61 0.000e+00UniRef50_A0A212K1T2 Gamma-glutamyltranspeptidase n=84 Tax=Proteobacteria TaxID=1224 RepID=A0A212K1T2_9PROT  ali  33  337LLSKSYAADIRKRIDPAKATPSAAVQPGTPPHEKPETTHYSVVDADGNAVSVTYTINGAFGAGVVAPGTGFLLNNEMDDFTVPGVKNLYGLVQGKANSIAPGKRPLSSMSPTLVT-KDGKTLLVLGSPGGSRIITITLETILNVVDYGMAPQEAVDAPRIHHQWLPDTVYTEPGLSPDTVRILEAMGHTVTEQKPWGAAAHSGKVREGFLYGANDARRPGAAVGY 585
62 0.000e+00UniRef50_UPI000C760082 glutathione hydrolase 1 proenzyme-like isoform X1 n=3 Tax=Eurytemora affinis TaxID=88015 RepID=UPI000C760082  ali  39  470ITSEAWARSVYRKINDRQTYDLEYYGAEFSMVPDKGTAHLTVLAENGDAVSVTSTVNTNFGCELMSPSTGIIYNNEMNDFSFPFFSNDFNLPPSPSNYVKPGKRPQSSMCPAIILDNQGKVRLLIGGAGGTRITTGVAQTLASHIWLKKSIQESIDHPRLHHQLAPNQLEYQTEFNKDILAGLIEKGHQLKDRGTAGSILTAVHIENGGFLGVSDYRKAGGVDGY 695
63 0.000e+00UniRef50_T1L0I9 Uncharacterized protein n=1 Tax=Tetranychus urticae TaxID=32264 RepID=T1L0I9_TETUR  ali  41  381LLSPEFVKTVAARINDERTYPQTYYSSLVSLAKDQGTSHVSIVDKYGNAASASSTINAYFGGGVMSQSTGIIFNNEMDDFSSPNITNQYGLPPTEFNKIEPGKRPLSSMCPAVIVDESGEVRIAIGASGGAQITSSVALNIARNQFLGEDLKSTIDAPRIHHQFSPNVIKYESDFPKNILAELQDRGHKVEVITGRSSIVMAVARTDGKLTANSDYRKGGSIDGY 606
64 0.000e+00UniRef50_S4RKC0 Si:ch73-236c18.3 n=3 Tax=Deuterostomia TaxID=33511 RepID=S4RKC0_PETMA  ali  54  310LTSEDYAQALRWKISGDSTHPARFYESMFSHAEDAGASHVSVVAGDGSAVSATSSINLGFGSLVRSRTTGIIFNNAMDSFSSPFTINTSGVQPSPANYIQPGKRPLSSMCPAVVMDEDAQVKMVVGAAGGIRIVTSAALAIINTLWFGQDIKAAVSAPRLHHQLLPNKVIVEDGFDQAVVDGLRCRNHEVALQSPAASVVQAIVRVGSHWCAESDYRRGGRPAGY 535
65 0.000e+00UniRef50_UPI0009E4A537 gamma-glutamyltranspeptidase 1-like n=2 Tax=Eumetazoa TaxID=6072 RepID=UPI0009E4A537  ali  44  48MTNADFAESLRQNIWDNKTFDSTYYGNFYLNSSQQGTTHLSVIAENGDAVSATMTINLYFGSKYRSTRTGIIYNNEMDDFSTPGKKNAFGVEPSESNMIYPGKRPQSSTAPTIFLDKDGVVRLVIGASGGTKITTAISLVTMNYLWFNRTLPQAVVDPRLHHQLLPMYIRIDKDYPMAIQEGLQKLGHEVKNVSG-YAVVQAVARNDGTLTGKSDPRKSGWAAGY 275
66 0.000e+00UniRef50_K5W5T8 Uncharacterized protein n=20 Tax=Agaricomycetes TaxID=155619 RepID=K5W5T8_PHACS  ali  40  404...KEFAEKIFANITDEHTHTPEYYQPVYDVPIDHGTSHSSIVDKNGMAVAITSTVNLIFGSQVLDSETGVLLNDELDDFSIPGTPNAFGLFPSPYNYPQPGKRPLSSTAPTIIEDSDGALWAVIGGSGGSRIFPALFQTLMN-LDWGLDASGAVEFGRVHDQLFPAVVDVDNVYPAALLDGLRARGHNVSVADRIAAVVQLVTQESGTLYAASDSRKRGKAAGY 626
67 0.000e+00UniRef50_A0A1Y1LMA5 Uncharacterized protein n=8 Tax=Polyphaga TaxID=41084 RepID=A0A1Y1LMA5_PHOPY  ali  43  339LTSFGYAKQLRRNFTLDRTFDPHHYGANYSIEEDHGTAHVSILAPNGDAVSVTGTINQVFGAGFMSPRTGIILNDEMDDFSAPGITNHFGVPPSPANFIRPFKQPLSSMCPSIVVDKNGDVVLVIGAAGGTKITTTTSLVIMRELWFGEDLSVAVNASRLHHQLVPMAVSYEPDFDKFIKLKLETIGHKITPTEDGFAAVTAVSRRNGIITGSIDPRRGGSVS.. 564
68 0.000e+00UniRef50_A0A0S3UCB3 Gamma-glutamyltransferase n=1 Tax=Leptolyngbya sp. NIES-3755 TaxID=1752064 RepID=A0A0S3UCB3_9CYAN  ali  36  65LISPEYAKIRQREIDPKKATSVKPGDPAVIQRESTETSHLTVVDRDRNAVSLTFTINLGFGAGIVAKGTGIVLNNEMDDFAIPNTPNAFGLVGGQANAIAPRKTPLSSMTPTIIT-ENGKLRMAVGAPGGSTIITTVLQTILNVLVYDMDVRSAIAAPRIHHQWQPDRLNVERGLDPLTIAELERRGHTIRQRGKW-GNANAIVVPDGLLEGAADPRGEGVAAGY 294
69 0.000e+00UniRef50_A0A0S8AGQ5 Uncharacterized protein (Fragment) n=2 Tax=Bacteria TaxID=2 RepID=A0A0S8AGQ5_9BACT  ali  35  143LLSKSYASAQRATIDPARATPSAQLVPG--RKEGDHTTHYSVVDAEGAAVSVTTTINSGYGSAVTVEGAGFLLNNEMDDFTAPGQPNQYGLVQGEANAIQPGKRMLSAMTPSIVLDPDGRLLMVVGTPGGPTIITTVTQVISNVIDHGMTLAEAVAAPRIHHQALPDQIYFERGLRPEVVAQLESMGHTLRRRGGYSGEVAGIMRVETGWVGVADPRSGGGAAGY 367
70 0.000e+00UniRef50_A0A1J5Q9X8 Gamma-glutamyltranspeptidase n=4 Tax=root TaxID=1 RepID=A0A1J5Q9X8_9ZZZZ  ali  33  93LISKDYAARQRASIDLDHATPWTDALSAVPPREGSNTTHFSVVDSQGNAVSNTYTLNFSYGVGLVAEGTGVLLNNELDDFAAPGASNAYGLVGFEANLPGPGKRPLSSMSPTIVL-KDGKPVLVTGSPGGSRIISTVLQVIVNVLDYKMDVAAAVAAPRLHHQWLPDEVRIERGFAEDTLAALRAKGHRVVEPMGQTS-ANSIAMTPDGLRGAPDPRRGAEAAG. 316
71 0.000e+00UniRef50_UPI00077FCC05 gamma-glutamyltranspeptidase 1 isoform X1 n=6 Tax=Arachnida TaxID=6854 RepID=UPI00077FCC05  ali  44  410LKSPSYAKSIFEQISDDTTFPPAHYKPEMEMVADEGTAHVSVLAPNGDAVSVTSTVNTYFGSLCRSPSTGIILNNGMDDFSSPNIVSYYGVPPSPANDISPGKRPLSSMCPTIIVDKEGEVKMVVGAAGGTRIITASAQGVIRTLWLSEDIKMATDAPRLHHQLFPNAVQYESGFPEIYRDKLKEYGHEVLE-DTKDSEFFGIVKQDGKIKTNLDFRKGGSAEGF 633
72 0.000e+00UniRef50_A0A069XN73 Gamma-glutamyltransferase n=11 Tax=Enterobacteriaceae TaxID=543 RepID=A0A069XN73_ECOLX  ali  32  185LTNKAYAKSIADQIDINKAKPSSEIRPGLAPYESNQTTHYSVVDKDGNAVAVTYTLNTTFGTGIVAGESGILLNNQMDDFSKPGVPNVYGLVGGDANAVGPNKRPLSSMSPTIVV-KDGKTWLVTGSPGGSRIITTVLQMVVNSIDYGFNVAEATNAPRFHHQWLPDELRVEKGFSPDTLKLLEAKGQKVALKEAMGST-QSIMVPDGELYGASDPRSDDLTAGY 411
73 0.000e+00UniRef50_A0A210PJB8 Gamma-glutamyltranspeptidase 1 n=1 Tax=Mizuhopecten yessoensis TaxID=6573 RepID=A0A210PJB8_MIZYE  ali  45  404MTSAAYSESIRQQITDDRTHDTPFYGPTFYVNNDAGTSHLSVLTPNGDAVSITSTVNLHFGSKEVGSRTGILFNDEMDDFSTPNTVNYFGVPASPANFIKPYKRPLSSMCPSIITDSNGDVKLVIGAAGGTKITTSTALTSIETLWFGMSMKEAIDHRRLHHQLLPKEIAVEIGFDEDVLAGLRQKGHNMTMNASAGCIVQGVLKNEKSISGCSDYRKKASPDGF 629
74 0.000e+00UniRef50_A0A1L8E287 Putative gamma-glutamyltransferase (Fragment) n=2 Tax=Nyssomyia neivai TaxID=330878 RepID=A0A1L8E287_9DIPT  ali  39  438LTSDEYAENIRVKIEDTFTQEPKDYGGNFHISEDHGTAHISLLAPNGDAISVTSSVNFYFGCGNMGNRTGIIFNSGMDDFSSPGLKNYFGLPGSPPNYIRPRKRALSSMSPTIVVGTDGNVKLVIGAAGGTKITTAVAMATMRILWFGQDVKEAVDAPRFHHQLIPMWVDYEYGTQDYLVDGLEELGHKMNRYNYRGSIICAIKRNDTAIYGNADFRKEGDVFGF 663
75 0.000e+00UniRef50_A0A026X1J2 Gamma-glutamyltranspeptidase n=3 Tax=Ooceraea biroi TaxID=2015173 RepID=A0A026X1J2_OOCBI  ali  45  443LTSKSFARAIRKKINDERTQDPRHYDSSIFGTEDHGTAHISVLAENGDAVSVTSTINYYFGSGMVSRRTGILLNNGMDDFSIPSRLSYFGIPPSPNNYIAPGKQPLSSMVPSIFVDQHGDVRMVVGAAGGTKITTAVALVTAKIFWMGQTVKEAVDSARIHHQLFPPEVAYEYGVPKQVIDGLKLRGHVTKRYRERGSVVCVILYANSTIFANADYRKGGDVYG. 668
76 0.000e+00UniRef50_A0A0P5TYI4 Gamma-glutamyltranspeptidase 1 n=166 Tax=Daphnia TaxID=6668 RepID=A0A0P5TYI4_9CRUS  ali  42  462LASKRFADETFEKFNDSYTSDPAFYGAVIHNPDSKGTSHISVLDRDGLAVSVTTTVNTYFGAGFISEQTGIIMNNEMDDFSSPNTTNFFGVPPSPANFIRPGKRPLSSMTPTIVVDSEGKVRSVIGAAGGTRITTSVVYTLIRNLWFGDNIKEAIDSYRIHHQLMPMDFQYEAGFPKTIVEGLRKRGHNVME-RVLRSAVYAISVEDGVIYANADYRKGGDVAG. 687
77 0.000e+00UniRef50_UPI0003595EEB gamma-glutamyltranspeptidase 1-like isoform X1 n=6 Tax=Gastropoda TaxID=6448 RepID=UPI0003595EEB  ali  45  379MTSLAVCEEIRQRISDEKTHDTAFYDPPFSVANDSGTTHISVIDGEGNAVSVTSTINTYFGSKVRGSRTGIVFNNEMDDFSTPGTVNYFGLPASPANFIQPGKRPMSSMCPAIVWDNNQRVKMVSGGAGGSKITTATALNIIDVLWLGISLPESIDKPRLHHQLVPNAIMLEKTFSKVILNGLKAKGHAIRD-KFGYSVLQAIVRDDGSIVGTADFRKGGVPKG. 603
78 0.000e+00UniRef50_A0A2C9K0V8 Uncharacterized protein n=2 Tax=Euthyneura TaxID=216307 RepID=A0A2C9K0V8_BIOGL  ali  44  310LTSRDYADSLRGRINDSRTYDYTYYGPAFESGSANGTSHLSVLDKDGNAVSATSTINTRFGSYRAGKRTGIIFNNEIDDFSFPNTTNEWRIAPSPANYIAPGKRPLSSMCPVVITDRHGSVSKVIGAAGGSLIPSAIVWVTSHLLWFGESLHQAVSQPRLHHQLIPHLVAYERGFDEDVLQGLITLGHNVTEFP-IISAVQAIDVRDGAIVAESDVRRKGKPDGY 535
79 0.000e+00UniRef50_K1QBZ0 Gamma-glutamyltranspeptidase 1 (Fragment) n=2 Tax=Crassostrea gigas TaxID=29159 RepID=K1QBZ0_CRAGI  ali  42  359LTSADFADKIRKMIWDNATHTTPYYGPVFNHKLKTSTAHLSVLGNDGIAVAVTSTVNLLFGSGVTGKRTGILFNDEMDDFSSPNITNAFGIPPSPANFIKPGKRPMSSMCPAVLADKTKRVRLVVGAAGGSRITSATAYIAAHVLWFGYNIKEAIDARRLHHQLIPQQAYYEPDFPQYFIDGLRDKGHNMTFNELGESIANGIVQDKDWIYANNDFRRPGGSSG. 582
80 0.000e+00UniRef50_K7IVN9 Uncharacterized protein n=6 Tax=Pteromalinae TaxID=272242 RepID=K7IVN9_NASVI  ali  42  389LTSKDYARSIRMMIRDNRTEDPVHYGPNFTNPDDHGTAHISVIAANGDAVSVTSSINMYFGSGVASENTGVLMNSGMDDFGVPGLLSYFGIPSNPNNYIAPGKRPLSSMSPTIFVDNNGDVKMTIGAAGGTKITTSIPFVIARHLWMGNTVKEAVDAPRIHHQLYPMEVSYEYGVPKPVVDGLKALGHKTSRYRGRGSVICLLVRVNNTIYANADHRKGGDVYG. 614
81 0.000e+00UniRef50_A0A284QMG9 Related to gamma-glutamyltransferase n=4 Tax=Agaricomycetes TaxID=155619 RepID=A0A284QMG9_9AGAR  ali  39  382...KAFANIIFPNITDGHTHPPDYYNPEYDVLTDHGTSHTSIVDKNGMAVSLTSTVNLVFGSEVLDPVTGVILNDEMDDFSIPGTPNGFGLWPSPYNYPEPGKRPLSSTTPMIIENANGSFYLSIGASGGSRIFPSVFQVLLN-LDWGLDLSEAIEFGRLHDQLYPLFLDADNVYPSDLLDDLRSRGHNVTVADRVAAVVQGVMIKDGMIFAASDSRKNGIAAGY 604
82 0.000e+00UniRef50_Q14390 Glutathione hydrolase light chain 2 n=15 Tax=Deuterostomia TaxID=33511 RepID=GGTL2_HUMAN  ali  86  1MTSEFFAAQLRAQISDDTTHPISYYKPEFYTPVDGGTAHLSVVAEDGSAVSATSTINLYFGSKVRSPVSEILFNDEMDDFSSPNITNEFGVPPSPANFIQPGKQPLSSMCPTIMVGQDG-------------QPPSHAQAIIYNLWFGYDVKRAVEEPRLHNQLLPNVTTVERNIDQAVTAALETRHHHTQIASTFIAVVQAIVRTAGGWAAASDSRKGGEPAGY 218
83 0.000e+00UniRef50_A0A0A9YCN9 Gamma-glutamyltranspeptidase 1 n=1 Tax=Lygus hesperus TaxID=30085 RepID=A0A0A9YCN9_LYGHE  ali  40  189MISENYAEEVRKKIDDKKTFSPRHYEAVEFGSSDYGTNHVSVLSADGDAVAATSSINLYFGAGFTSKRTGILLNSVMDDFSIPGITNYFDFIPSSHNYVEPGKKPLSSACPTIIVDQNGDVKIVLGASGGSRIITAMAWIIMRMLWLGEDLKAAVDASRIHHQLSPMVLSYEYGILKQVAEGLKQLGHDVERYTVRGSVVCGITKTNGTIHVNADFRKFGGVTG. 413
84 0.000e+00UniRef50_B3WVT0 Gamma-glutamyltransferase n=11 Tax=Proteobacteria TaxID=1224 RepID=B3WVT0_9ENTR  ali  32  132LTNKAYAKSIADQIDINKAKPSSEIRPGLAPYESNQTTHYSVVDKDGNAVAVTYTLNTTFGTGIVAGESGILLNNQMDDFSKPGVPNVYGLVGGDANAVGPNKRPLSSMSPTIVV-KDGKTWLVTGSPGGSRIITTVLQMVVNSIDYGMNVAEATNAPRFHHQWLPDELRVEKGFSPDTLKLLEAKGQKVALKEAMGST-QSIMVPDGELYGASDPRSDDLTAGY 358
85 0.000e+00UniRef50_W6MCX4 Gamma-glutamyltranspeptidase n=1584 Tax=root TaxID=1 RepID=W6MCX4_9GAMM  ali  33  353LTAKAYARELVARIDLNRARPAAEIKPGQPQHESDQTTHYSVIDRDGNAVAVTYTLNFGYGSGIVAAGTGILLNNEMDDFAKPGTPNAYGLIGGDANAVGPGKRPLSSMSPTIVL-KDGQPVLVTGSPGGSRIITTVLQTVSNVIDHQMNIAEATLSPRLHHQWLPDELRLEEGFSPDTVQLLRTWGHKVVVKDAM-GDTQSIVRTPDGLYGFSDTRRGGLAVGY 578
86 0.000e+00UniRef50_G4T8C6 Related to gamma-glutamyltransferase n=5 Tax=Basidiomycota TaxID=5204 RepID=G4T8C6_SERID  ali  36  465...KEYAQHIFPNITDDTTHEAAYYNPVYDVPEDHGTTHTSALDRNGMAVALTSTVNLVFGSHVMDPETGIILNDEMDDFSKPGIPNAFGLWPSPYNYPAPGKRPLSSTAPTIVTEDDETFFLALGGSGGSFIFPSVVQTLLNV-DWGMDIRQAIEAPRIYDQIFPYTTVVETTYNERAVEGLRDRGHNITLWNDSFAAVQGVMQENGKITAASDSRKLGVAAGY 687
87 0.000e+00UniRef50_A0A1D2NFN3 Gamma-glutamyltranspeptidase 1 n=1 Tax=Orchesella cincta TaxID=48709 RepID=A0A1D2NFN3_ORCCI  ali  43  365LTSTDYINEIMELIHDDSTNNYEYYGAEYWQPEDHGTSTMSLVAPNGDAIAVTSTVNLYFGSMLRSRQTGIIYNDMMDDFSSPNITNAFGVPPSVNNFIKPGKRPVSSMTPTIFTDSEGKVRLVIGGAGGTQITTSVTLVAIRNLWFGENIKEAIDARRMHHQLYPMELECEAGFSSSVVEGLKAVGHVVKQPENFISVVQAIAIENGTIYANSDFRKKGTVAGY 594
88 0.000e+00UniRef50_A0A2T9YT08 Uncharacterized protein n=1 Tax=Smittium simulii TaxID=133385 RepID=A0A2T9YT08_9FUNG  ali  42  431..SKEYAAQVRKNITDFQTHNFEYYNPEFDIKEDHGTTHLSVVDKNGMAVSLTSTINLIFGSKVMDPYTGVLFNDHMDDFSTPNLKNAFGLYPSPKNFIKPKKRPLSTTSALIVE-KNGKLQFIMGASGGSKILTSTTQVLLNSLEFNMTLKDAVDAPRLHHQLLPQQLLFESNYSKLISDGLALKGHKLDDLPIGTCNVQAIQIHNGTINAVSDGRKFGAPYG. 652
89 0.000e+00UniRef50_A0A2H5ZZY5 Gamma-glutamyltranspeptidase n=41 Tax=Bacteria TaxID=2 RepID=A0A2H5ZZY5_9BACT  ali  34  356LLSKEYAATLRSEIDPQKASKTPAF--VSSGSEGTNTTHYSIVDSRGNAVSVTTTINSSYGSGVTVTGAGFLLNNEMDDFAAPGRPNQYGLVQGEANAIAPGKRMLSAMTPSIVLDPQGRLRMVLGTPGGPTIITSVAQVILNVIDHGMTLAEAVAAPRIHHQAWPDQIFYERGLSDAVVETLRSWGHTVEERSGYSGDIAAIEWRGGRWIGVADPRRGGGAAGY 580
90 0.000e+00UniRef50_E7D126 Gamma glutamyl transpeptidase (Fragment) n=1 Tax=Latrodectus hesperus TaxID=256737 RepID=E7D126_LATHE  ali  43  94LANRTYADEIRSKIDDKETHDPDYYGVNVTIPENHGTAHLSIIAPNGDAVSVTSTINHYFGSQVMSPSTGILLNNEMDDFSSPNITNFFGVPPTGKNHIRPGRRPMSSMTPAIVVDSDKNARLVVGGNGGTQITTSVAQVIIRNLWLGENIKQAIDAPRFHHQLLPNYIEHEENYPEDILEELKAKGHELKKLNNMLGIIMGV...................... 297
91 0.000e+00UniRef50_U5ET38 Putative gamma-glutamyltransferase (Fragment) n=5 Tax=Neoptera TaxID=33340 RepID=U5ET38_9DIPT  ali  38  290LTSTEYADEIRAKINDFTTTNPREYGANFYSKDSHGTAHISVIGPNGDAVSSTSSVNFYFGAALTGKRTGIVLNSQMDDFSSPGLKNYFGLPGSEPNYIRPHKRALSSMSPTLILDKDRNIKLVIGAAGGTKITTAVSMAIMKSIWFGGNIKEAVDLPRFHHQLIPMEIQYEYGNLQQVIDGLEAIGHKTRRYRERGSIICGITRNSTGVYANADYRKGGDVVGF 515
92 0.000e+00UniRef50_A0A1W2WAJ8 gamma-glutamyltranspeptidase 1-like n=3 Tax=Ciona intestinalis TaxID=7719 RepID=A0A1W2WAJ8_CIOIN  ali  49  263MTADWYADDLRLKINDDHTWPVDYYGPDWSVPDDSGTAHLSVLAPNGDAVAITSTINLYFGSKVRGKYTGIIFNNEMDDFSSPNITNAFGVPPSPANYISPGKRPFSSMTPTIIMKKGKKPLMVVGASGGTFITSATTLVTMNSLWFGFNVGESVEMKRIHDQLMPNVTQCEAGLHQDIITGLRHKGHNVTVRKK-ISAVQAILLEDGRVSAASDSRKGGYPDGF 488
93 0.000e+00UniRef50_UPI0002652B6A gamma-glutamyltranspeptidase 1 n=1 Tax=Strongylocentrotus purpuratus TaxID=7668 RepID=UPI0002652B6A  ali  44  377MTAQSYADALRARIDDDRTHNYTYYEPEFQLVEDSGTSHISIVDQYGNAAAITSTINTFFGSKVRGEKTGIIYNNEMDDFSQPGVNNFYGVPPSPSNFIEPGKRPMSSMTPVIVVDREGDVRLVTGASGGTRITLSASLVSIENLWFGSSIRDAIERKRIYHQLIPEDPFYEDGFPQDIVDGLARKGHRP-LVSSRSAVVQGIERDDGLLRAHSDSRKGGIPSGF 601
94 0.000e+00UniRef50_A0A0T6W469 Gamma-glutamyltranspeptidase n=9 Tax=Proteobacteria TaxID=1224 RepID=A0A0T6W469_9ALTE  ali  33  360LTSKDYAAELRKGIAPDKARPSLEIKPGQPAVESPETTHFSVVDRWGNAVSNTYTINFSYGSGITVAGAGFLLNNEMDDFSKPGAANAYGLIGGEANKIEPGKRMLSSMSPTIV-RKDGKNVLVTGSPGGSRIITTTLQVVMNVIDHNMNIQTAVSAPRMHHQWLPDEIRIEQGISQDTIELLESRGH-VVNTSTAMGAIQSIMVEDGTLFGGADPRRSSSAMGF 586
95 0.000e+00UniRef50_A0A2C9K5N7 Uncharacterized protein n=1 Tax=Biomphalaria glabrata TaxID=6526 RepID=A0A2C9K5N7_BIOGL  ali  43  282MTSLEYGERTRQRIDDDITNETNYYQPTSYINNDAGTAHISVVDVEGNAVSVTSTINTYFGSRVRGNRTGIIFNNEMDDFSTPNSPNYFGLPASEANFIRPGKRPMSSMCPAILWDKSKRIKLVTGAAGGSKITSATALNIIDVLWFGMPLPASIDRPRLHHQLMPPELVVEKDYPETILNGLRAKGH-VTKNMVGYSVIQAVDVLENGIIGTADFRKGGEPSGY 506
96 0.000e+00UniRef50_A0A0J7KHC8 Gamma-glutamyltranspeptidase 1 n=1 Tax=Lasius niger TaxID=67767 RepID=A0A0J7KHC8_LASNI  ali  42  208LTSNDYAETIKERIKDDRTQDPEEYGAVTETTVDSGTAHVSVLAPDGSAVSVTSTINQVFGAMIRSESTGIIFNDQMDDFSSPNITNGFDLPPSPANFIRPGKRPLSSMCPTIVVDQNNDVRLVIGAAGGTKITSGVAIALVLHLWSNYNIKEAVDARRLHHQLFPMNVQNEKDFCPDTLNYLSKIGHNITTFSGIGSAITAVSKENGLITANSDYRRQGRTAG. 432
97 0.000e+00UniRef50_A0A1C7NR15 Gamma-glutamyltranspeptidase 1 n=2 Tax=Mucorineae TaxID=1344963 RepID=A0A1C7NR15_9FUNG  ali  42  383LTNKDFAADIRQKITDDTTHDPLYYNPKFDHIESHGTMHLSVVDENDGAVALTSTVNLAFGSHVMDPDTGIILNDEMDDFSIPGVPNQFGLYPSEDNYAGPGKRPLSSITPTIVEM-DTKFEMVLGGSGGSFIPTATLNALINVLDFGKDMYRAVASPRIHHQLLPNTAITENGYSHKIEKELEAKNHQVFQIPSSFSAVQGVRRPDGTIEAASDPRKMGIAAAY 609
98 0.000e+00UniRef50_A0A1B6HBW4 Uncharacterized protein (Fragment) n=4 Tax=Cicadomorpha TaxID=33365 RepID=A0A1B6HBW4_9HEMI  ali  42  180LTSPEYIAKIRSKISDTWTSDPKFYGGHYDTLEDHGTANIVVLAPNGDAVAVTSTVNLLFGSQFVSPSTGILLNDEMDDFSAPSITNYFGLPPSPANYIVPGKRPLSSMCPSLVVDSNGDVRLAVGSAGGTKITTSTALVTILNLWYDKNIKEAIDHARYHHQLMPMTFAYEYGLVKEVVQGMKRIGHKVTRMPAWRSCVTAIARNGSTITSNSDFRRPGRSAGF 406
99 0.000e+00UniRef50_A0A1Y1Z881 Gamma-glutamyltranspeptidase n=2 Tax=Fungi incertae sedis TaxID=112252 RepID=A0A1Y1Z881_9FUNG  ali  43  370..DKKYAAQVRQNLSDIRTFPISHYNPKFDVEESPGTTHLSVVDKNQLSVALTSTVNLYFGSQVLDLNTGVILNNEMDDFSIPGVSNAFNLPPSPNNFVAPKKRPLSSSVPTITEF-NGDLELVLGASGGSRITTAVLQTLINALDFDMNLADAVEYPRLHHQLYPNLAYYEAQYPQDIQRGLSERHHNVTLMP-FHAVVQAIRRPEGKIHAVSDPRKQGVASGY 591
100 0.000e+00UniRef50_K1R1G5 Gamma-glutamyltranspeptidase 1 n=7 Tax=Pteriomorphia TaxID=6545 RepID=K1R1G5_CRAGI  ali  50  397MTSSSYADYVRSRISDDSTHDTMYYGPTFYDQSKTGTSHLAVLAPNGDAASITSTINLYFGSKVVGKRTGIFFNNEMDDFSTPNTTNYFGVPASAANFIKPGKRPLSSMCPSIVVDSDGHVKLVVGASGGTKITTSTALVSIETLWFKYGIKKAIDHKRLHHQLLPAYITVEEGFDPQVINGLRRIGHNITMSASAGSIVQGILQEEGMITANADYRKRGVPDGY 622
101 0.000e+00UniRef50_A0A1Y1ILJ3 Gamma-glutamyltranspeptidase n=1 Tax=Klebsormidium nitens TaxID=105231 RepID=A0A1Y1ILJ3_KLENI  ali  46  403MLSSDFAAQVRANISDDRTFPPEYYGGKWSQLDDHGTSHVSIVDSERNAVALTTTINTGFGSKVVSPSTGIILNNEMDDFSIPDTRNSFGLAPSEANFIRPGKRPLSSMSPTIVVH-NGVVRMVAGASGGPRIITGTAQVLLNFLAGGKDPLAAVVAPRIHHQLIPDEIAYETELPPDVRNALLRRGHKLVPT-TFGSVCQVVVHDLGPLTAVSDPRKDGAPAG. 651
102 0.000e+00UniRef50_A0A0K1UE64 Gamma-glutamyltranspeptidase n=141 Tax=cellular organisms TaxID=131567 RepID=A0A0K1UE64_9ALTE  ali  32  361LTSKGYAEELRKGIDPDRARPASDINPGQPAAESPETTHFSVVDKWGNAVSNTYTINFSYGSGITVEGAGFLLNNEMDDFSKPGVPNAYGLIGGEANKVEPGKRMLSSMSPTIV-KKDGKNVLVTGSPGGSRIITTTLQVILNVIDHGMNIQTAVSAPRMHHQWLPDEIRIEQGISPDTIRLLQERGHTV-VGGSAMGAIQSILIDEGVLNGGADPRRSSSAMGY 587
103 0.000e+00UniRef50_K7J8Z0 Uncharacterized protein n=21 Tax=Apocrita TaxID=7400 RepID=K7J8Z0_NASVI  ali  43  378LTSKDYANAIRSLIEDTKTHDPKYYGAVTTNQREHGTSHTCVLAPDGSAVSVTSTINQVLGAKIRSSSTGIIFNDEMDDFSSPNITNGFDLPPSPANFIKPGKRPLSSMSPTIVLDANRRVRLVVGAAGGSKITTAVAAIMIFNLWNDYDIKEAIDAYRIHHQLFPMQVQIEHDFPPYVLHYLREIGHSITTYAGIGSAVTAISDNNGRITANSDFRRQGATAGF 603
104 0.000e+00UniRef50_A0A0B7A030 Uncharacterized protein (Fragment) n=3 Tax=Gastropoda TaxID=6448 RepID=A0A0B7A030_9EUPU  ali  45  258MQSLAYGEETRKKINDLFTHDTNYYNPTYQLNNDEGTAHISIIDAEGNAVSVTSTINTYFGSKVKGNRTGIIFNNEMDDFSTPNSTNYFLLPASPANFIKPGKRPMSSMCPVIVVDNNGEIKLVAGAAGGSKITTASALNIIDVLWFGMSLSASVDRPRFHHQLIPPEIQVEDNYPQVILDGLRAKGHK-TVTMQGISVVQAASVLQNGILAVADWRKGGVPCGY 482
105 0.000e+00UniRef50_UPI0003EB0381 inactive glutathione hydrolase 2 isoform X2 n=1 Tax=Homo sapiens TaxID=9606 RepID=UPI0003EB0381  ali  99  188MTSEFFAAQLRSQISDHTTHPISYYKPEFYTPDDGGTAHLSVVAEDGSAVSATSTINLYFGSKVCSPVSGILFNNEWTTSALPAFTNEFGAPPSPANFIQPGKQPLLSMCLTIMVGQDGQVRMVVGAAGGTQITTDTALAIIYNLWFGYDVKRAVEEPRLHNKLLPNVTTVERNIDQAVTAALETRHHHTQIASTFIAVVQAIVRTAGGWAAASDSRKGGEPAGY 412
106 0.000e+00UniRef50_A0A1Y1NPC6 Uncharacterized protein n=6 Tax=Holometabola TaxID=33392 RepID=A0A1Y1NPC6_PHOPY  ali  42  379LTSNDYASYIRNKILDNTTHNPEDYGAVFFNKEDHGTAHISVLASNDDAVSVTSTVNVFFGSGVTSKSTGIILNNVMDDFSSPNFPNYFNLPGSPNNVIEPGKRALSSMTPSIITDRNGDVQMVIGASGGTKITTAIAFVIMRHLWFGDNIKEAVDAPRIHHQMYPMTIDYEYGNLQQVINGLQKLGHNTTRYSERGSVVCALTVHNGTIIANSDYRKGGDVYG. 603
107 0.000e+00UniRef50_UPI0003F09ACB uncharacterized protein LOC102802318 n=1 Tax=Saccoglossus kowalevskii TaxID=10224 RepID=UPI0003F09ACB  ali  43  582MMSKDYAAKIREMIHDNTTHGIGYYGAILSIGEDHGTSHLSVVDQYGNSVSVTSTINTLFGSTVVGSRTGIIFNNEMDDFSSPNITNFFGLPPSPANFIEPGKRPLSSMNPSI--DKNGNVVLSIGGSGGTKIPTSVSQSAMNLLWFGENLGDSISKLRIHHQLSPNELLYEENFPAAIIEGLKEKNHNTSSDYGTNSAVQAIYSLDEQLHACSDARKGGIPAGF 804
108 0.000e+00UniRef50_A0A261Y5Q3 Uncharacterized protein n=1 Tax=Bifiguratus adelaidae TaxID=1938954 RepID=A0A261Y5Q3_9FUNG  ali  40  397IITKEWADLVRANITDNQTHEPDYYRPVFDNAESHGTTHLSTLDSDDMAVSLTSTVNLLFGARMMNRKNGVILNDEMDDFSIPGIPNAFELPPSEFNYVAPRKRPLSSSVPTIIE-RDGKFEMVLGASGGSRIITATLAAILNTLDYGMNILEAIDAPRLHHQLIPNVAQFESGIDPALVVALESRGHNVTVFDRGVSEVQAVLRSNGTINAASDWRKHGVAAGY 623
109 0.000e+00UniRef50_A0A067R1C7 Gamma-glutamyltranspeptidase 1 n=11 Tax=Pancrustacea TaxID=197562 RepID=A0A067R1C7_ZOONE  ali  42  370LTSKDYAEAVRKNISDYVTQDPKHYGADVVMPEDHGTAHISVLAPNGDAVSVTSTVNLYFGAMVRSVSTGIILNDEMDDFSAPNITNYYDVPPSPNNYIEPKKRPLSSMVPSICVDGSGDVQLVTGAAGGTKITTATALVAMQVLWFNNNIKEAIDAPRVHHQLFPMHLQYEYGLLQQIVQGLQEIGHETERL-HFFSAVTGITRKGGKVYASTDFRRGGITAGF 594
110 0.000e+00UniRef50_UPI000B911C10 gamma-glutamyltranspeptidase 1-like isoform X1 n=7 Tax=Acanthaster planci TaxID=133434 RepID=UPI000B911C10  ali  49  438MTSQSYADSLRAAIDDNMSHDPSYYTAYYNQP-DGGTSHLSVVDTYGNAVAATSTINLYFGSKVRGNRTGILFNDEMDDFSKPGEPNAFGVPPSVSNFIRPGKRPMSSMTPTIVVDRDGKVKLLVGASGGTRITTGVAQVTVDTLWYGDSIKNAIQRRRFHHQLVPNNVTYEAGFKQDVINGLRAKGHYPYE-STRGCVVQGIMRDQGFWSAYSDDRKGGSSAG. 660
111 0.000e+00UniRef50_A0A2T7PH69 Uncharacterized protein n=2 Tax=Pomacea canaliculata TaxID=400727 RepID=A0A2T7PH69_POMCA  ali  45  268MTSPEVGQEIRAKISDDKTHDIPYYEPSFFNKNDKGTSHTSVFDGEGNAVAITSTVNLYFGSKMKGNRTGIIFNNEMDDFSTPNTTNAFDVPASPANFIQPGKRPLSSMTPSVFVDKTGEVKLVAGASGGTKITTATALVAMRTLWFNDSLVEAVDDPRVHHQLFPPEIHVDPGFPKDIQDGLVAKGHKV--VAQSGSVVQAILNEDERLYAVSDWRKGGAPDGY 491
112 0.000e+00UniRef50_UPI000D73CE90 glutathione hydrolase 1 proenzyme-like isoform X1 n=2 Tax=Pomacea canaliculata TaxID=400727 RepID=UPI000D73CE90  ali  49  383LTSNEYADAIRQLITDNTTHNISYYGPTFYDRLTTGTAHLSVVDAEGNAVAVTSTVNARFGSKRRGSRTGIIFNDEMDDFSSPNITNIFGLPPSPANFIFKGKRPLSSMCPSIFTNPNGSVRLVVGAAGGTYITTSTAYVAVRQLWLGNSMEQAVEARRLHHQLLPDYITYEEDFDMAIVKGLQALGHEVQSIALGKSIIQAISGEGGMLHAVSDFRKGGHPDGY 607
113 0.000e+00UniRef50_UPI000C7575A0 glutathione hydrolase 1 proenzyme-like n=1 Tax=Eurytemora affinis TaxID=88015 RepID=UPI000C7575A0  ali  48  405MTSEESAVDKASRIEDDKTYNASHYGAVFYTPEDHGTAHVSILAENGDAVSVTSTINLYFGSLIMSKRTGIILNDEMDDFSAPNITNYFGVPPSPHNFIKGGKRPLSSMSPAVIVNKDGKVRLVVGAAGGTKITTATALTIISNLWLGEDIKMSIDKRRIHHQLAPMEVSYEPDYPQDLLKELEKRGHATAEMDSFGSVINGVSVEDGRIYANADFRKAGGVDGY 631
114 0.000e+00UniRef50_A0A1W4W5B0 gamma-glutamyltranspeptidase 1-like isoform X1 n=22 Tax=Neoptera TaxID=33340 RepID=A0A1W4W5B0_AGRPL  ali  41  433LTSSKYAEQIRKKIDDTTTQKPEDYGAVFYNQEDHGTAHISVLAENGDAVSATSSVNLYFGAGITSKSTGIVLNSVMDDFSFPYYKNYFGLPGSPSNSLQPGKRSLSSMSPSIVTDKNGDVRVVIGASGGTKITTAVALVIMRTLWFGQNIKEAIDAPRIHHQIYPMKVSYEYGNLQQVVEGLQKKGHKMERYSERGSIICALLIKNSTIFANADYRKGGEVYG. 657
115 0.000e+00UniRef50_A0A091SST2 Gamma-glutamyltranspeptidase 1 (Fragment) n=4 Tax=Euteleostomi TaxID=117571 RepID=A0A091SST2_9AVES  ali  62  156MTSEFFADGLRRKITDNTSHPVDYYEPVYYTGDNAGTSHLSVVADDGSAVSATSTINQYFGSDVRSNVSGIIFNDEMDDFSSPYIINGFGIPPSPANFIAPGKQPMSSMCPSILVDKMKKVRMVVGASGGTKITTATALTIMNSIWFGYDVKKAVEEPRIHDQLFPNITELEQQMEEGIEEQLKKRKHDTMRMSGG-AVVQAILRTDKGWAAASDSRKGGFPAGY 379
116 0.000e+00UniRef50_A0A0F8AD56 Gamma-glutamyltranspeptidase 1 n=1 Tax=Larimichthys crocea TaxID=215358 RepID=A0A0F8AD56_LARCR  ali  53  706ITSTPFADGLREKITDDTTHHMNYYEPEFYLPENHGTSHISVVAEDGSAVSATSTINQYLGSKVMSASTGILLNNEMDDFSSPLITNGFGVPPSPNNFIRPGKRPMSSMCPAILFDKDNKVKMVVGGSGGTKITTSIAQVILNVLFFNYDLEKAVSDPRLHNQLSPNTTVAEPDFDRNILDGLASKNHTTEFLKSSGAVVQAVVRHDDGLHAQSDPRKFAYAAGY 930
117 0.000e+00UniRef50_A0A0B7AUX9 Uncharacterized protein n=5 Tax=Bilateria TaxID=33213 RepID=A0A0B7AUX9_9EUPU  ali  45  138LTSKAYADSIRKLITDNETHSYEYYGPTFYDQETTGTSHMSVLDHHGNAVSVTSTINGRFGSYRRGTRTGIIFNNEMDDFSSPNITNEYGIPPSPANFIIPGKRPLSSMCPAVFINLDGSANLVLGAAGGSKITTSTAWVAAHVLWLGLSIEKAIEIPRLHHQLLPPWISFETGFKESLIQALRQLGHNATEFIPGQSVVQGIDVRDGFIYAVSDYRKGGTPNGY 362
118 0.000e+00UniRef50_A0A1S3JRK3 glutathione hydrolase 1 proenzyme isoform X1 n=5 Tax=Lingula unguis TaxID=7574 RepID=A0A1S3JRK3_LINUN  ali  48  433MTSLEFGDHIRSLITDNTTHGTAYYGPTFYDRMTEGTSHLSVLAGNGDAVSVTSTINLYLGSRVRGKKTGIIYNDEMDDFSSPNITNAFGIPPSPNNFIRPGKRPLSSMCPTIVVNKDGDVILVVGASGGSRITTATAYVTARTLWFGENIKQAIDARRIHHQLLPPEISYEEGFRKMYISGLRALNHNLTERAVGGSVVQGIHRSESAIYANSDFRKGGYPDGY 657
119 0.000e+00UniRef50_UPI000B90E9E8 gamma-glutamyltranspeptidase 1-like n=2 Tax=Acanthaster planci TaxID=133434 RepID=UPI000B90E9E8  ali  48  291MTSQAYADSLRAAIDDNMSHDPSYYTAYYNQPDS-GTSHLSVVDTHGNAVAATSTINLYFGAKVRGNRTGILFNDEMDDFSKPGEPNAYGLPPSVSNFIRPGKRPMSSMTPTIVVDRDGKVKLVVGASGGSRITTGVAQVTVDTLWYGDSIKDAIQRRRFHHQLVPNNVTYEAGFNQDVIDGLKAKGHYPYE-STGNCVVQGILRDQGFWSAYSDDRKGGHPAG. 513
120 0.000e+00UniRef50_V4BXA9 Uncharacterized protein n=4 Tax=Mollusca TaxID=6447 RepID=V4BXA9_LOTGI  ali  47  391LTSRDYADFIRSKIWDNTTHDMMYYGPTFYDKYTTSTAHLSIVDQHGNAVSVTSTINARFGSKLRGLKTGIIFNDEMDDFSSPNITNIFGIPPSPANFIRPGKRPLSSMCPAIAIDKKGDVKLVIGAAGGSKITTATALVTMNELWLGRNIKKSIDTLRLHHQLLPPEIQYEKDFDQDVLIGLVKKGHNISEVAVGESVVQGVARHDHRLYANCDFRKGGEPAGF 615
121 0.000e+00UniRef50_A0A2L2XUY1 Gamma glutamyl transpeptidase n=1 Tax=Parasteatoda tepidariorum TaxID=114398 RepID=A0A2L2XUY1_PARTP  ali  43  95..SKDYADQTRPKIDDKKTHDPDYYGVNVNVQEDHGTAHMSIIGTNGDAVSVTSTINHYFGSQVMSPSTGILLNNEMDDFSSPNITNFFGVPPTGKNQIRPGRRPFSSMVPAIVVDGNRNVRLVVGGNGGTQITTSVAQVIIRNLWLDENIKQAIDAPRFHHQLLPNLIEHEVNFPEDILSDLKNKGHELKKLDNMLGIIMAVATDNGRISANSDYRKGGEVDGF 319
122 0.000e+00UniRef50_D3DW46 Gamma-glutamyltransferase-like activity 4, isoform CRA_b n=18 Tax=Boreoeutheria TaxID=1437010 RepID=D3DW46_HUMAN  ali  88  1MTSEFFSAQLRAQISDDTTHPISYYKPEFYMPDDGGTAHLSVVAEDGSAVSATSTINLYFGSKVRSPVSGILLNNEMDDFSSTSITNEFGVPPSPANFIQPGKQPLSSMCPTIMVGQDGQVRMVVGAAGGTQITMATAQAIIYNLWFGYDVKWAVEEPRLHNQLLPNVTTVERNIDQEVTAALETRHHHTQITSTFIAVVQAIVRMAGGWAAASDSRKGGEPAGY 252
123 0.000e+00UniRef50_A0A1S3F0H0 gamma-glutamyltranspeptidase 1 n=6 Tax=Euteleostomi TaxID=117571 RepID=A0A1S3F0H0_DIPOR  ali  77  397MSSEFFAAQLQARITDNTTHVASYYEPEFYNPDDGGTSHLSVVSEDGSAVSTTSTINLYFGSRILSRVSGILFNDEMDDFSSPNFMNQFGVFPSPANFIRPGKQPLSSMCPSIIVGPDGKVQMVVGASGGTQITTSTALAIIYNLWFGYDVKRAVEEPRLHNQLLPNTTTVEKHIDQAVVEALKARHHHIEVTSTFIAVVQAIVRTASGWAAASDSRKGGEPAGY 621
124 0.000e+00UniRef50_UPI000BBDD3CF gamma-glutamyltranspeptidase 1-like isoform X1 n=4 Tax=Clupeocephala TaxID=186625 RepID=UPI000BBDD3CF  ali  53  348ITSKSFAEGIRHKITDDSTQQESYYEPEFFVPDDHGTSHISVLAEDGSAVAATSTINRYFGSKVMSASTGIILNNEMDDFSSPLITNSFGVPPSPNNFIKPHKRPMSSMCPAILFDKNHKVKMVVGGSGGTKITTSVAQVILNSLSFNYDLKRSVVEPRVHNQLSPNITLVEAGFDQAVADGLAQKNHVIEVLTSTGAVVQAIERRGMWIEAVSDPRKGGYAAGY 572
125 0.000e+00UniRef50_UPI0007AD6418 gamma-glutamyltranspeptidase 1-like n=5 Tax=Clupeocephala TaxID=186625 RepID=UPI0007AD6418  ali  52  195ITSKDYADMILQKITDNTTQQESYYEPEFYLPDDHGTSHVSVVAEDGSAVAATSTINLYFGSKFMSNSTGIILNNEMDDFSSPLITNNFGVPPSPNNFIVPHKRPMSSMCPAILLDKNNKVKMVVGASGGTKITTAVAEVILNALFFDYDLKKAIEDLRIHNQLSPNTTQAEPDFDKAILEGLAMKNHVIEVLKSMGAVVQAVVRYSAGLSAESDPRKGGYAAGY 419
126 0.000e+00UniRef50_K7GKE3 Glutathione hydrolase 1 proenzyme n=3 Tax=Sarcopterygii TaxID=8287 RepID=K7GKE3_PIG  ali  79  294MSSEFFADQLRARISDTTTHPDSYYEPEFYTPDDAGTAHLSVVSEDGSAVSATSTINLYFGSKVRSRISGILFNDEMDDFSSPNITNQFGVRPSPANFITPGKQPLSSMCPVIIVGEDGQVRMVVGASGGTQITTSTALAIIHSLWFGYDVKRAVEEPRLHNQLLPNTTTLEKGIDQAVAAALKTRHHYIQDASTFIGVVQAIVRTPSGWAAASDSRKGGEPAGY 518
127 0.000e+00UniRef50_B0UXV5 Gamma-glutamyltransferase 1a n=49 Tax=Chordata TaxID=7711 RepID=B0UXV5_DANRE  ali  60  355MTSDYFADNIRSKITDDTTHPDSYYDPEYFVPDNHGTAHLSVIAEDGSAVAATSTINLYFGSKVMSRSTGIIFNDEMDDFSSPYITNGFGVPPSPNNFIQPGKRPLSSMCPTIIFDKHNRVKMVVGASGGTKITTATALVILNSLFFNYDLKKAVTEPRVHNQLNPNMTVVEQDFEQSVLDGLEQKNHVTELQRTPGAVVQAIVRQGDKLCAECDPRKGGYPAGY 579
128 0.000e+00UniRef50_A0A2Y9LEL9 gamma-glutamyltranspeptidase 1 isoform X3 n=5 Tax=Odontoceti TaxID=9722 RepID=A0A2Y9LEL9_DELLE  ali  80  188MSSEFFAAQLRARISDDTTHPASYYEPEFYTPDDGGTAHLSVVSEDGSAVSATSTINLYFGSKVLSRANGILFNDEMDDFSSPNIINQFGVPPSPANFITPGKQPLSSMCPAIIVGQDGQVRMVVGASGGTQITTSTAQAIIHSLWFGYDVKQAVEEPRLHNQLLPNTTTLEKDIDQAVAAALKTRHHHTEVTSTFIAVVQAIVRTAGGWAAASDSRKGGEPAGY 436
129 0.000e+00UniRef50_A0A2J8KX22 GGTLC1 isoform 1 n=21 Tax=Chordata TaxID=7711 RepID=A0A2J8KX22_PANTR  ali  88  1MTSEFFSAQLRAQISDDTTHPISYYKPEFYMPDDGGTAHLSVVAEDGSAVSATSTINLYFGSKVRSPVSGILLKNEMDDFSSTSITNEFGVPPSPANFIQPGKQPLSSMCPTIMVGQDGQVRMVVGAAGGTQITMATALAIIYNLWFGYDVKWAVEEPRLHNQLLPNVTTVERNIDQEVTAALETRHHHTQIVSTFIAVVQAIVRMAGGWAAASDSRKGGEPAGY 225
130 0.000e+00UniRef50_UPI0009A34DE7 LOW QUALITY PROTEIN: gamma-glutamyltranspeptidase 1-like n=1 Tax=Rhincodon typus TaxID=259920 RepID=UPI0009A34DE7  ali  63  100MTSENFAARLWSKITDNTTHPIPYYEPEFYTTEDHGTAHLSLVAEDGSAVSATSTINLYFGSKVRSAKNGIIFNDEMDDFSSPGILNGFDVPPSPANFIMPGKTPLSSMCPAIILDKNKSVKMVVGASGGTMITTATALVIMNVLWFNYNVKRAVTEPRFHNQLFPNVTQVEEAIEETVYEGLQERHHTLTTITPSGGVVQAIVRDEGKWFAESDYRKGGKPAGY 326
131 0.000e+00UniRef50_A0A1A6HW75 Uncharacterized protein n=7 Tax=Euarchontoglires TaxID=314146 RepID=A0A1A6HW75_NEOLE  ali  77  260MTSEFFADQLRARISDGTTHPTSYYEPEFYLPDDGGTAHLSVVSEDGSAVSATSTINLYFGSKVLSRVSGILFNDEMDDFSSPNFVNQFGVSPSPANFIKPGKQPLSSMCPVIILDKDGKVQMVVGAAGGTQITTSTALAIINNLWFGYDAKRSVEEPRLHNQLLPNTTTIEKNIDQVVAAGLRTRHHYTEVTDTFIAVVQAVVRTSNGWAAASDSRKGGEPAGY 484
132 0.000e+00UniRef50_A0A1R1PQA1 Gamma-glutamyltranspeptidase 1 n=1 Tax=Zancudomyces culisetae TaxID=1213189 RepID=A0A1R1PQA1_ZANCU  ali  40  473.LSKEHAKQNKAKITDDRTHDFEYYEPEYADKEDHGTTHVAVVDKDGNAVSLTSTINLLFGSRVMDPKTGVIFNDNMDDFSTPGTKNGFGLHPSPKNFVKAGKRPLSTTSGTIVLDKNGKVEYVVGASGGSRILTAVAQVLRNCMEYGMTIKQAVDSPRIHHQLLPDELMVEPYYPVDLVNGLREKGHNIVEMAQVSSVVQAIRISDGTIHAVSDGRKKGAPAAY 697
133 0.000e+00UniRef50_Q9BX51 Glutathione hydrolase light chain 1 n=32 Tax=Euarchontoglires TaxID=314146 RepID=GGTL1_HUMAN  ali  89  1MTSEFFSAQLRAQISDDTTHPISYYKPEFYMPDDGGTAHLSVVAEDGSAVSATSTINLYFGSKVRSPVSGILLNNEMDDFSSTSITNEFGVPPSPANFIQPGKQPLSSMCPTIMVGQDGQVRMVVGAAGGTQITMATALAIIYNLWFGYDVKWAVEEPRLHNQLLPNVTTVERNIDQEVTAALETRHHHTQITSTFIAVVQAIVRMAGGWAAASDSRKGGEPAGY 225
134 0.000e+00UniRef50_P07314 Glutathione hydrolase 1 proenzyme n=404 Tax=Euteleostomi TaxID=117571 RepID=GGT1_RAT  ali  77  344MSSEFYATQLRARITDETTHPTAYYEPEFYLPDDGGTAHLSVVSEDGSAVAATSTINLYFGSKVLSRVSGILFNDEMDDFSSPNFTNQFGVAPSPANFIKPGKQPLSSMCPSIIVDKDGKVRMVVGASGGTQITTSVALAIINSLWFGYDVKRAVEEPRLHNQLLPNTTTVEKNIDQVVTAGLKTRHHHTEVTPDFIAVVQAVVRTSGGWAAASDSRKGGEPAGY 568
135 0.000e+00UniRef50_F7HKK5 Uncharacterized protein n=8 Tax=Boreoeutheria TaxID=1437010 RepID=F7HKK5_MACMU  ali  89  329MTSEFFAAQLRAQISDDTTHPISYYKPEFYMPDDGGTSHLSVVAEDGSAVSATSTINLYFGSKVRSPVSGILFNDEMDDFSSPSITNQFGVPPSPANFIQPGKQPLSSMCPTIMVGQDGQVRMVVGASGGTQITTATALAIIYNLWFGYDVKRAVEEPRLHDQLLPNVTTVERNIDQAVTAALETRHHHTQIASTFIAVVQAIVHTPGGWAAASDSRKGGEPAGY 553
136 0.000e+00UniRef50_P19440 Glutathione hydrolase 1 proenzyme n=107 Tax=Gnathostomata TaxID=35060 RepID=GGT1_HUMAN  ali  93  345MTSEFFAAQLRAQISDDTTHPISYYKPEFYTPDDGGTAHLSVVAEDGSAVSATSTINLYFGSKVRSPVSGILFNNEMDDFSSPSITNEFGVPPSPANFIQPGKQPLSSMCPTIMVGQDGQVRMVVGAAGGTQITTATALAIIYNLWFGYDVKRAVEEPRLHNQLLPNVTTVERNIDQAVTAALETRHHHTQIASTFIAVVQAIVRTAGGWAAASDSRKGGEPAGY 569
137 2.000e-98UniRef50_E4YZ32 Uncharacterized protein n=1 Tax=Oikopleura dioica TaxID=34765 RepID=E4YZ32_OIKDI  ali  45  10.....FAKQFADKIDDE-THPLEFYEPEFEIVEDSGTSHMSIVDAHGMAVAITSTINTILGSKMIGKRTGIIFNNEMDDFSTPGVSNNYGLPPSPSNFIKPGAQPLSSMCPIIVVDKNGDVIFTAGASGGSQITTATANVAIRTLLYGDGMNEAIQRARIHHQLLPNEIRKEDRFDLNMIKELEKKGHVYYNGTGRGAVVQGILRRNGLLEAVSDVRKGGKPDGY 229
138 2.000e-98UniRef50_A0A088AQ38 Uncharacterized protein n=62 Tax=Apocrita TaxID=7400 RepID=A0A088AQ38_APIME  ali  41  445LTSKIHAKKTQMMIDDYRTNDSAHYGARTSNAKDHGTAHVSVLAPNGDAVSATSTINFYFGSGVVSENTGILLNNAMNDFGIPSTISYFGIPPSPNNYIAPGKRPLSSMVPSILVDSNDDVRMVIGASGGTKITTTVSQIIAKIIWMNQTVKEAVDAPRIHHQLFPPEMNYEYGVPKPVIDNLQKFGHVTSRYRVRGSVACVIFTENNTVYANADYRKGGDVYG. 670
139 2.000e-98UniRef50_A0A2E9R516 Gamma-glutamyltransferase n=1 Tax=Deltaproteobacteria bacterium TaxID=2026735 RepID=A0A2E9R516_9DELT  ali  38  341LTSQEYADNLAKRIT-NKVQSPKAYGSPKASPRDGGTSHISVIDKDGMAVAMTTTINTGYGSKVIAPRSGIILNNEMDDFSTPGKPNAFGLIQSKYNEIAPGKRPLSSMSPTLIT-KGGKIVLAVGASGGPTIITGTLQTLLNVLVFGLEINDAVSRSRIHHQWFPPLLFIESDLPADVVQALQKRGYKTRVWKVPFTAVQAAQRTKIGLTGASDPRKHGQTA.. 566
140 2.000e-98UniRef50_T2J8N5 Gamma-glutamyltranspeptidase n=6 Tax=root TaxID=1 RepID=T2J8N5_CROWT  ali  29  100LISKKYADQIGEKIDLEKVIPSQNIKPVFQSNESTETTHYSIMDRYGNAVANTYTLNFSYGSGLTVPGTGILLNNQMDDFTAKGVSNAYQLIGGQNNSIAPEKRMLSSMTPTIVM-KEGKPWLVTGSPGGSRIITTTLQIIMNVIDHEMNIAEATNATRIHHQWFPDQIRLERGLNGDTIDLLETKGHTIK-SSFAMGSTQSVMYKKGQFYGASDPRKPGATLGY 326
141 2.000e-98UniRef50_A0A0P6GRR6 Gamma-glutamyltranspeptidase 1 n=20 Tax=Daphnia magna TaxID=35525 RepID=A0A0P6GRR6_9CRUS  ali  45  390LTSEEWAIDTRAKINDSFTSDPAYYGAVTYTPDDKGPSHTSVLDADGMAVSATTTVNLYFGAGFTSEQTGIIPNDEMDDFSSPNVTNAFGVPPSEANFIEPGKRPLSSMTPTIIVDSTGKVRSVVGASGGTKITTAVVYTIIQNLWFGKTIKEAIDRPRIHHQLFPMTFEYETGFPKDITDNMLTKNHVLSEF-QFGSSVHGLTVEDGYIYANADHRKGSDVAG. 615
142 2.000e-98UniRef50_T1JME8 Uncharacterized protein n=1 Tax=Strigamia maritima TaxID=126957 RepID=T1JME8_STRMM  ali  39  518LMSKGYARAIRDKIRPDNVQSFSAYGLVLSNPDDSGTAHLSVLAPNGDAVAVTSSVNTWLGAGIRSRSTGIVLNNEMDDFSFPSITNHFGVPPSPTNFMRAGKRPQSSMCPSIFTNSKGDVVLVIGAAGGTKILSSISQAVIRTLWIGDTIKEAIDARRLHHQLLPNEIQLEEGFPEAISRKLRRMGHRAVVHAAKGSSVVAIHKPDGSIHACADFRKDGSTAGY 743
143 2.000e-98UniRef50_L8GST7 Gammaglutamyltransferase n=1 Tax=Acanthamoeba castellanii str. Neff TaxID=1257118 RepID=L8GST7_ACACA  ali  43  387MMGKEHASRLRSKIKLNATFPYQYYEDFTAPIEDAGTTHLSVIDSQRNAVSLTSTVNLVFGAKFLSTSTGVVLNNQMDDFSTPNTSNAFNLPPSEANFIVPGKRPLSSMSPTIVT-KNGQVYLVVGASGGSRIITSTLQALLGVVAYKQDVWKAVSSPRLHNQLLPPFVYTEAAFSPAITAYLKKIGHDMAFMEE-VGVVAAVQLDDGYLYAASDPRKLGRPAGF 613
144 2.000e-98UniRef50_A0A2V8TWW4 Gamma-glutamyltransferase n=1 Tax=Acidobacteria bacterium TaxID=1978231 RepID=A0A2V8TWW4_9BACT  ali  31  214LLDPKHIANLRASIDPDHATPSDQVRPKFAIREGGDTTHFAVADAAGNAVAVTVTLNSQYGSAVTAPGLGFLLNDNMDNFAAPGKTNQYGLVQGEANAIQPHKRPVASMTPTIVL-KDGRLFMIVGTPGGPTILNSVLQALLHVVDFHMNAQDAVAAPRIHHQWYPDKLFLEPGFSPDTIALLKARGHNI-EMKGSNNDMNMVLMEGGWIQAGVDPRREGKAAGY 438
145 3.000e-98UniRef50_V4ASG3 Uncharacterized protein n=1 Tax=Lottia gigantea TaxID=225164 RepID=V4ASG3_LOTGI  ali  43  294LTNLNYGETTRYKINDNKTFKYKHYHPAFSLTETHGTTHLSLLGPNGDAVAITSTVNLYFGSDVVGENTGIIYNDEMDDFSTPNTTNYFGVPASPANFIKPMKRPLSSMTPSIAVAPSGDVVMVVGASGGTKITTAVARVVMESLWFKWGIKKSIDYPRLHDQLVPEVCEAERGYPAVVFDGLKGIGHNMTWVGGG-SVVQGILQKPGDITANSDYRKGGKPAGY 518
146 3.000e-98UniRef50_A0A2E5UQ84 Gamma-glutamyltransferase n=2 Tax=Candidatus Marinimicrobia bacterium TaxID=2026760 RepID=A0A2E5UQ84_9BACT  ali  32  348LISKEYADDRFSTISMKKAIPSKKIGHGNFWNESEETTHFSIVDKYGNAVSLTTTVNGWFGNGITVDNAGFLLNNEMDDFSIPGYPNLYGLVGNEANSIQPNKRMLSSMTPTIVENENNELIYVLGTPGGSTIITSVAQILINLIDFNMPLKEAVSRKRFHHQWLPDVIQVEKNFSPEVISRLEKYGHKVSERSS-IGEANCIYIDGTGLYSTSDSRRGGVSKAY 576
147 3.000e-98UniRef50_A0A1F9FID3 Gamma-glutamyltransferase n=1 Tax=Deltaproteobacteria bacterium RBG_16_71_12 TaxID=1797848 RepID=A0A1F9FID3_9DELT  ali  33  263LTSPAYAALRRGAIDDRRASKSADVKAMSAAQESPDTSHLSVVDGERNAVSLTFTVNYGFGSGVVVPGTGVLLNDEMDDFSAPGVPNAFGLVGGEANSVQPGKVPLSSMTP-LVAAKAGKLYLVAGSPGGSTIITTVLQTLLHVVDYDMDCQAAVAAPRLHHQWLPESTRLEAGFDTATKGALELRGHAFTTTDGWGNAMCIRVLDDGTLEGGADPRGEGVARG. 493
148 4.000e-98UniRef50_A0A1Q7T062 Gamma-glutamyltransferase n=1 Tax=Ignavibacteria bacterium 13_1_40CM_2_61_4 TaxID=1805219 RepID=A0A1Q7T062_9BACT  ali  30  178LISKPYAGERRKEIDPSRAAESSSVRGSPRGTEGQHTTHFCTVDESGTIVSTTYTLNDLFGCKAVVGGAGFLLNDEMDDFSKPGVPNAYGLIGGDANAIAPGKRPLSSMTPTIVL-KGSRPFLALGARGGSKIITAVVQAISNVIDFGMGPQEAVDAPRFHHQWMPDSLVYEKCFPRDVIQNLEQKGHRIRESDGPLGELEVIAFDEGWIYGAPDSREGGVAVGY 406
149 5.000e-98UniRef50_A0A2H6ELT1 Gamma-glutamyltranspeptidase n=6 Tax=Bacteria TaxID=2 RepID=A0A2H6ELT1_9BACT  ali  29  343LLSKEYAKSIFLKIG-NKATPSSSIKAGNPMQESTETTHYSIYDKYGNAVSVTTTLNSAFGNKIVVEGAGFLLNNEMDDFSSPGVPNQFGLIGGEGNSIQPEKRMLSSMTPTIIL-KDGKPYIVIGSPGGSTIITTVMQVILNCIDFNMDIQTAIDMPRIHHQWLPDKIFFEKAVNLDTAEKLRALGYKLADIRKSFGIAEGIMIDNTIIYGASDPRGGGSAEGY 574
150 5.000e-98UniRef50_A0A2V6FVC3 Gamma-glutamyltransferase n=2 Tax=Bacteria TaxID=2 RepID=A0A2V6FVC3_9BACT  ali  32  195LIDKKYAGDWRESIDPARASPSKYARLTNVVREPENTTHYSVVDPAGNAVAVTTTLNESFGSGVTVAGLGFLLNNEMDDFTVPGVPNTYGLIQGPANAIGPGKRPLSAMAPTIVL-KDGKLFLVLGSPGGPRIITTVANILMGVVDYGLNLQEAVNAPRFHHQWLPDEVYVERGTSPDSAALLQQMGHHV-VTEDYWSDGECIAIDTGERLGASDVRNNGKAVGY 433
151 5.000e-98UniRef50_A0A1Y2HNU6 Gamma-glutamyltranspeptidase n=1 Tax=Catenaria anguillulae PL171 TaxID=765915 RepID=A0A1Y2HNU6_9FUNG  ali  42  390ILSKDEAAAARRNISDATSYPPEHYQPKYTNAPSHGTTHLSVVDESGMAVAVTTTVNLIFGSRIMEPKTGVILNDQIDDFSFHNVSNYFGLPPSPSNYMEPMKRPMSSTAPTIVE-QDGQVSLVVGGSGGSRIISAVFQTIVNFLEFDWSVTRSVFSPRLHDQLFPDLTEVEEGFPTSVSRELAARNHQLKYVGHHESVVQAIARTSGELEAVADYRKGGEPDGY 616
152 5.000e-98UniRef50_A0A222F918 Gamma-glutamyltransferase n=36 Tax=Bacteria TaxID=2 RepID=A0A222F918_9RHOB  ali  32  356LTARDYAAELVKTIRMDAATPSVDVKPGPYPYESNETTHFSVVDKDGNAVSNTYTLNFSYGVGLTADGTGVLLNNELDDFSKPGVPNAYGLVGGTANAVEGNKRPLSSMSPTLVF-KDGDLYLATGSPGGSRIITTTLQIILNVIDHDMNIAEATAAPRIHNQWLPDEIRIEEGLSPDTIRLLEQRGHKIAVKNAMGST-QSIMKVDGLLAGASDPRRPGATAGY 581
153 6.000e-98UniRef50_A0A2I3RST2 Uncharacterized protein n=10 Tax=Tetrapoda TaxID=32523 RepID=A0A2I3RST2_PANTR  ali  86  1MTSEFFAAQLRAQISDDTTHPISYYKPEFYTPDDGGTAHLSVVAEDGSAVSATSTINLYFGSKVRSPVSGILFNNEMDDFSSPSITNEFGVPPSPANFIQPGKQPLSSMCPTIMVGQDGQVRMVVGAAGGTQITTATALAIIYNLWFGYDVKRAVEEPRLHNQLLPNVTTVERNIDQ-VGWGLEKLSHGVGPQG............................... 193
154 7.000e-98UniRef50_A7X2L9 Putative gamma-glutamyl transferase (Fragment) n=8 Tax=Mesangiospermae TaxID=1437183 RepID=A7X2L9_POPCN  ali  38  18MISPKFAEELKKTIYDNMTFDPGHYGGRWNQINDHGTSHISIVDSERNAVSMTNTVNAYFGAQILSPSTGIVLNNEMDDFSMPGNNTGHVLPPAPPNLIRPGKRPLSSMTPTIVL-KDKKLKGVVGASGGSMIIAGTTEVLLNHFVKGMDPLSSVLAPRVYHKLTPNVVQYENWLPADVRAFLQKRGHDLEGIAGGT-ICQFIVQDLGKLVGVSDPRKGGLPAGY 258
155 7.000e-98UniRef50_K9QCR7 Gamma-glutamyltransferase 1 n=8 Tax=Nostocales TaxID=1161 RepID=K9QCR7_9NOSO  ali  38  347LINPAYAKQRRQEINLDMAKPASQIKPVAPETESAETSHLCVVDEQRNAVSLTFTINLGFGAGVVTPGTGILLNNEMDDFAAPGVPNAFGLVGNEANAIAPRKTPLSSMTPTIIT-ENNHLRMAVGAPGGSTIITQVLQVILNVLEYKMDVGAAVSVPRIHDQWLPDELRVEPGLDALTLQDLRRRGHNIKENDPW-GNVNAIAVKDGSLEAAADPRGEGSPRGW 598
156 8.000e-98UniRef50_L7MJV6 Putative gamma-glutamyltransferase (Fragment) n=7 Tax=Ixodoidea TaxID=297308 RepID=L7MJV6_9ACAR  ali  41  422MLSRDYANSLRSKISDIETHEPSFYEPATHMNEDKGTAHVNVLAPNGDAVSATSTVNRYFGAMLVSPSTGIVLNSGMDDFSVENATNSFGLEWSTANLIAPGKRPLSSMCPTVVTDSSGTVHTVIGGAGGSRITSGTAQILFRTLYLGETIKQAIDDLRIHHQLYPNHIFYEKAFPPIILDKLQEFGHKVRP-EVEESAFQGITREDGGLLANVDFRKGGSIAGY 646
157 9.000e-98UniRef50_A0A109FFG4 Gamma-glutamyltranspeptidase n=2 Tax=Basidiomycota TaxID=5204 RepID=A0A109FFG4_9BASI  ali  39  367....KYADAVRANITDDRTHKLSYYNPQFDILEDHGTTHLSVIDQWGGAVSLTTTVNLIFGSRVMDTKTGIILNDEMDDFSTPGLPDAFGLRPSPFNYPEGGKRPLSSTSPLIMDHPSSEVYLALGGSGGSRIFGAVAQTLLN-LDWGYDLANAVEQPRVHHQLLPAYVSIESTFRPDLVEALQSRGHNTTLFDINLGIVQACMRDNGRFFATSDSRKNG..... 585
158 9.000e-98UniRef50_V5IH53 Putative gamma-glutamyltransferase (Fragment) n=2 Tax=Ixodoidea TaxID=297308 RepID=V5IH53_IXORI  ali  38  102LTSVEQALATRRLIDDARTFEQAHYFGEEPFQPDHGTAHASFLSPNGDAVAVTSTVNFYFGS--VVRSGGVVLNNEMDDFSVPGTSNLYDVAPSEANYAAPGKRPMSSMAPAVVVDRDGDVQLVLGGAGGAKITSGIALVSMRYLWQGNDIKEAIDFPRVHHQLLPNQVDVEANFPQVYRRLLEKKGHKVVVPKGRFSIMMGIGRREGRVYANADFRKGGSVDG. 324
159 9.000e-98UniRef50_A0A2G5VT91 Uncharacterized protein n=21 Tax=Chromadorea TaxID=119089 RepID=A0A2G5VT91_9PELO  ali  45  415ITSKEWADWVRSKITD-VTHPDDYYGGSFEPPQDHGTTHVSIIDAQGNAVSVTSTINLYLGALVSSESTGILWNNEMDDFSTPGHPNFFGFPPSPANFIRPGKRPMSSQSPLVIFNTNGQELMAVGGAGGSTIISGVAGVALHALWLKADVKQAVDAPRMHNQLQPNYTWYEPNFPKAYVKSLIDRGHTMKAVNNLT-VVTAAERLDGQIYANSDFRKGSAPAGY 641
160 1.000e-97UniRef50_A0A2E3U818 Gamma-glutamyltransferase n=14 Tax=root TaxID=1 RepID=A0A2E3U818_9GAMM  ali  29  335LTSKDYAQYRFSDFDPQQASDSEDIGAGTWPAESTETTHYSVMDKDGIAVSVTTTLNLGYGNRIVVPGAGFLLNNEMDDFSKPGAPNAYGLLGDEANKIEPGKRMLSSMTPTIVT-RDGETVLVTGSPGGSTIINTVFQVILNTLDHNMSIEQAVASPRIHHQWQPDIVRYEPNFVDGALEELERMGHEMRPGGYGIGDANSILVRDGVMHGTSDPRNDGGASAY 561
161 1.000e-97UniRef50_K5W2B5 Uncharacterized protein n=11 Tax=Agaricomycotina TaxID=5302 RepID=K5W2B5_AGABU  ali  37  375MMTKEYAHEIYTNITDDKTHPPEYYNPEYGMKPDHGTSHTSIIDRNGMAVSLTTTVNSVFGCHVLDPITGMVLNDEMDDFSVPDTPNDFGLWPSPYNFPLPGKRPVSSTAPSIIENADGSIYASLGGSGGARIFGSILQVLLN-LDWGLDASEAVEFSRLHDQLYPLVLDADEDYPSESLEFLRRLGHNVTIADRIAAVVQLVVKRDGVIYAASDSRKNGIAAGY 600
162 1.000e-97UniRef50_U5H6N8 Gamma-glutamyltransferase n=6 Tax=Microbotryomycetes TaxID=162481 RepID=U5H6N8_USTV1  ali  40  484....EYADRVRVNITDERTHTLEHYHPHFDIKEDHGTTHLSTVDRWGSSVSLTSTVNLIFGSRVMDKKTGVIMNDEMDDFATPGIQDAFGLRPSPFNYPAPGKRPLSSTAPMIMDSPDGEVWLSLGGSGGSRIFGAVAQVLLN-LDFGYDLGNAVEQSRVHDQLSPAYVSIESGFREDLIEVLKERGHNTTVFDVNLGIVQAVMRDNGRFFATSDSRKNGIPAAY 706
163 2.000e-97UniRef50_A0A2D5NIW9 Gamma-glutamyltransferase (Fragment) n=1 Tax=Planctomycetes bacterium TaxID=2026780 RepID=A0A2D5NIW9_9BACT  ali  33  192LISEAYARERGRTVDLERVSELGP-GVPPGAPESDDTTHFSIIDRDGNAVSCTTTINSTFGSCCVADGCGFFLNNEMDDFSKPGVPNQFGLIGGKANAIAPGKRMLSSMTPTIV-CKDGELRYVIGAPGGGRIITAVMQVLLNLVDHEMSLKRAVEAPRVHHQWLPDHIQWEAALPADVRRALAAKGHRFRAQPRGIALVFAALQPDGTRVGVADGRSGGAAAAY 417
164 2.000e-97UniRef50_H2YDU8 Uncharacterized protein n=2 Tax=Ciona savignyi TaxID=51511 RepID=H2YDU8_CIOSA  ali  49  364MTADWYADDLRLKINDDHTWPVDYYGPDWSVPDDSGTAHLSLVASNGDAVALTSTINLFFGSKVRGRSTGILFNNQMDDFSAPNISSAFDVPPSPANFIQPGNRPFSSMTPT-VISKHGKPVMVVGGSGGTIITTATALVVMNSLWFGFDVGTSVEMKRVHDQLMPNVTDCEQGLDEAIIAGLRSKGHAINKMSFSYTAVQALLLPDGRISAACDSRKGGYPDGY 590
165 2.000e-97UniRef50_UPI0002B425D7 gamma-glutamyltranspeptidase 1-like n=1 Tax=Hydra vulgaris TaxID=6087 RepID=UPI0002B425D7  ali  43  359MLNSTIASNIRQKIWLNSTHPPSYYGGSF-GKDDFGTTHLSVLAENGDAVSCTNTINTSFGSLLLSNITGILYNNEMDDFSTPGVPNAYGYPPSAANFIHPGKRPLSSMSPSIITDGNGDVKMVVGASGGSQIISAVLQVLLRKIFFNQELGFAIDGFRLHDQGVPNEILYDTP-PKHLLDGLRELGHK--SKSGLYNVVQAIYKDKGKIYAASDPRKGGLPGGY 580
166 2.000e-97UniRef50_A0A0D1P635 Ggt protein n=75 Tax=Proteobacteria TaxID=1224 RepID=A0A0D1P635_BRAEL  ali  33  359LVDKAYAARQRATIDLARATPWIDVRNAKQPHEGDNTTHYSVVDAGGNAVSNTYTLNFPYGVGLVADGTGVLLNNELDDFAAPGASNAFGLVGFEANLPGPGKRPLSSMSPTIVL-KDGKPVLVTGSPGGSRIISAVTQIIVDVIDYKMDIAAAVAAPRIHHQWLPDEVRIERGFPDAVLADLRAKGHKLVE-PLGYSSANSIVVTTNGLLGAPDPRRGSEAAGY 583
167 3.000e-97UniRef50_A0A2X3C460 Gamma-glutamyltranspeptidase n=2 Tax=Klebsiella pneumoniae TaxID=573 RepID=A0A2X3C460_KLEPN  ali  32  43LTSKAYAKAIAAEIDVNKAKPSSQIRPGLAPYESNQTTHFSVVDKDGNAVAVTYTLNTTFGTGIVAGDSGILLNNQMDDFSKPGVPNVYGLVGGDANAVEPKKRPLSSMSPTIVV-KDGKTWLVTGAAVGSS--TTVLQMVVNTIDFGMNVAEATNAPRFHHQWLPDELRVEKGFSPDTLKLLEAKGQKVALKEAMGST-QSIMVPDGMLYGASDPRSDDLTAGY 269
168 4.000e-97UniRef50_A0A1X7VJW9 Uncharacterized protein n=1 Tax=Amphimedon queenslandica TaxID=400682 RepID=A0A1X7VJW9_AMPQE  ali  47  336MLDVDTAVDMRSRITDDTTHDVEYYNQPLHNPESHGTTHLSVIDEKGNAVGITSTINLYFGSRSMSSRSGIIFNNEMDDFSVPGRNNSFDYPPSPSNYIKPNHRPLSSMTPTIVTDEEGSVVMVAGASGGSKIPTATSQVILNTLSFSIPLEDAVSRPRLHHQLIPNTLEVETDFSQSYIEGLEERNHVIRKTSS-VGVVQAIYKEKGGIYAASDKRKGGEPSGY 562
169 4.000e-97UniRef50_A0A1F9AF08 Gamma-glutamyltransferase n=1 Tax=Deltaproteobacteria bacterium RBG_13_61_14 TaxID=1797834 RepID=A0A1F9AF08_9DELT  ali  33  341LLSKEYADYLRESIQPNRATPSREIRGNLLPPESASTTHLSVVDSRGGAVALTQTINTLFGAGVVAPGTGVLLNNEMDDFSAPGAPNAYGLVQGEANAIAPGKVPLSSMSPTMVF-KDGKLWMVLGSPGGPRIITTVLQVIVNMVDFGISLPEAVAAPRLHHQWLPDQLYLEHDFPG--RRELNKKGHVLKHY-LLPCNAQAVMVPDSSLLGASDPRGEGRPAA. 566
170 4.000e-97UniRef50_A0A0T6B606 Uncharacterized protein (Fragment) n=1 Tax=Oryctes borbonicus TaxID=1629725 RepID=A0A0T6B606_9SCAR  ali  42  179LTSEDYALAIRGDIRDNVTFDPAHYGANTTLVEDHGTAHISILAPNGDAVSVTGTINLYFGAGIRSVNTGIILNDEMDDFGAPNISNSFGMPPSISNYIAPYKTPLSSMCPSIIIDDDGAVRMVIGAAGGTKITSSTALVVIRHLWYNYSLEDALEIKRFHHQLFPMSIEFENDFDMEIVEALAKIGHNIAAAADGFAAITAITNNDGQIEAAADTRRPGTVA.. 404
171 4.000e-97UniRef50_A0A1R0H6W2 Gamma-glutamyltranspeptidase 1 n=13 Tax=Smittium TaxID=4888 RepID=A0A1R0H6W2_9FUNG  ali  39  477.MDKDFASEVREKITDDKTHGFKYYEPEHDIDVDHGTTHLSVLDKDDMAVSLTSSINLLFGSRVIDINSGVIFNDHMDDFSTPKLKNAFGLYPSPNNYISPGKRPLSTASAVVIENENG-VEFVLGASGGSRILTSTTQVFLNMVEFNKTLKEAIDSPRLHHQLLPEVLLVEPFYPKNIVNELKERKHKIGPMNQGTSVVQGVRKQDGTFNAVSDGRKFGGPAAY 700
172 5.000e-97UniRef50_A0A0K3CRJ7 BY PROTMAP:  ali  38  506....KYADAVRGNITDSRTHKLSYYHPRFDIKEDHGTTHLSVIDQWGGAVALTTTVNLIFGSRLMDEETGIILNDEMDDFATPGLPDAFGLRPSPFNYPVGGKRPLSSTAPLIMDHANDDVYLSLGGSGGSRIFGAVAQTLLN-LDWGHDLSSAVEAPRVHHQLLPAYVSIESTFRPDLVKELKARGHDVTLFDINLGIVQAVMRDDGRFFAASDSRKNGVPAAF 729
173 5.000e-97UniRef50_A0A0J9XC32 Similar to Saccharomyces cerevisiae YLR299W ECM38 Gamma-glutamyltranspeptidase, major glutathione-degrading enzyme n=5 Tax=Saccha  ali  38  424ILDPKWADMIRTNISDDNTHPWQFYSPAYEGKDPHGTAHFSVLDADGMAVSMTTTVNLLFGSLVVDPVTGIVLNNEMDDFSTPGTRNAFDLEPSIYNYIAPFKRPLSSCVPTVITDTTQWPEFVIGAAGGSKILTSVFQAIVRKLEYGMPLLDVVRAPRIHHQLLPDVAYLEMLAPETVRNELEKRGHTVKSIAPA-STMNGIYINPGIIHAVSDWRKRGQADGY 651
174 6.000e-97UniRef50_A0A2E9QRZ3 Gamma-glutamyltransferase n=1 Tax=Deltaproteobacteria bacterium TaxID=2026735 RepID=A0A2E9QRZ3_9DELT  ali  33  426LISRKYAAALRKKISMEKAAPKGSVKPGAPADFTKHTSHISVIDQWGNAVAMTLTINTTFGSGVIAKNTGVIWNSEMDDFTAPGKPNSYGLMQSDANAIQPGKTPLSCMTPTLVF-EDGRLRGSIGSPGGPTIITTVAQIILNLIDHGMSIQRAVRFPRIHHQWKPEVLYVERRASNRAILRLKRRGHKVK-FRSWWGNAMGVWIDDGMLDGAADPRGDGVADGF 651
175 6.000e-97UniRef50_Q023P7 Gamma-glutamyltransferase n=3 Tax=Bacteria TaxID=2 RepID=Q023P7_SOLUE  ali  30  329LLDPKYIARQRASIDPERATPSAQIKAAFTGHESMETTHYTVADEAGNVVAVTYTLNGGFGSKVTATGLGFLLNNEMDDFSKPGEANMYGLIQGEFNAIAPGKTPLSAMTPTIVL-KDGKPVLAVGSPGGPTIINTVLEVVVNVLDFGMGVQDAVNWPRFHHQWMPDELRMEPGYSPDTIALLEKRGYIIKRTN-AQGEAAAIRWNNGWLEGAPDPRTEGTAEG. 552
176 8.000e-97UniRef50_A0A0P5XHW2 Gamma-glutamyltranspeptidase 1 n=3 Tax=Daphnia magna TaxID=35525 RepID=A0A0P5XHW2_9CRUS  ali  41  154LISDSFVDETRSKMCDSATSDPAYYGAACYAPEDNGTSHVSVVDETGMAVAVTSTINLHFGAGFASAQTGIILNNEMADFSPSCSVNCYGLPPSSINMVKPGKRPLSSMTPTVVVNSSGRVRLVIGAAGGIRITTSTVYAMIRNLWLGEDIKEAIDSPRFHHQLFPMTLNYEKGLPKEMVKQLANRGHQMSQENTRGGSVYGISVEDGYLYANADYRKGGDVAGF 407
177 8.000e-97UniRef50_A0A2M7YWN8 Gamma-glutamyltransferase n=1 Tax=bacterium CG_4_9_14_3_um_filter_65_15 TaxID=1975567 RepID=A0A2M7YWN8_9BACT  ali  38  360LTAPGYLDSLAARFDPLHTFGPEAYGTASSPADDSGTSHISVLDQDGMAVGCTETINLEWGSAVDVPGWGFFLNDEMDDFTTSEGANAYGLVQSNRNRPEPGKRPLSSMSPTIVL-ENGRVAAVAGASGGPRIISGTLQVLLAALVFGNDAGQAVDRPRLHHQWLPDEVRVESGWTDQALKGLQARGHHVVDYPKSVGVVQAIVVQGGRITAASDPRKGGRPAG. 583
178 9.000e-97UniRef50_A0A2G6JJK0 Gamma-glutamyltransferase n=1 Tax=Planctomycetes bacterium TaxID=2026780 RepID=A0A2G6JJK0_9BACT  ali  34  335LIDKDYVAKRRQDFDWERATPPKIDDPQGVRRESKDTTHYSIVDAAGNAVSITTTINSSFGNGQLVPGAGFLLNNEMDDFSKPGVPNQFGLVGAKANEIQPGKRPLSSMSPTIVLSKDGKPLLILGSPGGSRIINTTFQVILNVLDHQMPIRQAVPAPRIHHQFLPPALYWEPALPQEVRAALLARGHSIQDKARIIGRCQAIWLPPGRVEAMADPRSGGAAKAW 573
179 9.000e-97UniRef50_A0A2N1IIL0 Gamma-glutamyltransferase n=3 Tax=Gammaproteobacteria TaxID=1236 RepID=A0A2N1IIL0_9GAMM  ali  31  383LTSKAYAQALSKNIKRNTITPSSDIKAGEPSKESPDTTHFSVMDAAGNVVSSTYTLNHNYGSGIIIPGTGILLNNTMDDFSVAGSPNSYGLIGGTANAIEAKKRPLSSMTPTIVL-KDGEPYIATGTPGGSKIITSVFQQLVNTLYFEMNIAEATNAPRVHHQWQPDVLSVERNTPADTVDILKAKGYTVNISSS-LGSLQSIMKHNGVFLGAADPRRPGSAA.. 605
180 1.000e-96UniRef50_W4YAM1 Uncharacterized protein n=2 Tax=Strongylocentrotus purpuratus TaxID=7668 RepID=W4YAM1_STRPU  ali  39  132MTSDDVASLIRQTINDVRVTNVTQYDTPFANTFDEGTSHLSVIAPNGDAVAMTSTVNNGFGSKFMSPTTGVVLNNQMDSFSTPGLRNSDGIAPSSPNFIKPGKRPMSSMSPTILLAENGDVRLALGASGSSRMITSISLVSLRTQCFDEDLRDVINQRRLHHQLSPNYIQYEEGFSEEILSRLENKGHE-TYLQTRYAVVQAILRREGSLYAFSDPRKGGIAAGF 358
181 1.000e-96UniRef50_A0A2B4S5Q8 Gamma-glutamyltranspeptidase 1 n=4 Tax=Stylophora pistillata TaxID=50429 RepID=A0A2B4S5Q8_STYPI  ali  44  456MTNSAFGESLRQLIYDNQTFDYKYYGDFYSSVNPAGTTHLSLISPDGDAVSATTTVNLYFGSKYRSMRTGIIYNNEMDDFSTPGEKNYFGVEPSPSNFIEPGKRPMSSMTPTIIVDHNNVTRLVVGASGGTKITTAISLVAMNYFWFNQTLTKAVEEPRFHHQLLPNFLRIERPISLAVQEGLKRLGHNLTEFSS--AVVQAAAVPDGKRYGKADPRKGSWAAGF 681
182 1.000e-96UniRef50_A0A2S5BCG3 Putative Gamma-glutamyltransferase n=1 Tax=Rhodotorula taiwanensis TaxID=741276 RepID=A0A2S5BCG3_9BASI  ali  39  559....KYADAVRANITDDRTHKLAYYNPQFDIDEDHGTTHLSVIDQWGGAVSLTTTVNLIFGSRVMDTKTGIILNDEMDDFSTPGLPDAFGLRPSPFNYPEGGKRPLSSTSPLIMDHADHEVYLALGGSGGSRIFGAVAQTLLN-LDWGYDLANAVEQPRVHHQLLPAYVSIESTFRPDLVEALKLRGHNTTLFDINLGIVQACMRDDGRFFATSDSRKNGIPAAF 782
183 1.000e-96UniRef50_UPI000D77B222 gamma-glutamyltranspeptidase n=2 Tax=Microstromatales incertae sedis TaxID=162477 RepID=UPI000D77B222  ali  42  445......AYQLAKKVDDTRTFPIDHYAPLFDVPEDHGTTHISAVDSSGMAVGITSTVNLIFGSQVMDPETGVIFNDEMDDTSTPGTPNAFGLYPSPYNYPQPGKRPLSSMSPVVIEDAQGRFQVLLGAAGGSRIPTSVLSTLLNMDIKGMDLSQAIEAPRLHHQLLPDVVAVESTFDEELDEGLRARGHQLKIDDLGYASVQGVQRRDGTYLASSDSRKAGWAAAY 673
184 1.000e-96UniRef50_UPI0004743CE4 gamma-glutamyltransferase n=2 Tax=Enterobacterales TaxID=91347 RepID=UPI0004743CE4  ali  31  216LLSKDYAAEIRKQIEPENATPSKNVQPGIGPHERPETTHYSIVDNQGNAVSTTYTVNGRFGSVVIAPGTGFFLNNEMDDFTVKGEKNLYGLVQGERNSIAPGKRPLSSMSPSLVT-KDGKIFMVLGSPGGSRIITITLQTALNIIDHGMAPQEAVDAPRIHHQWLPDEVYYERGLSADTLNLLKQRGYNMVEQTPWGAGAAGVVVREGYLYGANDIRRPGAAIGY 464
185 1.000e-96UniRef50_A7SF26 Predicted protein n=1 Tax=Nematostella vectensis TaxID=45351 RepID=A7SF26_NEMVE  ali  46  357LTSPVYAEKIRQNIWDNQTHNASYYGAETGQTVDGGTTHLSILASNGDAVSVTSTINYRFGAAYLGRRTGILFNNEMDDFSTPGATNLYGLPPSEVNFIKPGKRPQSSMAPVIFTDQEGDVELVCGAAGGSMIITSTSLVSMSKLWFGRSLSEAVKEPRLHHQLFPDVVTYPYELPLAIRKALETRNHTVSP-RTSQNIVQAVSRNDGSLYGMSDPRKFARAAGY 586
186 1.000e-96UniRef50_A6DTD9 Putative gamma-glutamyltranspeptidase n=1 Tax=Lentisphaera araneosa HTCC2155 TaxID=313628 RepID=A6DTD9_9BACT  ali  27  343IISKKYAKKLKRSIKMNRARPAKEISGKVHFRESNDTTHFSVSDRQGNVLSFTYTINYSFGSGIMIPGLGFFLNNEMDDFAIEGVPNSYGLLGGEANFVKSNKRPLSSMTPTIVFKKD-QPYLCTGSPGGSRIISTVLQILLNVIDFNMDLREATLRPRIHHQWLPDKLEFESGLNEEIVESLKKKGHNTEEV-FPFGCAETIMMRYDGKHGFADPRRDGKALG. 567
187 2.000e-96UniRef50_UPI000BA1CEF0 gamma-glutamyltransferase n=1 Tax=Altererythrobacter mangrovi TaxID=1982042 RepID=UPI000BA1CEF0  ali  33  353LISPQHAALIRAEIQPDKATPSSEVKGLSGPVEGTHTTHFSIVDAQRNAVSVTYTLNYLFGIGQIAGDTGFFLNNEMDDFSKPGVPNGFGLVQGKANAVAPGKRPLSSMSPTIVL-KDGKPYIVTGSPGGATIISTTMESIINVIDFGMNMQQSVNAPRIHHQWLPDNVMVEPGYTDKTRTALEAMGYKFHDVSAWGAD-EAIRIDPGMLEGANDRRRPGLAAGY 580
188 2.000e-96UniRef50_A0A0D6KLS8 Gamma-glutamyltransferase n=7 Tax=Nostocales TaxID=1161 RepID=A0A0D6KLS8_9CYAN  ali  37  346LISTAYAKKRRQEINMEVAKPATEVKPNPKFSESPETSHLTVVDAQHNAVSLTFTINLGFGAGVVTPGTGIVLNNEMDDFAAPGVPNAFGLVGNEANAIAPRKTPLSSMTPTIVT-ENGHLRMAVGAPGGSTIITQVLQVILNVLEYGMDAGAAVSAPRIHHQWLPDELRVEPGLDALTLQELRRRGHNIKQTTPW-GNANAIVVTADRLEGAADPRGEGAAIGY 599
189 2.000e-96UniRef50_A0A2E9F8K6 Gamma-glutamyltransferase n=3 Tax=Candidatus Poribacteria bacterium TaxID=2026781 RepID=A0A2E9F8K6_9BACT  ali  32  343LISKSYSNKQRSKINTDLVLDLEHGNPLPY--ESENTTHFSVLDQDGNAVSITQTVNTSFGSGMIIEGTGIILNNEMDDFSAPGVPNIYGLVGAEANSIAPQKRPLSSMSPTI-LSKDGQTFMVIGSPGGPRIITTVVQAIINVIDYGMDIQSAVDAPRIHHQWRPNKLRVEAEYPIDTSTTLLNLGHQIEQKGSW-SLAHGITFETGIIYGGADHRQDSLAIGW 568
190 2.000e-96UniRef50_A5E8W9 Gamma-glutamyltransferase 1, Threonine peptidase, MEROPS family T03 n=70 Tax=root TaxID=1 RepID=A5E8W9_BRASB  ali  33  365MLSKDYAARQRASIDPMRATSAGDVLNIKPLREGSNTTHFSVVDNDGNAVSNTYTLNFPYGVGLVAAGTGVLLNNELDDFAAPGASNAFGLVGFEANLPGPGKRPLSSMSPTIVL-KDGQPVLVTGSPGGSRIISTVLQVIVNVLDYQLDVREAVKAPRLHHQWMPDEVRVEKGFADDVLADLRALGHRIEEPMGRTS-ANSILVTPAGLIGAPDPRSKGAAAA. 587
191 2.000e-96UniRef50_UPI000B988EBC gamma-glutamyltranspeptidase 1-like isoform X1 n=4 Tax=Nilaparvata lugens TaxID=108931 RepID=UPI000B988EBC  ali  40  442LSSPEYIKAVRSKVHDDRTQNHSYYGARFDLIEDHGTANLVVLGPNGDAVSVTSTVNLVFGSKFVSKSTGIILNDQMDDFSAPNITNFFGMPPSPSNFIRPGKRPMSSMSPAIFVQGDGSVRLILGSAGGTKITTSIAWVSMMNLWFGMNIKEAIDEPRIHHQLFPMQFSYELGVLKSTVDAAKKIGHKTNRLNTWRSCVTGIAYSDGKIEGISDFRRPGSVEGF 669
192 2.000e-96UniRef50_U7QM81 Gamma-glutamyltransferase n=76 Tax=Bacteria TaxID=2 RepID=U7QM81_9CYAN  ali  34  358LTSLPYAAEQRQAIDMNEARPSTEVKPVDEATESPETSHLTVVDNERNVVSLTFTINGSFGAAVVAEGTGILLNNEMDDFAAPGVPNLFGLVGGEANAIAPLKTPLSSMSPTIVT-RDGKFVMAGGSPGGSTIITTSLQLVLNVVEFGMNAGEAVSEPRIHHQWLPDRLIVEKGMNPETLDELRRRGHDIEKWDGW-GNANLIRLTNGVLEGAADPRREGAAIG. 588
193 3.000e-96UniRef50_A0A0C4DKA1 Gamma-glutamyltransferase n=3 Tax=sordariomyceta TaxID=715989 RepID=A0A0C4DKA1_MAGP6  ali  38  94MLSAATAAEVRKKIQADKAFGVDYYNPDLESLKTPGTSHMAAMDAHGMAVSLTSTINLIFGSRVLVPETGVIMNNQMDDFSQPGRSNAFGYAPSPANFIRPGKRPLSSMSPVIVEVKGKKPYLVVGAAGGSRIITATVQNVINVIDRGKNVAQALAMPRLHDQLIPAVTTFEWAYDNSTVAYIKGLGHNVSWVAPVQSAAQAVRLPNGTFEAAGEPRQGGYAV.. 325
194 3.000e-96UniRef50_A0A258DZG9 Gamma-glutamyltransferase n=2 Tax=Bacteroidetes TaxID=976 RepID=A0A258DZG9_9BACT  ali  29  121LFDSDYLKSRMETFNWEKATKSEDIAAGIEFAESMETTHYSIVDAAGNAVSVTTTLNGAYGSKLYVDELGFFMNNEMDDFSKPGTPNMFGLIGAEANSIAPGKRMLSSMTPTIVE-KNGKLFMVVGTPGGSTIITSVLQTILNVAEFDMGMQEAVESPRFHHQWLPDLVNFEPAFDSTLIQTLKSRGYLINEANPIIGKVDAILVPDGKLEGGADPRGDDMAVGF 349
195 3.000e-96UniRef50_E6ZUW4 Related to gamma-glutamyltransferase n=17 Tax=Basidiomycota TaxID=5204 RepID=E6ZUW4_SPORE  ali  38  459......ARQIVPNITDDKTHPLEYYHPKFDIINDHGTMHLSILDQHGMAIAVTSTVNLIFGSRVMDAATGVILNDEMDDTSTPGVPNAFGLAPSPYNYPEAFKRPLSSTCPTIIESEAGEVELVLGGSGGSRIFSSVLQTILNFYLWGMDLSQAIEAPRLHHQLLPTQLSVETGYSNKTLAGLLGRGHEVSWIDIDLGIVQAVAVEGAGVWAASDSRKGGVAVA. 683
196 3.000e-96UniRef50_A0A194QUB0 Gamma-glutamyltranspeptidase 1 n=1 Tax=Papilio machaon TaxID=76193 RepID=A0A194QUB0_PAPMA  ali  41  283.TTPSYGAEIRARINDSSTSDTAVYGATEYNQPDAGTAHISIIANNGDAVSVTSSVNYYFGAGFTTLNTGIVMNNVMDDFSLPGFTNYFGLKPSPANFIAPGKRPMSSMSPSIIVDKGGNAKLVIGASGGTKITTAVALVAMRKLWFGQTIKQAVDEARLHHQI----------FPQDIIKGLRAKGHGMERYPGRGSIICAMYRNRTGIYANADFRKGGDVAG. 496
197 3.000e-96UniRef50_A0A0L0SIX0 Gamma-glutamyltransferase n=3 Tax=Blastocladiales TaxID=4805 RepID=A0A0L0SIX0_ALLMA  ali  39  387ILTKQEAAMARRNISDSTTYPPEHYRPKYENAPSHGTTHVSVVDANDMGVAVTSTVNLIFGSHIMDRKTGVVLNDQMDDFSFRNFSNAFGLPPSPSNFVEPMKRPMSSTVPTIVE-KDGRLELVVGGSGGSRILSAVLQTILNQIEFEWGVTRAVTAPRLHDQLYPNVCEVEDGFDPRSVQELAQRKHELKPVGRHESVVQAVARRDGALEAVSDYRKGGRPDGY 613
198 3.000e-96UniRef50_A0A1B0EW75 Uncharacterized protein n=1 Tax=Phlebotomus papatasi TaxID=29031 RepID=A0A1B0EW75_PHLPP  ali  41  296.............IDDTTTQQPKDYGGNFHISEDQGTAHISLLAPNGDAISVTSSVNFYFGCGNMGNRTGIIFNSGMDDFSSPGLKNYFGLPGSPPNYIRPRKRALSSMSPTIVVGNDGNVKLVIGAAGGTKITTAVAMATMRILWFGQDVKEAVDAPRFHHQLIPMWVDYEYGTEEYIVEGLERLGHKTNRYNYRGSIICAIKRNDTAIYGNADFRKEGDVFGF 508
199 3.000e-96UniRef50_A0A2V9L257 Gamma-glutamyltransferase (Fragment) n=1 Tax=Acidobacteria bacterium TaxID=1978231 RepID=A0A2V9L257_9BACT  ali  32  92LISSEYAAKLREQILTSKPEAPVQAGLAMTWRESSQTTHFSVVDAEGNAVANTYTLNGGYGSGVTVEGAGFLLNDEMDDFAKPGQPNMFGLVQGEANSIQPRKRPLSSMTPTIVLRDSGTPVLVLGSPGGGTIINTVLQVLLNALVFKMDAREAVTSPRFHHQWMPDELVVEDGFSADTLEKLRQAGYRISSRRGKIGECQAITIDPGWRFGAADPRGDGRAVGY 343
200 4.000e-96UniRef50_A0A0P5PM49 Gamma-glutamyltranspeptidase 1 (Fragment) n=8 Tax=Daphnia magna TaxID=35525 RepID=A0A0P5PM49_9CRUS  ali  41  302LISDSFVDETRSKMCDSTTSDPAYYGAACYAPEDKGTSHVSVVDETGMAVAVTSTINLHFGAGFASAQTGIILNNEMADFSPSCSVNCYGLPPSSINMVKPGKRPLSSMTPTVVVNSSGRVRLVIGAAGGIRITTSTVYAMIRNLWLGEDIKEAIDSPRFHHQLFPMTLNYEKGLPKEMVKQLANRGHQMSQENTRGGSVYGISVDDDELYANADYRK....... 526
201 4.000e-96UniRef50_B2ITI2 Gamma-glutamyltransferase n=36 Tax=Cyanobacteria TaxID=1117 RepID=B2ITI2_NOSP7  ali  37  351LLSPAYAKQRRQEINMQVARPSTKVKPVDTRYESTETSHLTVVDEERNAVSLTFTINLSFGAGVVTPGTGIILNNEMDDFAAPGVPNAFGLVGNDANSIAPRKTPLSSMTPTIVT-ENGHFRMAAGAPGGSTIITQVLQVILNVLEYNMNVGAAVSVPRIHHQWLPDELRVEPGLDALTLEELRRRGHKIKESTPWGNG-NAIAVTDGTLEGAADPRGEGSPRG. 606
202 4.000e-96UniRef50_B0W7T9 Gamma-glutamyltranspeptidase 1 precursor n=12 Tax=Culicidae TaxID=7157 RepID=B0W7T9_CULQU  ali  39  364LTNKNYAAFIRDGILDNKTFDYEHYGAIFSNEEDHGTAHISVLAPNGDAVAATSTVNYVLGAMIRSQKTGIVLNDEMDDFSTPGVINSYGLHASPSNYIVPGKRPLSSMCPTVVTDRHGNVRIVGGSAGGSRITTATLLLIVRHLYFGEDLADIIKNPRIHHQLAPMSVEYESGFDQNVVDDLTVRGHTMKQADSGFAAITAIIRDKDKITATWDPRRSGS.... 588
203 4.000e-96UniRef50_UPI000C7793B0 glutathione hydrolase 1 proenzyme-like isoform X1 n=2 Tax=Eurytemora affinis TaxID=88015 RepID=UPI000C7793B0  ali  35  243LTSENWIENIKNVIVDDQTSDPAHYGASYIPTEDHGTCHMNFLDPEGNAVSVTASINLIYGCKYLSRSTGIIMNNQMDDFASPNIVSAYKLRPSENNFIHPGKRPMSSISTTIVLDSEGRVIAVAGASGGTKIITAVAQVLLRTLYLGQNVKDAIDAPRLHHQLLPMELWYEEGNSRWMLKELTSIGHNLTYFPTGGSAVQAILVDTGLTTANADYRKGGGVYGF 470
204 4.000e-96UniRef50_A0A182LXZ4 Uncharacterized protein n=2 Tax=Cellia TaxID=44534 RepID=A0A182LXZ4_9DIPT  ali  41  52LTDPQFASHIREKINDERTSNFEYYGAEFADVQDKGTAHICVLAPNGDAVSATSTINYLLGAKIRSQSTGIILNDEMDDFSTPGTFNTYGLPASPANFIAPGKIPLSSMTPSIVTDRDGTVRMVLGGAGGSRITSATAVMIYRHVVFGDDLETIMNEKRLHHQLAPMWVDYEVGFPQAILDGLVAKGHQVKEKDAGFAAATGIVQDAKTVQAAFDPRRGGSV... 279
205 5.000e-96UniRef50_A0A2A6CIF4 Uncharacterized protein n=5 Tax=Chromadorea TaxID=119089 RepID=A0A2A6CIF4_PRIPA  ali  45  397MTTPEWAKWVRSLITD-VTHPDAYYGGTFEAPADHGTTHISVIDKFGNAVSVTSTINLLMGSIRASNSTGILWNDEMDDFSLPGHPNYFGFPPSPANFIKPGKRPQSSMSPIVIFDKDDRQLLSVGGAGGSTIISGVASVALHALWLNANVKQAVDAPRLHNQLQPNVTQYESNFPTDYIDNLIARGHIMEKTDNLT-VVTAVERSDKQIYANSDFRKGDEPAGY 624
206 5.000e-96UniRef50_UPI0008117BE8 LOW QUALITY PROTEIN: gamma-glutamyltranspeptidase 1-like n=2 Tax=Acalyptratae TaxID=43741 RepID=UPI0008117BE8  ali  37  292LTNPEYSMSIREKINDNKVHEIFDYGANLWXEDDAGTSHVVVLAPDGDAVSVTSSVNEYFGASQAGRRTGIVFNSAMNDFSVAGTTNHYGLPAAPTNFIDARKRPMSSMSPMILTDQKGNVRLVLGAXGGSKIISAVVEVAARFLWFGQDIKSAIDAPRIHHQLLPNVLQYEFGFSEEVLQLLKAKGHELQPYKXIGSVVCAIARNDTAIYANADFRKRG..... 513
207 7.000e-96UniRef50_A0A0B7IN88 Gamma-glutamyltranspeptidase n=439 Tax=root TaxID=1 RepID=A0A0B7IN88_9FLAO  ali  28  338LLNPNYLTYRMSDFSWDKASRSSEISGKLSSYESEETTHYSIVDSYGNAVAVTTTLNTNYGSKVYVRGAGFFLNNEMDDFSIPGVPNVYGLVGSEANAIAPNKRMLSSMTPTIVEH-NGKLKMVIGTPGGSTIITSVLQNILNVIEFGMTMQEAVNQPRFHHQWLPDEVKLEPGFDRKTVEELMGKGYLIKEEDSIIGKVDAILVPNGELEGGADPRGDDRAIGF 566
208 7.000e-96UniRef50_A0A267GH36 Uncharacterized protein (Fragment) n=16 Tax=Macrostomum lignano TaxID=282301 RepID=A0A267GH36_9PLAT  ali  43  403MTSSSYASELRSRITDDATHDVNYYGPMFEWKEDSGTTHVSLVDSDGNAVAVTSTINTYFGSLVRGEKTGIVYNNEMDDFSQPNRTNYYGLPPSPTNFIAANKRPMSSMAPMIVVNADGHVQFVSGASGGSRITTAIAYTLARQLYLNETVKAAVDSYRLHHQLLPNVLNYNPDPPESIKQRLRQKGHKVQPFSS-TSVVEGIQRSGGQLQANADFRKPSKTGGF 630
209 7.000e-96UniRef50_A0A2G9GKA8 Gamma-glutamyltransferase n=75 Tax=Magnoliophyta TaxID=3398 RepID=A0A2G9GKA8_9LAMI  ali  42  347MLSEKFAAELRKTILDNTTFNSSHYGGRWNQIHDHGTSHISIVDRQRNAVSMTTTINVYFGSKFLSTSTGIILNNEMDDFSMPANSSENAPPPAPANFIYPGKRPLSSMTPTIIV-KDGHLKAVVGASGGSFIIAGTTEVILNHFVRGMDPLSSVLAPRSYHQLIPNILQYENWVPAEIRAALQKKGHILRSIAGGT-ICQFIVQESGQLIGVSDPRKGGFPAGF 583
210 9.000e-96UniRef50_A0A2P2I6D7 Gamma-glutamyltranspeptidase 1-like (Fragment) n=1 Tax=Hirondellea gigas TaxID=1518452 RepID=A0A2P2I6D7_9CRUS  ali  39  378MTSDDYAKSIRMKIMENGTQDPQYYGAYYEIVEDYGTSHISVISADGDAVAATSTLNTAFGALIASARTGIIFNNQMDDFSSPNITNVFGVPPSPANFIKPGKRPVSSMCPAILVSDSGDVSLVIGAIGGTRISSAVAQVVLNSMCH-LSLADSIAAPRMHHQLVPMSLMVERDFSQDLLRKLSELGHDIAMYPS-VSVVNAVSRTNGELHAVADHRKFGGTDG. 602
211 1.000e-95UniRef50_A0A1F9GGS5 Gamma-glutamyltransferase n=1 Tax=Deltaproteobacteria bacterium RIFCSPLOWO2_01_FULL_45_74 TaxID=1797872 RepID=A0A1F9GGS5_9DELT :_  ali  33  346LIAKEYAKTLAESIDLRKATPSEKAPPELVTRESDSTTHFSIVDTEGNAVASTQTINTLFGSGMVVQGTGIVLNNEMDDFSIPGVPNAYGLVGSEANSIMPGKKPLSSMAPTFVFNPKGELVMVVGAKGGPRIITSVLHTIFNQIDFKAKPLQAVAAKRYHHQWLPDELQYEPGFSEKLTQRLTMAGHLLKEGKASW-LVTLIAKSGEGWIGVSDPRGFGSPLGY 572
212 1.000e-95UniRef50_O14194 Glutathione hydrolase proenzyme 2 n=4 Tax=Schizosaccharomyces TaxID=4895 RepID=GGT2_SCHPO  ali  36  384LLSKEFASQIRNNISLSKTYPWEHYNPSYDLPISHGTTHVSTVDSNNLAVSITSTVNLLFGSQLMDPVTGVVFNDQMDDFSIPGASNAFNLSPSPWNFIEPFKRPQSSSAPTILTDINGDFEMALGASGGSRIVTAVLDSIIKRIDMDYDIESMVASARPHHQLLPDILILESGFSKSVATRMKKYGHKVKQHDTPLSQIQAVTRHHSEYYGMSDPRKYGQAAAY 611
213 2.000e-95UniRef50_A0A0V0YIE9 Gamma-glutamyltranspeptidase 1 n=24 Tax=Trichinellida TaxID=6329 RepID=A0A0V0YIE9_TRIPS  ali  39  387ILTKQYAQEVRKKIT-NHSHESSYYGELFTSRPNHGTTHISVLDAEGNAVSLTATINTYFGSKVRSKKYDIIWNNDMDDFSTPGLTNFFEYPPLPNNFIKAGKRPLSSMSPLIFYDQNGNVKLVVGAAGGSRIISATAWVALRSICLNETIKEAVDRPRLHHQLSPDRAYYETLFPQGFVDDLKNYGQNMVPIEPVTAATGILVSDNGVISANSDWRKGGYPAGY 612
214 2.000e-95UniRef50_A0A139AE70 Gamma-glutamyltranspeptidase n=1 Tax=Gonapodya prolifera JEL478 TaxID=1344416 RepID=A0A139AE70_GONPR  ali  38  301..DKAHAEEVRVGISDFHTFPPEHYGGKFSAEETPGTMHVSLVDKEGYAVGLTATINLLFGAQIMDITSGVILNNEMDDFSSPTFNNSFRLPPSPSNFIVPGKRPMSSSAPVIVEH-NMEVLACLGGSGGSRITTGVAQVLLNLLDYQMDPLSAVMDPRVHHQLFPDSVQVEWNFSPDSEEALRTKGHLVEPLDTFMSIVNTILRENGMIYAVSDPRKRGLAAAY 525
215 2.000e-95UniRef50_A0A2E6SGR1 Gamma-glutamyltransferase n=6 Tax=FCB group TaxID=1783270 RepID=A0A2E6SGR1_9BACT  ali  31  337LISKNYAVNRISDIDLKNATPSESIAGKTSDYESRETTHYSVVDKWGNAVSVTTTINLSYGSGHLVKGAGFFLNNEMDDFSSPGVPNAFGLVGNEANAIQEGKRPLSSMTPTIVL-KENKPFIIIGSPGGSTIITTTMQVILNIIEYEMDIKEAVDSPRFHSQWFPDVIMTEPGLAKDVVNNLKARGHKLIPYKGYIGEANGIMITEDGYYGGGDNRGETSAVGY 564
216 2.000e-95UniRef50_A0A0N4VUB9 Uncharacterized protein n=3 Tax=Rhabditida TaxID=6236 RepID=A0A0N4VUB9_HAEPC  ali  45  100ITSKKWAEWVRSKITEE-THPDEYYGGSLEAPADHGTTHISVIDIHGNAVSVTSTINLYLGAAVTSPSTGILWNDEMDDFSTPHHPNTFGIPPSPANFIRPGKRPMSSQSPLIIFDKSAKRVLVVGGAGGSTIISGVAGVALHNLYLKANVKQAVDAPRLHNQLYPNSTSYEPNFPQAYLTELESRGHILKKVRNLT-VVTAAERADGQLYANSDFRKGSSPAGY 330
217 2.000e-95UniRef50_J3KWG7 Uncharacterized protein n=10 Tax=Poaceae TaxID=4479 RepID=J3KWG7_ORYBR  ali  42  224MLSPAFADKIRQKIVDNTTFPPGYYFPKWSQLRDHGTSHLCVVDGDRNAVAMTTTVNYYFGAHVLSPSTGIVLNNEMDDFSVPAERTPDHLPPAPANFIAPGKRPLSSMTPSIIL-KDGQLAGVVGGSGGTNIIATVAQVFLNHFVVGMHPLAAVQHPRVYHKLVPNEVVYEDELSGETREFLRRRGHRLKSTDSG-AVCQFIVQDHGMLTAVSDPRKGGRPAG. 480
218 2.000e-95UniRef50_A0A0P5TL02 Putative Gamma-glutamyltranspeptidase 1 n=1 Tax=Daphnia magna TaxID=35525 RepID=A0A0P5TL02_9CRUS  ali  42  105...............DSATSDPAYYGAACYAPEDNGTSHVSVVDETGMAVAVTSTINLHFGAGFASAQTGIILNNEMADFSPSCSVNCYGLPPSSINMVKPGKRPLSSMTPTVVVNSSGRVRLVIGAAGGIRITTSTVYAMIRNLWLGEDIKEAIDSPRFHHQLFPMTLNYEKGLPKEMVKQLANRGHQMSQENTRGGSVYGISVEDGYLYANADYRKGGDVAGF 321
219 3.000e-95UniRef50_A0A1J5DL90 Gamma-glutamyltransferase n=2 Tax=unclassified Deltaproteobacteria (miscellaneous) TaxID=122706 RepID=A0A1J5DL90_9DELT  ali  37  341LIEPSYAETLRSKIKPDQVLPLDSYGSATQLTPDDGTAHFSIVDERGNAAACTTTINMGLGSMVYVASSGVLLNNEMDDFQKPGAANAYGLVGTEANAVAPGKRPLSSMSPTLLL-RDGKVFMAVGGSGGPQIISSTLQVIVNVVDFGMSARAAVEAPRIHHQWLPDELWVEPEVARDVVVNLESRSHKVR-SEALYSAVQVVVVDSGRRSAASDPRKLGAPSA. 565
220 3.000e-95UniRef50_E0VKX6 Gamma-glutamyltranspeptidase 1 precursor,putative n=1 Tax=Pediculus humanus subsp. corporis TaxID=121224 RepID=E0VKX6_PEDHC  ali  46  284.TDKSVGETLRGKINDNFTYDPSYYGAVFVNKDDHGTAHVSVISPDGDAVSATSTINLYFGAGVTSKNTGIILNSGMNDFSSKYLKNFFNLPPAEANKIEPGKQPLSSMSPTILVDENGDVRLVVGAAGGTKITTSVAYVIIRHLWFGEDIKTAVDASRIHHQLFPKTLR------------LQKLGHEVHRPRNRSSVVCAVAKYNESIFANADYRKGGS.... 492
221 3.000e-95UniRef50_A0A2D6R319 Gamma-glutamyltransferase n=2 Tax=Acidobacteria bacterium TaxID=1978231 RepID=A0A2D6R319_9BACT  ali  35  375MISAEYGTERRASIEMARATPSSAIGPGLGRPEETETTHLSVIDADGNAVAVTTTINSFYGSKVTVRDAGFLLNNEMDDFAAPGKPNQFGLVQGENNAIEAGKRMLSAMTPTIVVRPSGELFFVVGSPGGATIITNVFQNISNVVDFEMTVVEAVNAPRLHHQHLPDRIQYEPGLTEETMAALRAMGHTVDERYPYIGDAQAIMVAGDRMLGWSDPRRGGAAVGY 609
222 3.000e-95UniRef50_A0A293N727 Uncharacterized protein (Fragment) n=1 Tax=Ornithodoros erraticus TaxID=265619 RepID=A0A293N727_ORNER  ali  40  402MLSKQYADSIREKISDAETHDPEYYGPDGFNAENKGTAQVSVLAANGDAVSATSTVNAYFGAMLRSTSTGIVLNNGMDDFSVENSTNRFGVHWSPSNLIAPGKRPMSSMCPTVLLDADGKVKIVFGGAGGTRITSAAALILFRNLYLNENIKQAIDGLRLHHQLFPNQIFYEKGFPQALLDSLRDIGHQLKE-EVEHSSFQGIVRLDGTLTANMDNRKRGSVEGF 627
223 3.000e-95UniRef50_A0A1F6G5Z5 Gamma-glutamyltransferase n=4 Tax=Proteobacteria TaxID=1224 RepID=A0A1F6G5Z5_9PROT  ali  33  345LISKGLARDEARRISRTTATPSAQIAPRIGGYESTQTTHFSVIDAKGMAVSNTYTLNLSFGSGIVIAGTGVLMNNEMDDFSKPGSTNAYGLIGGRANEIAPKKRMLSSMSPTIV-RRNKKVVLVTGSPGGSHIITTTLQVILNVLDHQMVLERAVTQPRMHHQWLPDELWVEPGFDPEVLNDLTKKGHQI-VQSRYLGAANSIHWNSGQLTGVADPRLGGLALG. 570
224 3.000e-95UniRef50_A0A1L9U515 Uncharacterized protein n=2 Tax=Aspergillus TaxID=5052 RepID=A0A1L9U515_9EURO  ali  37  764MLADSTIEEIRRNISDQRTQAVSAYNPGLESLETPGTSHIATIDHTGLAISAITTINLLFGSTVMVPETGIIMNNEMDDFSIPNSSNSFGYIPSEANFIRPGKRPMSSCTPVIVTHPNGTVFFVAGSAGGSRIITATIQNIIHVIDEGLSAAEALAQPRLHDQLIPNHVTFEYDYDNETVSFMEARGHNVTWVGPGQSAAQAIRVTNGTFDAAAEPRQGGFAV.. 991
225 3.000e-95UniRef50_A0A0X3PRT5 Gamma-glutamyltranspeptidase 1 (Fragment) n=2 Tax=Schistocephalus solidus TaxID=70667 RepID=A0A0X3PRT5_SCHSO  ali  41  400....KFADELQSKISDEHTQDLSYYGSVWSTGNQEGTSHISILADNGDAVAVTSTINTKFGSKMVGRRTGVLFNNEMDDFSSPNTSDYFGLAPAQENFIRPGKRPLSSMSPVIFTHPNGSVRLVIGASGGSLILTSIANSALDALYFNMDIKKAIDDPRVHHQLLPNHILPDANFPKDVLEQLKKLGHKVAPV-GFFASVQGIEVKGDQLRANADYRKGGEADG. 625
226 3.000e-95UniRef50_A0A0L0D252 Gamma-glutamyltransferase n=1 Tax=Thecamonas trahens ATCC 50062 TaxID=461836 RepID=A0A0L0D252_THETB  ali  44  349LTSKDYAAWVRTRIVPDATFNASYYGAAFDMEPTPGTTHFSVVDSERNAVALTSTVNLFFGSKVMDPVTGVVLNNEMDDFSVPNVTNAFGVKPSPANYIVPGKRPLSSTTPTIVTAND-QVLAVAGASGGTKITTSTLLTLLKMFAWGMEAGEAVASPRFHDQLYPNVLQVEYGFAQSLVTYLREIGYELDELDGHIAIVQAIYIDKGILYGASDWRKGGAPAG. 576
227 4.000e-95UniRef50_A0A0A1XBJ8 Gamma-glutamyltranspeptidase 1 n=29 Tax=Schizophora TaxID=43738 RepID=A0A0A1XBJ8_ZEUCU  ali  36  550LTNPEYGMSIREKINDNKVHDIFDYGAQFMGEDDAGTSHTVVLAPNGDAVSVTSSVNNYFGASQAGRRTGIVFNSGMNDFSVQGTSNYFGLPSSPSNFIEARKRPMSSMSPMILADRKGNVRLAFGSAGGSKIISGVIEVAARFLWFGQDIKSAIDAPRIHHQLVPNVFQYEFGFSEEILNLLKDKGHKLQPFKDIGSVVCAIAQNETAIYANADYRKRGGIAGF 776
228 4.000e-95UniRef50_UPI000DEAF4E3 gamma-glutamyltransferase n=1 Tax=Roseimicrobium gellanilyticum TaxID=748857 RepID=UPI000DEAF4E3  ali  32  994LIHRDYARELAAKIDLTKATVVPSHGEPPRAQEDKHTTHLSAADAEGNWVALTQTVNTAFGSKVIVPGTGVILNNEMDDFAVPGVPNAFKLVGAEANAIAPGKRPLSSMSPTIVLDKDGEPFLAIGAAGGPTIISQTLQNLVNVLDLKMGVEEALGAPRLHHQWSPDELRVEKAMGDEVMKVLRERGHIIKESSGGIGVSQGVMWDKESFRAAHDPRVPGKADGW 1228
229 6.000e-95UniRef50_A0A0Q4H1K0 Gamma-glutamyltranspeptidase n=29 Tax=Proteobacteria TaxID=1224 RepID=A0A0Q4H1K0_9BURK  ali  32  335LLDKGYAEKIRAVIAADKAGVSQEIKPGVAPHEGSNTTHYSIADRWGNAVSVTYTLNDWFGARVTAGGTGVLLNDEMDDFSKVGVPNIYGLVQGEANAIAPGKRPLSSMSPTIV-SKDGKPVMVLGTPGGSRIITAVALTMTNAIDYGMNVQEAVDAPRFHQQWLPDLTNVEPALSPDTRRLLEQWGHKLG-APQPANHLAAIVVGRNRFYGANDPRRNGLALGY 570
230 7.000e-95UniRef50_A0A1M3T1P3 Uncharacterized protein n=3 Tax=Aspergillus TaxID=5052 RepID=A0A1M3T1P3_9EURO  ali  38  693MLADSTIEEIRKNISDQHTQAVSAYNPGYESLETPGTSHIAAIDHSGLAISAITTINLLFGSKVMIPETGIIMNNEMDDFSIPNSSNSFGYIPSEANFIRPGKRPLSSCTPAIVTHPNGTVFFVAGSAGGSRIITATIQNIIHVVDEGLSAAEALAQPRLHDQLVPNRVTFEYDYDNETVSFMEARGHNVTWVGPGESTAQAIRVPNGTFDAAGEPRQGGFAV.. 920
231 7.000e-95UniRef50_Q9US04 Glutathione hydrolase proenzyme 1 n=4 Tax=Schizosaccharomyces TaxID=4895 RepID=GGT1_SCHPO  ali  39  405LLSLEYADEIRNNISNERTFDFTHYKAEYDFPNDHGTTHLSVIDKDNMAVGLTASINLMFGSQLLEPETGIILNDHMDDFASPGIVNAFGLSPSPYNFIAPGKRPQSSAVPTILVY-NGEVEMVLGGSGGSRIVTAVLDTIIKKYKWGKSLLESVESPRFHHQLMPNIVYIDETVEIEVLRALEKFGHIVDLIPYPFSEIQAVFRTNGTLYGLSDSRKQAVAAAY 630
232 7.000e-95UniRef50_A0A1S8VJV8 Gamma-glutamyltransferase n=5 Tax=Chytridiomycetes TaxID=451435 RepID=A0A1S8VJV8_9FUNG  ali  41  363.IDKATSDHIRQGIFPDRTFEPGHYAAAYDVLNDHGTMHLSILTEQGEAVSLTSTVNLLFGSKVICPITGIILNDEMDDFSIPGVSNAFGLASSPYNYIRPGKRPMSSSVPTIIESADGSVEIVAGASGGSMIITSTMQTILGMTEFGYDPAAAIHMPRMHHQLLPNTLVLEFEFDRHVAREIQTRGHTVVFFNEGETGVQAIKRPDGTLQAASDFRKGGVAAGY 590
233 8.000e-95UniRef50_A0A1V0DA55 Gamma-glutamyltransferase n=4 Tax=Bacteroidetes TaxID=976 RepID=A0A1V0DA55_9BACT  ali  31  348LISRAYMDRRMADFNPYRATSVTMTHGDPFAHESTETTHYSVVDAAGNAVSTTTTLNSFFGSKVVVDGAGFFLNNEMDDFSKPGVPNQFGLVGAEANAIEPGKRMLSSMTPTIVERPDGTPMLVVGAPGGSTIITTVFQVIVNMVVYGMDVQEAVSAPRIHHQWLPDELWYEPGLQRDVVDNLKRRGWRVVDRGAPWGRAHAIAVAEGVLLGGVDPRGNGAAIGY 596
234 8.000e-95UniRef50_A0A2N1PAB8 Gamma-glutamyltransferase n=1 Tax=candidate division Zixibacteria bacterium HGW-Zixibacteria-1 TaxID=2013855 RepID=A0A2N1PAB8_9BA  ali  31  342LLNPNYLESRRALINLQSAANSQEIGSGLPSVESESTTHFCISDKDGNLVSLTYTINASFGSKLVVEGAGFLLNNEMDDFSIPGVPNLYGLIGGRANEIEPGKRMLSSMSPTIVMLKD-RPFLALGAPGGSKIITTVAEAIINFTRFDLNLQKTVECPRFHHQWMPDTLYLEGGFDINVKQDLISRGHVIKEIEP-YSDLQMVHIVNGLMSGASDPRKNGRSAGF 569
235 1.000e-94UniRef50_B7PAQ0 Gamma-glutamyltransferase, putative n=12 Tax=Ixodoidea TaxID=297308 RepID=B7PAQ0_IXOSC  ali  39  303LTSREYAEATRRMIDDRKTFDSAHYTGETGFPVDHGTAHASFLGANGDAIAITSSVNYYFGSSVRT-SSGVVLNNQMDDFSIPGSPNMYGVAPSEANFVVAGKRPMSSMSPLVVVGPTGDVDLVIGGTGGAKITSGVALVSMRNLWQGNSIKEAIDYPRLHHQFLPNRVDVETQFPKVYRRQLEERGHQTFVPKGRFSIIMAITRRNGRVFANSDFRKGGTVDG. 526
236 1.000e-94UniRef50_A0A016RVB0 Uncharacterized protein n=3 Tax=Ancylostoma ceylanicum TaxID=53326 RepID=A0A016RVB0_9BILA  ali  46  426..DPAFATDIARNITTKETHPDEYYGGSLAPPQDHGTTHISVVDSHGNAVSVTSTINMYFGAAVTSPSTGIVWNDEMDDFSLPGRPNFFGLPPSPANFIQPGKRPMSSQCPLIIFDKSDKVVLAVGGAGGSTIITGVAGVAFHSLWLKENVKQAVDAPRLHNQLYPNVTRHEPNFPKEYLAELAARGHVLSKAKNLT-VVMAVERDSGEVYANSDFRKGSAPAGY 663
237 1.000e-94UniRef50_I4Y8Q0 Gamma-glutamyltranspeptidase n=2 Tax=Wallemia TaxID=148959 RepID=I4Y8Q0_WALMC  ali  36  286MLNKSYAQETVDKITD-RTHTWEYYGPDFEGKDTHGTTHLTLVDDDDGVVTLTSTVNGLFGSHVLDEHTGIILNNEMDDFSIPGHPNMFGLWPSPYNLPEPYKRPLSSTAPTIVE-REGNLVAALGGSGGSRIFGSVLQTLLHIL-QGYNPSAAIEAPRVHDQLFPPVVTFESGFSRHLIREMRLRGHNTTVFDFNLGAVQAVTIEDNFKYAASDSRKGGVAAAY 509
238 1.000e-94UniRef50_A0A1Z9BXF4 Gamma-glutamyltransferase (Fragment) n=1 Tax=Alteromonadaceae bacterium TMED101 TaxID=1986649 RepID=A0A1Z9BXF4_9ALTE  ali  29  123LISDDFLGQRRTLIRDAVATPSSEIRPGTEDRESTETTHFSIADQFGNVVSNTYTINFSFGSGIVVPGTGMLLNNEMDDFAKPGSPNGYGLIQGESNAVSAGSRPLSSMTPSLVL-KNGKPWIATGSPGGSRIITAVAQTLLNVMAFDMTLGLATSAPRVHHQWMPDMAMVEPGISIDTVNILEASQHKILRSDRTIGRVNSVQIEDGWLYGYTDPRRPG..... 343
239 1.000e-94UniRef50_A0A0D7Q9J1 Gamma-glutamyltranspeptidase n=6 Tax=Bacteria TaxID=2 RepID=A0A0D7Q9J1_9BRAD  ali  32  343LLDKAYAAKIRAVIDPTKASVSKDIKPGVAPHEGSNTTHYSIADKDGNAVSVTYTLNDWFGAKVTAAKTGVLLNDEMDDFTAKGVPNLYGLVQGEANAIAPGKRPLSSMSPTIV-SKDGKPIMVVGTPGGSRIITAVLLTMINAIDYGMNAQEAVDMPRFHQQWLPDLTNLEYALSPDTRKILEGMGHKLGPPQPANHLAVIIIVGNNRFYGANDPRRNGLAGGY 578
240 1.000e-94UniRef50_A0A1B6IBL7 Uncharacterized protein n=4 Tax=Cicadellinae TaxID=33370 RepID=A0A1B6IBL7_9HEMI  ali  39  91LTDEATILGLREKIHLNSTSEDVSYYGADYAKEDHGTNNIVVVDAEGNAVSVTSTINTLFGSAFVSTSTGILLNDQMDDFSTPGVPNFWGVAPSAANFIEPNKRPQSSMSPSIIVDSNGDVRLVVGAAGGTTITTQTASVAVRNLWLGKNIKEAIDERRFHHQLLPMEISYEYGVLDTMVEAWHKIGHKTRRRPPPLALVTGIARLGLNITANCDWRRFGGVEGF 318
241 1.000e-94UniRef50_E9HFI5 Uncharacterized protein n=20 Tax=Daphnia TaxID=6668 RepID=E9HFI5_DAPPU  ali  39  356LSSKALASETYAKINDSFTSNPEFYGAVSYSPEDHGTSHISVLDGNGMAVAITSTLNHFFGAGFASEQTGIILNAEMDDFSTPNV-HKYEMPPSPVNFIEPGKRPLSSMTPTILVNSTGRVRSVIGAAGGTKITTATAYAIIRNLWFGETIKEAIDSPRIHHQLFPMNFQYEKGFSTDIIKDMVERGHNVTDGEYTGGAVCGVTVEDGFIYANSDWGKSGGVDG. 582
242 2.000e-94UniRef50_A0A1E4EVM1 Gamma-glutamyltransferase n=2 Tax=Bacteria TaxID=2 RepID=A0A1E4EVM1_9BACT  ali  30  229LISKDYAKKIREQIPERKARTSQQVGPAIPGYESDQTTHFSVADEKGWAVSLTYTLNFSYGSGLVAEGTGVLLNDEMDDFSAPGKPNGFGLLGGKANAIEPGKRPLSSMTPTIVQH-EGQFVAALGSPGGSTIITTVLQVILGIVDFDQNAQSAVCETRIHHQWYPDEVKYEQGLSPDTLTMLKSWGHNMVRADS-VGHTMLVRRPNGDFEGGADPRRGGTALGY 455
243 2.000e-94UniRef50_Q48NM5 Gamma-glutamyltranspeptidase n=6 Tax=Gammaproteobacteria TaxID=1236 RepID=Q48NM5_PSE14  ali  31  120LLDVKYAAKLREAIEPQKAGDSNKIKPGVAPHEGSNTTHYSIVDKWGNAVSVTYTLNNWFGAGVMASKTGVILNDEMDDFTVKGVPNMYGLVQGEANAIAPGKTPLSSMSPTIVT-KDGKAVMVVGTPGGSRIITATLLTMLNVIDYGMNIQEAVDAPRFHQQWQPEATNIDTAVSPDTLKILESWGHKF-AGPQPLNHVAAILVGNNRFYGANDPRRNGLSLGY 355
244 2.000e-94UniRef50_B7KCL9 Gamma-glutamyltransferase n=18 Tax=Bacteria TaxID=2 RepID=B7KCL9_CYAP7  ali  32  378LLSRSYADEIRRQIPPDKAVSPEKLY-QNILKEGTNTTHYSVTDKYGNAVAVTYTINSYFGAGVMAENTGFLLNNEMDDFSKPGVPNQFGLVQGKANIIEPGKRPLSSMSPTIVT-QNDKLFLVTGSPGGSTIPTTVLQVITNMIDYQMDVNQAVNSPRFHYQGLPNFVLSEPRFSSDEVEKLEKKGYNIRVFRTW-GAAESINFDTGIFQGANDARKSGEAVGY 604
245 2.000e-94UniRef50_A0A0D3DIA8 Uncharacterized protein n=8 Tax=eudicotyledons TaxID=71240 RepID=A0A0D3DIA8_BRAOL  ali  38  333MLSPKFAQDLKRKINDKKTFDPKYYGGRWNQIKDHGTSHLSIIDHERNCVSMTSTINAFFGALMLSPSTGIVLNNEMDDFSIPLKSDSDKPPPAPANFIRPGKRPLSSMTPTIVL-KDGKVKAAVGASGGMYIIAGTTEVFLNHFLLNMDPLSSVVAPRIYHQLIPNSVKYENWIPKRTRHVLEKKGHVLTPFAGGT-ISQFIVQEDGKLVAVSDPRKGGFPSGY 567
246 2.000e-94UniRef50_UPI000A2A75AE gamma-glutamyltranspeptidase 1-like isoform X1 n=3 Tax=Hexacorallia TaxID=6102 RepID=UPI000A2A75AE  ali  44  377MMNENIAKKLRHMIWDNQTHTQNYYGKRYHVPLKTGTTHLSILSEDGQAVSVTSTVNGYFGAKFMSCGLGFVYNNEMDDFSAPGITNEFGLLPSPVNFIKPGKRPQSSAVPAIILDKDSHVNMVVGGAGGTIITTAVANVIMNYFWFKNNIKNAVSRARVHDQLYPESVFAETWFPPEVVNGLRALGHKVDVSDTSHGVVQAVVKNPIRFTANSDYRKGGLPAGY 622
247 2.000e-94UniRef50_A0A2I2F7K9 Nucleophile aminohydrolase n=14 Tax=Aspergillaceae TaxID=1131492 RepID=A0A2I2F7K9_9EURO  ali  36  639MLSDATIKEIHGKISDTRTQNASAYDPGLESLNTPGTSHIAAVDHTGLAISEITTINLLFGSKLMVPETGIIMNNEMDDFSTPGSSNSFGYIPSPANFIRPGKRPLSSMTPAMVTHPNGTVFFIAGSAGGSRIITATLQNIIHAVDEGMSAAEALAQPRLHDQLIPSEVQFEYSYDNSTVAFMKSLGHNVTWLAPGESSAQAIRRPNGTFDAAGEPRQGGIAV.. 866
248 3.000e-94UniRef50_C3YQF3 Uncharacterized protein n=1 Tax=Branchiostoma floridae TaxID=7739 RepID=C3YQF3_BRAFL  ali  42  403LTSDSYAERIATKINEYKHHTSDYYGARFYNAEDHGTTHVSILAANGDAVAVTSTINHYFGSGVYSPVTGVILNNEMADFSSPGFPDDKHFPPFSKNFISPGKRPLSSTCPTIMIDRDQDVQVVMGGSGGMMIPTAVAQVFANMEWFGMDLGTAVSRARIHHQLEPNVLYMERKLNHELVHHLSHWHYHPSPTEGSYAAVQVIRREGKEIQACSDPRKGGKPAGY 637
249 3.000e-94UniRef50_A0A1F6GMW0 Gamma-glutamyltransferase n=1 Tax=Candidatus Lambdaproteobacteria bacterium RIFOXYD2_FULL_56_26 TaxID=1817773 RepID=A0A1F6GMW0_9P  ali  29  345LISKRLADQEARGINLKSPTSAEKIAPRIPGHYGENTTHFSIVDGSGMAVSNTYTLNFSFGSGIVVEGTGVLLNNEMDDFSKPGSPNAYGLIGGVANSIAPKKRMLSSMSPTIV-RKDQKPILVTGSPGGSKIITTVVEVIQNVLDHKMGLEQAVTAPRIHHQWLPDQLEVEPSFDPKTAQTLRDKGYQV-EVRGYWGRADSIAFEGGQWVGVSDPRGKGLALG. 568
250 3.000e-94UniRef50_A0A2S9XGX0 Gamma-glutamyltranspeptidase n=5 Tax=Myxococcales TaxID=29 RepID=A0A2S9XGX0_9DELT  ali  32  385LLDVSYIDERVADINPKKATPSDQVGAGVEIKESEQTTHFSVVDGEGLAVANTYTLNGGFGSKVLVPGTGVILNNEMDDFTAKGAPNMFGLIQGPQNAIEPGKRMLSSMTPTIVV-KDGELRAVLGSPGGPTITTTVAQILIQLIDYDRSLEDAVRDHRIHHQWKPDNIWHEDGIEPALKKALEKKGHELKTRNWRIGHANCIEVDPGELEAVADSRDGGSAAAY 612
251 3.000e-94UniRef50_S8BY71 Uncharacterized protein n=1 Tax=Dactylellina haptotyla (strain CBS 200.50) TaxID=1284197 RepID=S8BY71_DACHA  ali  39  400..SKQFAAMVRRNISDTRTYGWKHYNPSYEFKESHGTSHLSVLDAEGMAVALTTTVNLYFGARICDPETGVILNDEMDDFSIPGTGNAFKLQPSIYNYIKPYKRPLSSTAPTITVY-NGYPSLIVGASGGSRIVTSVFLAFIKIFKWNYSLLDTVHSPRVHHQLIPEVAYVEHGVRNDVIQGLKERGHEVEELPTIGSVMQAVLRPDGEIHAVSDWRKGGV.... 619
252 4.000e-94UniRef50_A0A1J5NWC3 Gamma-glutamyltranspeptidase n=2 Tax=root TaxID=1 RepID=A0A1J5NWC3_9ZZZZ  ali  32  93LINPIYNESRMKSFNWDAATPSTAIQPGTAGYESDQTTHYSIVDAEGNAVSITTTLNDSFGSHIFVKGAGFLLNNEMDDFSSPGAPNMFGLVGGKANSIQPGKRMLSSMTPTIIE-KDGKLFMVVGTPGGATIITSVFQTILNVIEFNMDMQQAVNVKRFHHQWLPDVVEIERGISADEKNRLEKKGYKMVDHGQ-IGRVDAILITDGYYQGGADPRGDDTKSGW 319
253 4.000e-94UniRef50_P36267 Glutathione hydrolase proenzyme n=2069 Tax=cellular organisms TaxID=131567 RepID=GGT_PSEUA  ali  31  340LLDKDYAAKIRAAINPQKAGISQEIKPGVPPHEGSNTTHYSIVDKDGNAVSVTYTLNDWFGAKVMANGTGVLLNDEMDDFSKVGVPNMYGLIQGEANAIGPGRRPLSSMSPTIVT-KDGKTVMVVGTPGGSRIITATLLTMLNMIDYGMNLQEAVDAPRFHQQWMPESTNIEAALSPDTQKILESWGQKF-AGPQPANHIAAILIGKNRFYGANDPRRNGLALGY 575
254 4.000e-94UniRef50_A0A1E3QZI2 Uncharacterized protein n=1 Tax=Babjeviella inositovora NRRL Y-12698 TaxID=984486 RepID=A0A1E3QZI2_9ASCO  ali  37  399...PEWAREVRHNISDSRTLPWQEYNSAYRVAENHGTASFSIVDSYNNSVAMTSTVNLLFGSMLHDPVTGVILNNEMDDFSIPDTTNAFGLKPVIYNFISPRRRPLSSMSPTIVTNSDGTPDLVIGAAGGSRITTAILQAIVRTYSYNLPLLETIAFPRLHHQLFPEEVYVEEPVSQEFIAGLEARGHKVSVIDHLTA-MNGIRKAEDGWIGVSDWRKRGCASG. 619
255 4.000e-94UniRef50_A0A1U8MTW0 gamma-glutamyltranspeptidase 1-like n=24 Tax=Pentapetalae TaxID=1437201 RepID=A0A1U8MTW0_GOSHI  ali  38  351MLSPKFAQELKKTIHDNMTFGPKYYGGRWNQIDDHGTSHVSIVDTNRNAVAITNTVNAFFGSKILSPSTGIVLNNEMDDFSMPNNSSKDNPPPAPSNFVRPGKRPLSSMTPTIIL-KDEKLKAVVGASGGANIIAGTTQVLLNHFALGMDPLSSVMAPRVYHQLIPNVVKYENSVPETIRKDLQKKGHILQ-GPASLSVSQFIVKGNGELVAVSDPRKGGFPAGF 589
256 4.000e-94UniRef50_A0A0K2TDZ4 Gammaglutamyltranspeptidase 1like [Megachile rotundata] n=3 Tax=Lepeophtheirus salmonis TaxID=72036 RepID=A0A0K2TDZ4_LEPSM  ali  39  445ITSPEYGQEAFKLINDSFTNNASFYGGDFVSREDHGTSQLSIIGPNGDAISVTSTINTHFGSKVVGQETGIIYNNEMDDFSSPNITNYFGLKPSPNNFIRPKKRPVSSMSPSIFVDHNGSVVLSIGAAGGSRITTATAYTSLLNLWLDKSIDISIDMRRIHHQLLPMELHYEKGFDGEILDELKSRRHVVVEDNPDYSVVQAVARTSDKYHAFSDTRKDGEVYG. 670
257 5.000e-94UniRef50_UPI000B784920 LOW QUALITY PROTEIN: gamma-glutamyltransferase light chain 1-like n=1 Tax=Aedes aegypti TaxID=7159 RepID=UPI000B784920  ali  41  91LSSPSYAEYVRSQIHDNETFDYNHYGAEFANPEDHGTAHICVLAANGDAVSATSTINYLLGAKIRSRSTGIILNDEMDDFSSPGTVNTYGLPPSPANFIVPGKRPLSSMTPTIVTNKAEGVQMVVGGAGGSRITTATVTLLLRYLFFGEELETVMNARRLHHQLAPMWVDYEAGFDEAILEGLRKRGHDVREKTPFAAATAIAKNAHHEVSAAYDSRRGGSV... 316
258 5.000e-94UniRef50_D5G4K0 Uncharacterized protein n=4 Tax=Pezizales TaxID=5185 RepID=D5G4K0_TUBMM  ali  37  427LQSKSYAEAVRANISADTTYSWEHYNPAYEPVDPKGTSHLSVLDNYGNAVALTTTVNLYWGAKVHDPQTGIVLNSEMDDFSIPGRSNAYRLEPSIYNYIIPYKRPLSSTTPTIIVEEDGAPGLVIGGSGGSRIVTGVFQAIVKNYLWGYNLLDTIKSPRLHHQLIPEVVSAERGTEKWILEGLEERGHVIGLRGSGGSVIQVVKMDSGRVEAVADWRKGGRAAGY 657
259 5.000e-94UniRef50_A0A1W0WJQ0 Gamma-glutamyltranspeptidase 1 n=1 Tax=Hypsibius dujardini TaxID=232323 RepID=A0A1W0WJQ0_HYPDU  ali  41  516LLSPWFAKLTRALINDQRTSDTKTYGVNIVPAIGKGTSHISIIDKMGNAVSITTTINTHFGSKRVSRKTGIILNNEMDDFTTPNSPNYYGLPPSIANLIAPGKRPQSSCAPIIVVDHNGDVRVVMGASGGSRIISAVANALIRVLYFGQDVKEAIDAPRIHHQLLPMELSYEPNFLRKHLKGLEDKGHHLVFSNT-IAVIQGLDRENMRIEANCDYRKRGAPAG. 742
260 5.000e-94UniRef50_A0A2J8DKR1 Uncharacterized protein n=1 Tax=Verticillium dahliae TaxID=27337 RepID=A0A2J8DKR1_VERDA  ali  39  326LLDNATAAHTRARILDNETQPVGRYAPALFVPDTHGTSHVVTADSAGRAVSLTSTVNLLFGALLVDPRTGVVLNNEMNDFSIPGVRNAFGFEPSPANFIRPGKRSLSSITPVIVEAPDGALRAVVGAAGGSRIVSATAQVLWHVLEHGMTMTEAVAEPRLHDQLMPNEVWLEYTFNNETAASLAEKGHRVKWVREGLSAVQGITVLGGKFEAASEPR........ 544
261 6.000e-94UniRef50_A0A100IT64 Gamma-glutamyltranspeptidase n=4 Tax=Aspergillus TaxID=5052 RepID=A0A100IT64_ASPNG  ali  38  397MLADSTIEEIRKNISDQHTQAVSAYNPGYESLETPGTSHIATIDHSGLAISAITTINLLFGSKVMVPETGIIMNNEMDDFSIPNSSNSFGYIPSEANFIRPGKRPLSSCTPAIVTHPNGTVFFVAGSAGGSRIITATIQNIIHVVDEGLSAAEALAQPRLHDQLVPNRVTFEYDYDNETVSFMEARGHNVTWVGPGESTAQAIRVPNGTFDAAGEPR........ 615
262 7.000e-94UniRef50_A0A2S2NKJ0 Gamma-glutamyltranspeptidase 1 n=1 Tax=Schizaphis graminum TaxID=13262 RepID=A0A2S2NKJ0_SCHGA  ali  37  138.TSDMYMSSVQNNISDQHTTDPKFYGAEFSWSEDHGTENIAIMDSFGNAVAVTSTINTPFGSGFVSESTGIIFNNEMNDFSTPGFSNFYGYPPSLSNLIQPHKRPMSSMCPTIITDSNGDVVLVIGGAGGSKIPLATAYVSALILWYNKTLKEAIEEPRLYHQLIPMQVDYEYGVLKPVVEKLKHVGHKMKRIMKDKSAVIGIFKTPKGITAMSDFRQMGNVSGY 363
263 8.000e-94UniRef50_A0A2E3RKZ2 Gamma-glutamyltransferase n=11 Tax=Bacteria TaxID=2 RepID=A0A2E3RKZ2_9BACT  ali  29  333LISDDYLKERWSDVDLFKARESSDVEGKLNYYESEETTHYSIVDKWGNAVSVTTTVNGWFGNGIVVDDSGFLLNNEMDDFSSPGYPNKYGLVGNKLNSIEPNKRMLSSMTPTIVENPNGDLFLVVGSPGGSTIITTVAQVIMNVIDQNMSIKNAVEQSRFHHQWLPDVVYFEPNFSKETXEELIDMGHNISKRNSIGNCIQSIKVNSYIFSGAAXSRRGASALGY 568
264 8.000e-94UniRef50_A0A066VQV3 Gamma-glutamyltranspeptidase n=1 Tax=Tilletiaria anomala UBC 951 TaxID=1037660 RepID=A0A066VQV3_9BASI  ali  40  291..SENESHRLFKKIHDEHTHEIDYYEPLFDVREDHGTMSLSVADADGVACSITSTVNLPFGSQVMDWETGIILNNEMDDSSTPGEPNAFGLWPSPYNYPAPFKRPLSSMAPTIIEKADGSFLLTLGGSGGSRIYGSVLQTLLN-LDWGLDLSDAIEHPRLHHQLLPHEISVETGYRQDVLNGLMAKGHNCTLIDINNAVAQAVMHVGAVFHAASDSRKQGVAAAF 518
265 9.000e-94UniRef50_A0A094G773 Uncharacterized protein n=1 Tax=Pseudogymnoascus sp. VKM F-4517 (FW-2822) TaxID=1420911 RepID=A0A094G773_9PEZI  ali  39  392MLDTANAHTTRHRISDDHTLDPIDYNPKLSTPGSHGTSHIVTTDASGMSITLTTTINLSFGSRLCVPETGIIMNNEMNDFSIPGVSNEFGFVPSPNNFIRPGKRPLSSITPIIVEHADGSLHVITGAAGGSRIITATIQALWHVLDHGMTMPEALAQPRLHDQLLPAHVLFEEGYDNATTAYMRAKGHNITWTPEFLSKVQGIRRENGTFEAAAEPRQGGFAV.. 619
266 9.000e-94UniRef50_A0A271J6Q8 Gamma-glutamyltransferase n=1 Tax=Rubrivirga marina TaxID=1196024 RepID=A0A271J6Q8_9BACT  ali  31  303LIDEDYTRERMASFDPVKADSSTGVGAGL--HESMQTTHYSVVDADGMAVSVTTTLNGGFGSLVVVEGAGFFLNNEMDDFSAPGEPNMFGLVQGEANAIAPGKRMLSSMTPTIVEDPEGRLMLVVGSPGGPRIITAVYQTILNVIDHGMDVQEAVAAPRVHHQWLPDELDYENGLALDVVVALQERGWALDESGGYWARVDAIEVVGRVLYGGADPRGEDAAAGY 548
267 9.000e-94UniRef50_A0A0B2URB6 Gamma-glutamyltranspeptidase 1 n=1 Tax=Toxocara canis TaxID=6265 RepID=A0A0B2URB6_TOXCA  ali  41  401ITTKEYAETIRALIT-ERAHPDSYYGGSFEGPEDHGTAHISVLDAEGNAVSVTSTINLHLGAAVMSESTGILWNDDMDDFSTPGHPNYFGFPPSPSNFIRPGKRPMSSMSPIVVFNNDNETRLSVGGAGGSTIISGVAGVTLHALWLDQNVKRSIDMPRVHNQLQPNYTQYESRFPQEYVEALRKLGHTMVSTANLT-VVTAIEKNDGVIYANSDFRKG...... 620
268 1.000e-93UniRef50_B0XE47 Gamma-glutamyltranspeptidase precursor n=57 Tax=Culicoidea TaxID=41827 RepID=B0XE47_CULQU  ali  39  354LTSKDYADYIRAKIDDNRTTSYEFYGADFANPEDLGTAHVSALAPNGDAVAATGTINDYFGAQLRSPSTGIIPNGEMDDFSTPGVINIYGVPASPANFIAPKKRPLSSMSPAIVIDGAGDVRLIAGGAGGTRITTATLQLILRHAFFGEDLRAAMGGPRVHHQLAPMWIEYEAAVDPTIVEQLKARGHAVKKVRR-VATETAVAREDGRVSAAFDPRRPGSA... 576
269 1.000e-93UniRef50_A0A1Q7JDB9 Gamma-glutamyltransferase n=14 Tax=Bacteria TaxID=2 RepID=A0A1Q7JDB9_9BACT  ali  34  374LLSKSYAAELRAQILPDRATPTPPFQASEGGGRDEGTTHYSIVDADGNAASITTTLNGGFGSAVTVQGAGFLLNNEMDDFTAPGQPNQYGLIQGEANAIAPKKRMLSAMTPSIVLDRNGNLFMVVGTPGGPTIINSVYEVIVNVIDHKMTLADAVAAPRINQQALPDVIFLERGLTPATLDSLKAMGYKLQE-RGRQGDVQAIQQTAAGWVGVADPRHGGGASGY 601
270 1.000e-93UniRef50_UPI000D77D06C gamma-glutamyltranspeptidase n=3 Tax=Exobasidiomycetes TaxID=452283 RepID=UPI000D77D06C  ali  40  445......AARIKTLITNVTHEELSYYDPLFDIGEDHGTQHLSTVDSAGQAVALTSTVNIPFGSWVMDPATGVILNDEMDDTSTPNVPNAFGLRPSPFNYPEPGKRPLSSTAPTIVEHSDGSFFLALGGSGGSRIFGSVAQVLLN-LDWGYDLSQAIERPRLHHQLLPAVVSAESTISDAILESLKSKGHNVTVFDINMGMVQAVMREPGRVFAASDSRKDGRASAY 669
271 2.000e-93UniRef50_M5BKJ1 Gamma-glutamyltranspeptidase n=1 Tax=Thanatephorus cucumeris (strain AG1-IB / isolate 7/3/14) TaxID=1108050 RepID=M5BKJ1_THACB  ali  39  143.LQKSTSKELADRISLSTTFPSYYYNPENYTAQESGTSHLVTADASGLVVSLTSTVNYYFGSQLMTED-GIILNDEMDDFSTPGTSNGFGYIATPANYIAPYKRPLSSISPTIVEDNEGNFHFATGAAGGSRIITATLQSLWHVLDQGMDVQSAINAPRLHDQIVPLTTTFEYTYDNATTAYMAALGHNVTWVAPGQSVVQGVTRDNGVFAAASDGRK....... 360
272 3.000e-93UniRef50_A0A067R874 Gamma-glutamyltranspeptidase 1 n=7 Tax=Neoptera TaxID=33340 RepID=A0A067R874_ZOONE  ali  36  274..SKDYGNKIRESIDDNRTTDPGYYGAVNYSVDDHGTAHVSIIAPNGDAASITSTVNIYFGAGVTSHRTGIILNSGMNDFSIPKAKSYFGIPFSSANSITPGKHAVSSMCPSVIVNGNGDVRLVIGGSGGTKITTAVAFVIMRILWFGEGIKQAVDASRIHHQIFPMEVAYDYGVLDQIVKGLEKLGHKTDRIRDRGSIICALFKLGNMITANADFRKGGDVFG. 496
273 3.000e-93UniRef50_A0A285Z017 Gamma-glutamyltransferase 1 Threonine peptidase. MEROPS family T03 n=2 Tax=Bacteria TaxID=2 RepID=A0A285Z017_9BACT  ali  34  358MLSADYVAQRRSTIRLDRATPSADVAPGPAPAEGTNTTHYSIVDGLGNAVAVTTTLNSLYGSGVTVTGAGFLLNNEMDDFSKPGVANQFGLVQGTANAIAPRKRMLSAMAPTIVLDARGRLRAVTGTPGGSTIITSIAQMVSNIVDFDMDVATAELAPRLHHQHLPDTLRFERGLEDSTVARLRAMGHVVAEREGYQGDVQIIVLPNGYVTGASDPRRGGAAVG. 586
274 3.000e-93UniRef50_A0A1R3V503 Gamma-glutamyltranspeptidase n=48 Tax=Bacteria TaxID=2 RepID=A0A1R3V503_9RHIZ  ali  32  341LLDKNYAKEIREKIDPFRAGVSQELMPKGFG-ESQETTHYSIVDNDGNAVAVTYTLNGSFGAGVVADGTGILLNNEMDDFTKPGVPNLYGLVQGEANAIAPRKTPLSSMSPTIV-AKDGKPFMVIGSPGGSRIITITLEAIVNVVDHGMNIQEAIDAPRIHHQWLPDTVYVEPGLSRDTEKLLAGMGYHLDVADATWGQAAGILVGGKRYNGAIDSRASGEAIGY 577
275 3.000e-93UniRef50_E4XKP5 Uncharacterized protein n=2 Tax=Oikopleura dioica TaxID=34765 RepID=E4XKP5_OIKDI  ali  44  364.....FAKQFADKIDDE-THPLEFYEPEFEIVEDSGTSHMSIVDANGMAVAITSTINTILGSKMIGKRTGIIFNNEMDDFSTPGVSNNYGLPPSPSNFIKPGAQPLSSMCPIIVVDKVNTMIHATRASGGSQITTATANVAIRTLLYGDGMNEAIQRARIHHQLLPNEIRKEDRFDLNMIKELEKKGHVYYNGTGRGAVVQGILRRNGLLEAVSDVRKGGKPDGY 582
276 3.000e-93UniRef50_A0A1Q3ERY9 Gamma-glutamyltranspeptidase 1 n=3 Tax=Lentinula edodes TaxID=5353 RepID=A0A1Q3ERY9_LENED  ali  39  429...KQFADEIRDRLDDHRTQPAEYYRPLYTLKPDHGTSHVSVVDKEGMMVSVTSSVNWFWGAQVLDPVSGIVLNNHMNDFSTFNETNIFGEFPARWNLPQPGKRPLSSMCPTIVEKEDGSPYIAIGASGGPTIFPAVFQTLINIIDYGLDPSEAIEFGRLHNQLKPEGTFADETYRADILEALSRQRHRIQVLDNGSSCVQAVMRDSGLLLGASDSRKNGIAAGY 655
277 3.000e-93UniRef50_A0A061H2R5 Uncharacterized protein n=1 Tax=Anthracocystis flocculosa PF-1 TaxID=1277687 RepID=A0A061H2R5_9BASI  ali  42  411...PAEARRVRANITDDATHPLAYYGPKFDIVDDHGTMHLSVVDEHGGAVALTSTVNLIFGSRVLDERTGIILNDEMDDTSTPGVPNAFGLAPSPYNYPEAGKRPLSSTCPTIVEHDDGSVDLVIGGSGGSRIFGSVAQTMLQR-EWGRDLSDAIEQPRVHHQLLPTMVTAESGYAEKTLNALRGRGHEVLEFDINLAVVQAVEASGRGRTAASDSRKGGIAVAY 637
278 3.000e-93UniRef50_A0A168PJK8 Uncharacterized protein n=4 Tax=Mucorales TaxID=4827 RepID=A0A168PJK8_ABSGL  ali  36  450IISKEWASRVRAKISDTDTHPPAYYGPKYEGVENHGTMHMSVVDENDGVVAMTTTLNHLFGSQVMDPVSGVIFNNGMDDFSIPGTPNFFGYKPSMQNYVAPGKRSQSSITPVIVES-DGRFFMALGGSGGSQIPSAVVSVLTNVLDYNMELYEAVATPRIHHQLMPNTVGIETTVPINVTNALKERRHELYYLDRNISGVQTVRRDDGTVHAVSEPRKYALASAY 676
279 4.000e-93UniRef50_A0A239ZC38 Gamma-glutamyltranspeptidase n=15 Tax=Bacteria TaxID=2 RepID=A0A239ZC38_CLOCO  ali  30  364LTSKDYAKELYEKIDKDKATQKVEAG-NPNKYESGSTTHYSIMDKEGNMVAVTKTINHFFGSCVAVPGTGILLNDEMDDF---------DFKPGLSNSIEPGKKPLSSMTPTLIL-KDGKPFMTIGSPGATRIIPTVAQVISNIVDHGMDIQEAINTPRMYD--KDGKLSLEGGIDEKVIEGLKNKGHEVDEYDLFFGGVQGVMMESGELHGGADPRRDGQAVGF 579
280 4.000e-93UniRef50_A0A1G1BIY0 Gamma-glutamyltransferase n=2 Tax=Ignavibacteria TaxID=795747 RepID=A0A1G1BIY0_9BACT  ali  31  335LISKEYGEVIKNKIG-ETARPATEFHPAPRFKEKEETTHFSVVDKFGNAVSTTYTLNGSYGNKIVVDGLGFLLNNEMDDFSKPGAPNMFGLMGSEANSIQPMKRMLSSMTPTIVL-KEGKPLLVVGSPGGSTIITSVLQVIINVLDFKMNVYEAINAPHIHHQLFPDQIDYEPGLSEDVKQNLISLGQKIG-IERYLGRVEAIYIDKNCFFGTSDPRGFGKAVGF 562
281 5.000e-93UniRef50_A0A0P5VP67 Gamma-glutamyltranspeptidase 1 n=4 Tax=Daphnia magna TaxID=35525 RepID=A0A0P5VP67_9CRUS  ali  44  257LSSEVMAAETWAKISDLFTFDPGSYGAVTYSPDDHGTSHISVLDGNGMAVSLTSTVNLKFGAGWISEQTGILMNDQMDDFSSPNVINYFGLPPSPANFIKPGKRPMSSMTPTVIVNSTGRVRMVTGAAGGTKITTATAYSIIRNLWFGETIKEAIDSKRMHHQLFPMSLEYEKGFPSRIVNDMMTRGHRTSKLHGDGAVVCGIAVEDGYIYGNSDWRKSGDVDG. 505
282 5.000e-93UniRef50_T0KT76 Uncharacterized protein n=1 Tax=Colletotrichum gloeosporioides (strain Cg-14) TaxID=1237896 RepID=T0KT76_COLGC  ali  36  613MISEQTGAEVRSKISDFRTQNVSAYNPGFESLETPGTSHVATADASGLAISLTTTVNLLFGSQLMVPETGVIMNNEMNDFSIPGSSNAFGYVPSPANYIRPGKRPLSSIAPVIVEKPDGKLYFVIGAAGGSRIITATIQNLHNVLDRNLTAPQALAEPRLHDQLSPDRINVEYSYDNSTISYLQSLSHNVTWVAPGSSSAQGVRLENGTFEAAGEPRQGGYAV.. 840
283 5.000e-93UniRef50_T2JQY4 Gamma-glutamyltranspeptidase n=2 Tax=Bacteria TaxID=2 RepID=T2JQY4_CROWT  ali  29  2...........KKIDLEKVIPSQNIKPVFQSNESTETTHYSIMDRYGNAVANTYTLNFSYGSGLTVPGTGILLNNQMDDFTAKGVSNAYQLIGGQNNSIAPEKRMLSSMTPTIVM-KEGKPWLVTGSPGGSRIITTTLQIIMNVIDHEMNIAEATNATRIHHQWFPDQIRLERGLNGDTIDLLETKGHTIK-SSFAMGSTQSVMYKKGQFYGASDPRKPGATLGY 217
284 5.000e-93UniRef50_A0A1C7LZE6 Gamma-glutamyltranspeptidase 1 n=4 Tax=Agaricomycetes TaxID=155619 RepID=A0A1C7LZE6_GRIFR  ali  38  334...KAFSDLIFPNMTDDRTHPPEYYNPVYDVPIDHGTSHSSIVDRNGMAVALTTTVNLVFGSLVMDPVTGIILNDEMDDFSTPGTPNAFGLYPSPHNYPEPGKRPLSSTTPTIIEHEDGSFYLAIGGSGGSRIFGSVFQVILNM-DWGMDVSAAIEYGRLHDQLFPQMMDADDVYAPAVLNALREKGHNITVSDRVAAVVQVVAKVNDTIYASSDSRKNGIAAGY 560
285 5.000e-93UniRef50_A0A1S3Z0W1 putative inactive gamma-glutamyltranspeptidase 4 n=5 Tax=Magnoliophyta TaxID=3398 RepID=A0A1S3Z0W1_TOBAC  ali  39  52MLSTEFAKQLKKTIYDNMTFNPNHYGGKWNQIHDHGTSHMSIVDSDRNAVSMTSTVNAYFGAKYLSPSTGIVLNNEMDDFSIPEKRSENVPPPAPANFIRPGKRPLSSMTPTIVL-KGEQLRAVIGASGGAMIIAGTTEVFLNHFARGMDPFSSVMAPRSYHQLIPNVLQYENWVPAKTRTSLQKKGHILQSIAGGT-ICQFVVQELGELVAISDPRKGGFPSGF 288
286 5.000e-93UniRef50_W4XEQ0 Uncharacterized protein n=3 Tax=Strongylocentrotus purpuratus TaxID=7668 RepID=W4XEQ0_STRPU  ali  39  263MTSDDVASLIRQTINDVRVTNVTQYDTPFANTFDEGTSHLSVIAPNGGAVAMTSTVNNGFGSKFMSPTTGVVLNNQMDSFSTPGLRNSDGIAPSSPNFIKPGKRPMSSMSPTILLAENGDVRLALGASGSSRMITSISLVSLRTQRFDEDLRDVINQRRLHHQLSPNYIQYEEGFSEEILSRLENKGHE-TCLQTRYAVVQAILRREGSLYAFSDPRKGGIAAGF 489
287 6.000e-93UniRef50_K3Y657 Uncharacterized protein n=7 Tax=Mesangiospermae TaxID=1437183 RepID=K3Y657_SETIT  ali  40  344MMSQTFAAELKKTIYDNMTFDPKHYGGRWDILQDHGTSHLSIIDSERNAVSMTSTVNSYFGSLILSPSTGILLNNEMDDFSMPANTTANSPPPAPANFVSPLKRPLSSMTPTIVL-KDGKLKAAVGASGGAMIPAGTIEVFLNHFVRNMDPLASVMAPRVYHQLIPNVVQYENWLDAATRADLQKIGHVLKPLAGGIGVVHNVERH-GDLTAVSDPRKGGVPAGY 578
288 6.000e-93UniRef50_A0A1D1VM15 Uncharacterized protein n=2 Tax=Parachela TaxID=210572 RepID=A0A1D1VM15_RAMVA  ali  39  469LLSPWFGHLTRMLINENQTSNTKAYGVEVANLQKTGTSHISVIDKDGNAASITTTINTHFGSRRVSQSTGIILNNEMDDFTTPNQPNYYGLPPSYANRIEPGKRPQSSCAPVIVTDGNGEARIVMGASGGSRIISATANALLRVMYLGQDVKEAIDAPRLHHQLLPIQLEYEYGFVRKHLEGLQQKGHNVQFSST-FAVVQGLVRDDGMIEANCDYRKKGAPAG. 695
289 6.000e-93UniRef50_A0A2W5CFC1 Gamma-glutamyltransferase (Fragment) n=1 Tax=Haemophilus parainfluenzae TaxID=729 RepID=A0A2W5CFC1_HAEPA  ali  30  247LTAKAYAATIAQKIG-EKSTPVSAIAPGVPQPESNETTHISIVDKEGNAVAMTYTLNDNFGNGFIVPGTGILMNNEMDDFSKPGEANLYGLIGAEANEVKGGKRPLSSMSPTFVF-KDKDLYLVTGTPGGARILTTVLQIIVDDLLFHLNPAEAIAAPRFHDQWLPDEIRVEKGLSPDTIHLLQEKGHTVRVKAVM-GKVGTIRVTHDQLEGAADPRNDGAVVGY 476
290 7.000e-93UniRef50_A0A2N1WZG8 Gamma-glutamyltranspeptidase (Fragment) n=2 Tax=unclassified Gammaproteobacteria (miscellaneous) TaxID=33811 RepID=A0A2N1WZG8_9GA  ali  29  60LTSPEYLKHRAAEINPTAISETEKVRPG---LESTQTTHFSIVDADGNAVSNTYTLNLDYGSGVVVKGAGFLLNDEMDDFSKPGVANAFGVVGSDANAIEPGKRMLSSMSPSIVT-RDGKVSLVLGTPGGSRIFTSIFQVLNNVYDFDMPLEKAVAAQRVHHQLLPDTIYYDAHAPGKVADELKAMGYTLEDQGWLMGDIQAIRVDGTRLQTGSDPRGRGV.... 280
291 7.000e-93UniRef50_M9NFP5 Uncharacterized protein, isoform C n=86 Tax=Brachycera TaxID=7203 RepID=M9NFP5_DROME  ali  36  352LIDPAFAAEIRKLILDDRTFDMSYYGANFANEEDHGTAHISVLAPNGDAISVTSTINSHLGAKVRSRQTGFILNDEMDDFSTPGKINAYGIPASPANFIKPGKRPMSSTCPSIVLDTHGNVKLIVGGAGGSKITTSVAQTILRYFVLHEPIEKAVNSGRLHHQLAPMHIDMEPNVPRHTVAYLSAIGHDIREDDKAYSAQTAIGILGTEPHPVCDRRRVGSAV.. 577
292 8.000e-93UniRef50_H2YDV0 Uncharacterized protein n=3 Tax=Ciona savignyi TaxID=51511 RepID=H2YDV0_CIOSA  ali  49  312MTADWYADDLRLKINDDHTWPVDYYGPDWSVPDDSGTAHLSLVASNGDAVALTSTINLFFGSKVRGRSTGILFNNQMDDFSAPNISSAFDVPPSPANFIQPGNRPFSSMTPT-VISKHGKPVMVVGGSGGTIITTATALVVMNSLWFGFDVGTSVEMKRVHDQLMPNVTDCEQGLDEAIIAGLRSKGHAINKMSFSYTAVQALLLPDGRISAACDSRKGGYPDGY 562
293 8.000e-93UniRef50_A0A2B4S3C6 Gamma-glutamyltranspeptidase 1 n=1 Tax=Stylophora pistillata TaxID=50429 RepID=A0A2B4S3C6_STYPI  ali  42  363MLDPKRGDDLRDRIRDSKTYKNVSYYADSFSNADYGTTHVAVLALNGDAVSVTTTINMRFGAKYRSTRTGIIYNNQMADFDIPGHEIVDDISPSPFNFPEPGKRPFSSMCPTIFTDNDGKVRLVIGASGGKMITTAVSLVLMNKLWFGYDLSEAVNKPRLHTQLVPDQVFYEYRIQDDVIEGLRERGHNIT-GSESFAVVQAIYNEPGRIFAKSDPRKHGAPAG. 593
294 9.000e-93UniRef50_A0A1Y2EFN3 Gamma-glutamyltransferase n=17 Tax=leotiomyceta TaxID=716546 RepID=A0A1Y2EFN3_9PEZI  ali  38  337MLSSATAIEIRSKISDYTTQNVSYYNPGLESIDTPGTSYIGTADKSGLAISLTTTINTIFGSRLMVPETGIIMNNEMNDFSIPGSSNAFGYIPSPANYVRPGKRPLSSISPTIAETADGKLYLVVGSAGGSRIITATIQNIHHVLDQNMTTPQALAQPRLHDQLSPNLVTFEYPYDNSTVAYMKSLGHNVSWVGPGQSTAQALRLSNGTFEAAGEPRQGGLAV.. 564
295 1.000e-92UniRef50_A0A2N5UUC2 Uncharacterized protein n=2 Tax=Puccinia coronata var. avenae f. sp. avenae TaxID=200324 RepID=A0A2N5UUC2_9BASI  ali  39  269IISKEYGQSISKRIDDNHTHDYSYYQPKYDLVQDHGTTHMSVVDRFGSAVSLTSTVNLYFGSTVMDPDNGIILNDQNDDFSVPGKANAFQLFSSPLNYPVTGKRPLSSMAPIIVAHPQAEFFCALGASGGSRIYGAVAGTFLKLLW-GYDISHAIEDPRIHHQLLPNELSVEKGYEEIYLAGLRARGHNITIIPDAKSVVNGIYKRDDTLYASSDSRKNGVPAAY 523
296 1.000e-92UniRef50_A0A1Y0MKL8 Gamma-glutamyltransferase n=16 Tax=Bacteria TaxID=2 RepID=A0A1Y0MKL8_9FLAO  ali  31  341LTSEAYLSGRMSDFSFDAATPSSAINGEVEVVESMETTHYSIVDAFGNAIAVTTTLNGAYGSKLYVPELGFFLNNEMDDFSKPGVPNMFGLIGAEANSIAPQKRMLSSMTPTLIE-KNGKFWMTVGTPGGSTIITSVLQTVLNVYEFDMSMQEAVNAPRFHHQWLPDVILFEPGFEQAILDSLKTKGYLPTNNSPIIGKVDGIMVPDGRLEGGADRRGDDTAVGY 569
297 1.000e-92UniRef50_A0A1G4AYY5 Gamma-glutamyltranspeptidase n=2 Tax=Ascomycota TaxID=4890 RepID=A0A1G4AYY5_9PEZI  ali  34  337MISPETGAKIRSKISDSRTFDVSYYNPGTETVENHGTSQIAVADASGMAISLTTTVNLLFGSQLMVPETGVIMNNQMNDFSIPGASNHFGFIPSRANYIRSGKRPLSSIAPVIVEKPDGKLYFVIGSAGGSRIITAVIQNLHNVLDRNLTVPQSLAEPRFHDQLSPNTASFEYAYDNATSSYLASLGTTVTWEAPGGSSAQGVRLPNGTFEAGSEPRQGGFAV.. 564
298 1.000e-92UniRef50_A0A137PGU3 Gamma-glutamyltranspeptidase n=6 Tax=Conidiobolus coronatus (strain ATCC 28846 / CBS 209.66 / NRRL 28638) TaxID=796925 RepID=A0A1  ali  37  396ILTKDYIKKLATEVDLTSTHNFGYYHPQYDTKELPGTTHISVIDNTGLVVSLTSTVNLEFGSHLMTPVSGIILNDEMDDFSLPNVTNGFNLPPSPLNWVQPHKRPLSSTVPTIVVGPNGD-IISLGGSGGTRILSAVAQILLEVEVNGKDLNSAIDTPRIHHQLIPETIFLEKAFDQDIINGLYTKGHNVTRWPRHKSVVQIVKRKDGSIEALSDGRKHGLAYVY 621
299 1.000e-92UniRef50_K0KKT7 Putative gamma-glutamyltransferase n=5 Tax=Phaffomycetaceae TaxID=115784 RepID=K0KKT7_WICCF  ali  38  401.ISKEWAEKAVQQIKENQTHSWADYNPAFEINDPHGTTHISIVDQHHNAVSFTSTVNLLFGSLVRDPVTGIILNNQMDDFSVPGIPNAFGVQPSIYNFVRPGKRPLSATVPTIVVNELGKPDLVIGAAGGSRIITTVLQAIVRIYSYSMPILETVSYPRLHHQLLPNYIEHEEHIGNDIIESLKSKGHK-TLLQPPKTVLNAIRRWEAEYHAVSDWRKRGESS.. 623
300 1.000e-92UniRef50_A0A2J7QZG2 Uncharacterized protein n=2 Tax=Neoptera TaxID=33340 RepID=A0A2J7QZG2_9NEOP  ali  37  222LQSKDYGNQIRHNISDNRTTNPGYYGAVNFSVDDHGTAHISIIAPNGDAASITSTVNLHLGAGVTSHTTGIILNSGMNDFSIEKAKSYFGIPFSPANAITPGKRAVSSMCPSIIVNGEGDVRLVIGASGGTKITTAVAYVIMRILWFGEGIKQAVDASRIYHQIFPMEVSYDYGVLDQIIKGLEKLGHKTDRIRDRGSIICALSKLGNMITANADFRKGGDVFG. 446
301 1.000e-92UniRef50_T1CG57 Gamma-glutamyltransferase n=2 Tax=mine drainage metagenome TaxID=410659 RepID=T1CG57_9ZZZZ  ali  31  57LLSTANIARIRGEIQPDHATPSSEVKGSLGAPEGLHTTQFSILDAKGNAVSVTYSINYLFGVGMMAGDTGFFLNNTMDDFSKPGVPNSFGLVQGHVNEIQPGKIPLSSMVPSIVL-KHGKVFMVTGSPGGSTIISTTLESILNVVDFGMNMQQAVDAPRVHMQWYPDEVFVEPGYTPQTRATLEQMGYKFKTMPAWGAD-EAILVNPKTIEGANDRRRPGLAAGY 284
302 1.000e-92UniRef50_UPI000905CE91 gamma-glutamyltranspeptidase 1-like isoform X2 n=2 Tax=Pentapetalae TaxID=1437201 RepID=UPI000905CE91  ali  39  172MLSTEFAKQLKKTIYDNMTFSPNHYGGKWNQIYDHGTSHMSIVDSDRNAVSMTSTVNAYFGAKYLSPSTGIVLNNEMDDFSIPEKRSENVPPPAPANFIRPGKRPLSSMAPTIVL-KGEQLRAAIGASGGAMIIAGTTEVFLNHFARGMDPFSSVMAPRSYHQLIPNVLQYENWVPAKTRTALQKKGHVLQSIDGGT-ICQFVVQELGELVAVSDPRKGGFPSGF 408
303 2.000e-92UniRef50_A0A2G4G097 Gamma-glutamyltransferase n=1 Tax=Cyanobium sp. Baikal-G2 TaxID=2026889 RepID=A0A2G4G097_9CYAN  ali  30  178LLSAAHAQRLRAQIQLQRHRPASELAAQGFQVGGTNTTHLSVADPQGGLVALTTTLNFAYGSGISVPGAGFLLNNEMDDFAKPGVANAYGLVQGSANAIAPGKRPLSSMTPTLVFRPDGRPWLATGSPGGSRIITTVLQVLLNRLVHGLNLASAVASPRIHSQLWPDQISVEQGLSPDTVGLLEAKGHRVVVTAAM-GSANSVEVPEGGSLGVADPRRLDAAA.. 401
304 2.000e-92UniRef50_A0A0F4YDN3 Gamma-glutamyltransferase n=100 Tax=Eukaryota TaxID=2759 RepID=A0A0F4YDN3_TALEM  ali  35  384MLNDSTIRDIRRRISDFRTQNVSAYDPGLESLDTPGTSHIVASDHSGLAISLTTTINLLFGSRLMVPETGIIMNNEMNDFSIPGSSNAFGYVPSPSNYIRPGKRPLSSITPIMVTHPNGTLYFITGSAGGSRIITATVQSVIHVLDQGLSAPESLAQPRLHDQLIPNHVTFEYAFDNDTVAFMQGRGHNVTWVAAGQSTAQAIRVPNGTFEAAGEPR........ 602
305 2.000e-92UniRef50_A0A2D9HG32 Gamma-glutamyltransferase n=1 Tax=Myxococcales bacterium TaxID=2026763 RepID=A0A2D9HG32_9DELT  ali  32  332LLSPSHLKALRQSIKREGATPPSELKGGSEGNPHHETSHLSVLDRRGNAVSLTFTINTTFGAAVMAPGTGVILNNEMDDFSKPGVPNAYGLVGGEANAIAPGKTPLSSMTPTLVFGPDNRLRLVIGSPGGSTIITTVLQTILQTLHLGRTLAESLALPRFHHQWLPDCVLLDRGLNEDMSDALKELGHCLKVRED-FGNAQGIMIDDGRVTAASDPRGEGTA... 567
306 2.000e-92UniRef50_B8EJJ6 Gamma-glutamyltransferase n=18 Tax=Bacteria TaxID=2 RepID=B8EJJ6_METSB  ali  33  371LLSKAYAARLRSEISTQRARPANEIAPVDPTPESDQTTHFSIVDAEGNAVSNTYTLNFSYGLGLVAEGTGVLLNNELDDFAKPGAPNAFGLTGGEANAPAPRKRPLSSMAPTMVFQGD-DLELVTGSPGGSRIITIVAEIISDIIDFNMNVAEATAAPRIHHQGTPDQLDVESGLSPDTLRLLEALGHKVAQRGAW-GSAQSIVRGGGMLMGAADTRQRGTAAGF 596
307 2.000e-92UniRef50_G0RXX5 Gamma-glutamyltranspeptidase-like protein n=4 Tax=Sordariomycetes TaxID=147550 RepID=G0RXX5_CHATD  ali  36  313MLSDKTAKDTRGRIRDNETQPVDVYNPNNYTTDGHGTSHIVTADASGLTVTSTTTINLLFGAQIMTPDTGIILNNEMDDFSQPNRNNSFGFAPSQANFIAPRKRPLSSISPIIAEHNNGTVFFATGAAGGSRIISATVQVAWRLLSFSMSMHDAIAAPRVHHQLMPDVLKVETGFDKGVAEALKEKGHVVEWMEPGLSAVQGIMRLDGTFDAVGETR........ 532
308 2.000e-92UniRef50_A7F023 Uncharacterized protein n=3 Tax=Helotiales TaxID=5178 RepID=A7F023_SCLS1  ali  33  340IISPETASANRRKILDDKTQDVGRYNPEWDIKNNHGTSHMVATDASGLSITSTSTINLLFGSAVMVPETGVILNNEMDDFSIPGVPNSFGFVPSPMNYVRPGARPMSSISPIHISHPNGSHFLSIGAAGGSRIPTSTIQTIINIIDHGMSLEEALKQPRMHDQLLPERTTVEPGYSEELQEGLRERGHKVTWSSGRESAVQGVRVTGGWLEAVGEPRQKGS.... 572
309 2.000e-92UniRef50_UPI0009E20AFA gamma-glutamyltranspeptidase 1-like n=1 Tax=Orbicella faveolata TaxID=48498 RepID=UPI0009E20AFA  ali  42  362MTNETFAEILRRKIWDNQTHNASYYRGNFHFEEDYGTSHLSVLSPNGDAVALTSTINFHFGCKYRSRITGIIYNNEMGDFSTPGQLNPDDIPPSKSNFIKPRKRPQSSISPVIFTDRSGRVRLVAGASGGPLITTAVSLVVVNELWLSRGISSAVDYPRVHHQLFPNTVMIEKTISQNIQDGLRARKHNISEKAS-FAVVQAVVRDDEEIYGKSDPRKYGWPDGF 590
310 2.000e-92UniRef50_J9VNW0 Gamma-glutamyltransferase n=30 Tax=Tremellomycetes TaxID=155616 RepID=J9VNW0_CRYNH  ali  39  480...KEWADEIRKKITDNETHSADYYGLQYDTPIDHGTTHLSTVDKWGGAASVTSTINLIWGSHVMDPKTGIIFNDEQDDFAVPGAPDAFGLWPSPWNYPAPGKKPLSSTSASIILNPSPSLYAVIGGSGGSRIFPSVAQVLLNLFS-GLDISESIEAYRVHNQIVPDLTTIEEGVDEEVVEGLKERGHKIGEFDVNIGIVQAIVVEDGHIFASSDSRKNGIAAGY 711
311 2.000e-92UniRef50_A0A1L7HZK1 Gamma-glutamyltranspeptidase n=87 Tax=root TaxID=1 RepID=A0A1L7HZK1_9FLAO  ali  32  341LTSKDYAGKLRESIEMKKASDSANFNKEHLAYESPETTHLSVVDQEGNAVSLTYTLEQSYGSKIVVEGAGFLLNNEMGDFNIPGYTNSKGLIGTKPNLIAPEKRMLSSMSPTIV-AKDGQPVIVIGSPGGRTIINTVLQVIVNMIDFELDIAKAIESPRFHHQWLPDVTYFESGFSPDTMELYEAMGHEVK-TRSSQGRAMGIYIDNEELQGAADSRSPGRAVGY 570
312 2.000e-92UniRef50_A0A251V4U7 Putative gamma-glutamyltranspeptidase 1 n=153 Tax=Spermatophyta TaxID=58024 RepID=A0A251V4U7_HELAN  ali  39  381MLSPSFAKKIQGRIFDNTTFPSEYYMPGWSQIQDHGTSHFCIVDADRNAISMTTTVNYPFGGGMVSQATGILLNNEMADFSVPTEISPDSLPPSPTNFIAPNKRPLSSMTPIIIV-KDGQLAGVIGGSGGLYIIPAVLQVFLNHFILGLEPLDAVQSPRVYHKLVPNVVYYENWLSDDEKEFLKERGH-VLEAKSGGAVSQLIVQTKGMLTGVSDPRKDGKPAGY 630
313 2.000e-92UniRef50_G7E2N5 Uncharacterized protein n=2 Tax=Basidiomycota TaxID=5204 RepID=G7E2N5_MIXOS  ali  39  411LMTKQFGRETLANIT-GGTHSVSYYNPLFDVKTDHGTMHLSVVDAHGSAVSLTSTVNLPFGSRVMDRETGVILNDEMDDFATPGVPDYFGLEPSPFNYPEAGKRPLSSTSAVLMDDADGKFLLALGGSGGSRIYSAVAQVILN-LDWGQDLSAAIQEPRVHDQLLPTYVSVEGSYSPGILAGLAQRGHRVELFDINIGAVQAVQKLGGWFYAASDSRKWGRAAAY 639
314 2.000e-92UniRef50_A0A2D7H1X2 Gamma-glutamyltransferase n=1 Tax=Phycisphaerae bacterium TaxID=2026778 RepID=A0A2D7H1X2_9BACT  ali  37  322LLADEYLDTLASRIVQGETKETFTYGSVTPPPDDNGTSHLCVVDSDGMMVSATETINTSFGSLVYSPLLGFMLNNEMDDFSSPNGANAYGLRQSEKNAPEHGKRPLSSMSPTIVE-RDGVPVLAIGASGGPRIISSVIQVLLDILWFGDEPVEAVGRGRVHHQWLPDNVYVEEAYDKEVESYLLDVGYSIKVRAN-IGVVQAIQIDNGFLKPACDPRKRGKPAG. 544
315 3.000e-92UniRef50_A0A2J7QZH2 Gamma-glutamyltranspeptidase 1 n=3 Tax=Cryptotermes secundus TaxID=105785 RepID=A0A2J7QZH2_9NEOP  ali  37  375LQSKDYGNQIRHNISDNRTTNPGYYGAVNFSVDDHGTAHISIIAPNGDAASITSTVNLHLGAGVTSHTTGIILNSGMNDFSIEKAKSYFGIPFSPANAITPGKRAVSSMCPSIIVNGEGDVRLVIGASGGTKITTAVAYVIMRILWFGEGIKQAVDASRIYHQIFPMEVSYDYGVLDQIIKGLEKLGHKTDRIRDRGSIICALSKLGNMITANADFRKGGDVFG. 599
316 3.000e-92UniRef50_A0A163JHH0 Uncharacterized protein n=5 Tax=Mucoromycota TaxID=1913637 RepID=A0A163JHH0_ABSGL  ali  36  366LVSKDWASCVRQNLSDERTFPPPYYQPKYDHVEAHGTMHLSVVDEADGAVALTSTMNLLFGSRLMDPTTGVIFNDQMDDFSIPGTPNMFGLSPSKNNYVAPGKRPLSSITPVIVEH-DKALELVLGGSGGSLITTSVMQVLLNALDYDKDLYTATESPRLHHQLIPNIVIMEDDANFRLMQTLNDRGHQTFVLPPHVSAVQSVQRPNGQVGAVSDPRKNGLAAAY 592
317 4.000e-92UniRef50_A0A1Y6B2H5 Gamma-glutamyltransferase 1 Threonine peptidase. MEROPS family T03 n=2 Tax=Proteobacteria TaxID=1224 RepID=A0A1Y6B2H5_9PROT  ali  31  362LISKEYAAALRKELPLDKAGDSKVIGAGNPVPESPSTTHFSIVDQWGNGVSSTQTINYTFGSGVVAAGTGILLNDEMDDFSKPGVPNAFGLVGSKANEVQPNKRMLSSMSPSFIFQGS-RLVGIVGSPGGSRIINATFQTILHRYVYGMSPEDAVHGYRIHHQWLPDMVFVENSFPLQTSKSLEELGYDIKSTPYPIGDIQAVFRDGDEWIGVSDTRGDGQPMGY 588
318 4.000e-92UniRef50_A0A0F9Q302 Uncharacterized protein n=3 Tax=root TaxID=1 RepID=A0A0F9Q302_9ZZZZ  ali  30  343LTSKSHAEDIRGKIDLKKAIPSATMGEEILTIEEAETTHYSVIDKEGLAVATTYTINGWFGSGVVAEGTGILLNNEMDDFNVPGYTDDKGLIGTKPNLIEPHKRMLSSMTPTLVI-KDGKVYMITGSPGGRTIINTVLNVIINVIDFNMPIQDAIDAHRMNHEWMPDLLRLEKGITEELIESLKAMGHTMKESSRWQGDAHSILIDPGYYYGAADKRSQGSAIGY 572
319 5.000e-92UniRef50_V4A181 Uncharacterized protein n=1 Tax=Lottia gigantea TaxID=225164 RepID=V4A181_LOTGI  ali  41  387MMSPEYAELLRSKIDTNQTYSESYYNITSKPWDSYGTSHISVLAPDGDAVSVTSTINYYFGSLLYSPSTGIILNNEMADFHAGDYALLDELQSESANYIAPGKMPLSSMAPAIFVNQDGEVELVIGSSGGARITTVNAQVAARILWFKQTVKEAIEHLRFHHQLIPNHIIFEENFPKNIMNTLTKYGHEYTERTTYMAVVQGVARNTGEIEAISDQRKYGQAS.. 613
320 6.000e-92UniRef50_A0A1F5VVC1 Gamma-glutamyltransferase n=1 Tax=Candidatus Fischerbacteria bacterium RBG_13_37_8 TaxID=1817863 RepID=A0A1F5VVC1_9BACT  ali  32  341LLSNDFINTIRKVINKEKPTPSDEIAPQFNNKEKLHTTHFSIVDKHGNAVANTYTLNDTFGSSYIAGDTGILMNNEMDDFSIPGHPNMYGLIGSAANAIEPGKRMLSSMTPTIIE-KNGVLYAVLGSPGGSRIITSVLQVTLNLIEFRMPVSKAVSVPRFHHQWLPDILYLEESFDTGIVTALKDMAYSIE--NKRIGCVNAVIYDSERYYGASDPRKMGKTSGY 566
321 6.000e-92UniRef50_A0A0A1WV89 Gamma-glutamyltranspeptidase 1 (Fragment) n=1 Tax=Zeugodacus cucurbitae TaxID=28588 RepID=A0A0A1WV89_ZEUCU  ali  38  234.....HARHLAYLIDDARTFDATSYGASFVTRTDHGTAHISVMAPNGDAVAATSSINFYFGSGKIGARTGILFNNAISDFTIEGLENYFDLPNMPKNRIKPGASPMSSMSPIIVTDPNGEVRLVTGAAGGTKIISVLVHILVRILWLEQNIKQAIDAPRFHHQLEPNILEYEYGILQNVVKSLEAKGHQTKRYRERGSAVCGIEKVRGKLFANADYRKEGDVRGF 457
322 6.000e-92UniRef50_A0A2A4UCA0 Gamma-glutamyltransferase n=14 Tax=Gammaproteobacteria TaxID=1236 RepID=A0A2A4UCA0_9GAMM  ali  27  364LIAKSYARKRFTDFDPQKASDSEVISPGTAPQESVETTHYSVMDHFGNAVSVTTTLNLGYGNKVVVEGAGFLLNNEMDDFSKPGTPNAYGLLGSEANAIKAGKRMLSSMSPTIVI-KEGKPYLVTGSPGGSTIINTTLQVLVNVIDHQMPLNDAVALPRFHHQWKPNQIKFEYGISVDAQRKLRAMKHQLIQLGGTMGDANSVMNSEGVLMGMSDPRNQGGAAAY 591
323 6.000e-92UniRef50_A0A0D7NVI3 Gamma-glutamyltranspeptidase n=10 Tax=Proteobacteria TaxID=1224 RepID=A0A0D7NVI3_9BRAD  ali  33  357LIAKDYAAKLRAGISIDRATPSSKVSAATSPREGSNTTHFSVVDARGNAVSNTYTLNFSYGVGLVADGTGVLLNNELDDFTAAGASNAYGLVGYEANLPGPGKRPLSSMSPTIVL-KDGKPVLVTGSPGGSRIISTVLQVIVNVLDYKMDVAAAVAAPRLHHQWLPDEVRVERGFPDDVLFELKTMDHLIVEPMGQTS-ANSIAVTPNGPLGAPDPRRGAEAAG. 581
324 6.000e-92UniRef50_V5G4M2 Gamma-glutamyltranspeptidase 1 n=2 Tax=Holometabola TaxID=33392 RepID=V5G4M2_ANOGL  ali  40  74LTSKSYAQYIRQFIFDNQTFDPSYYGANTTLTEDYGTAHISVLAPNGDAVAITSTINYVFGAKFASNSTGIILNNEMDDFSSPNITSGYDISPSPAHFIVGGKQPLSSMCPTIILDGNGDVIMVTGAAGGTKITTTVSLLIMKHLWFGMDLLSAMDDKRLHHQLFPMRITFEGPYSTEIVEGLSNIGHNYTQLTDGFAAATSISRDTNKVTGVSDKRRPGTVS.. 303
325 7.000e-92UniRef50_A0A2E5FWF5 Gamma-glutamyltransferase n=12 Tax=Bacteria TaxID=2 RepID=A0A2E5FWF5_9GAMM  ali  32  372LLSDAHLDELRSSIKADRATPSSDIQASLGPDEGTHTTHYSIVDSAGNAVGVTYTINYLFGNARIAGDTGFFLNNEMNDFAKPGVPNAFGLVQGKANQVEGGKRPLSSMSPSMLLDDNGDVFMVTGSPGGSTIISTTLESMINVLDFDMNMQQSVNAPRIHNQWLPDVTRVEAGYTPETREALRAMGHSFNETDSWGAD-EAVLVDSGKRHGANDRRRPGLAAGF 600
326 7.000e-92UniRef50_A0A1M4XJX5 Gamma-glutamyltranspeptidase / glutathione hydrolase n=1 Tax=Aliifodinibius roseus TaxID=1194090 RepID=A0A1M4XJX5_9BACT  ali  30  340LLDPDYNEERMESFSWETASSSDDIGGDIPFRESTETTHYSIIDEAGNAVAVTTTLNGSFGSMVAVSGAGFLLNNEMDDFTAPGEPNMFGLIQGKANAIAPEKRMLSSMSPTIVT-QNDSVRMVLGAAGGPRIITATLHNFLNMAVFEMDPAEAISVPRFHHQWMPDKLYYEEGLSPDTRKLLKQKGHTLSASDG-LGRVHTIFVDDDGFLGAPDPRGDGMAAGF 566
327 7.000e-92UniRef50_A0A0B7FPL8 Gamma-glutamyltranspeptidase n=6 Tax=Basidiomycota TaxID=5204 RepID=A0A0B7FPL8_THACB  ali  39  339.LQKSTSKELADRISLSTTFPSYYYNPENYTAQESGTSHLVTADASGLVVSLTSTVNYYFGSQLMTED-GIILNDEMDDFSTPGTSNGFGYIATPANYIAPYKRPLSSISPTIVEDNEGNFHFATGAAGGSRIITATLQSLWHVLDQGMDVQSAINAPRLHDQIVPLTTTFEYTYDNATTAYMAALGHNVTWVAPGQSVVQGVTRDNGVFAAASDGRK....... 556
328 8.000e-92UniRef50_T1GPW7 Uncharacterized protein n=1 Tax=Megaselia scalaris TaxID=36166 RepID=T1GPW7_MEGSC  ali  38  248MTDPKFADLIRPLIRDDKVFDLKYYGSKSGGPEDHGTSAMSVLHPNGDAISVTSTINFYFGSKIRSPSTGIILNDNLDDFSTPGIVNTDGDLSSPYNFIEPGKRPLSSMCPSIVIDKKGDVKMVLGGAGGTQIVTAISQVLLKSLVFQESLDETINSKRLHHQLLPTLINYEEGFDPEVLEYLVGKGHAIESFGHRTSAVTAILVGNLTTEVAFDKRRGGSAA.. 472
329 8.000e-92UniRef50_UPI0006415392 gamma-glutamyltranspeptidase 1-like n=1 Tax=Hydra vulgaris TaxID=6087 RepID=UPI0006415392  ali  41  382MTSLDVGTYYRLKITDYLTHNISYYGAELPPPTDRGTTHLSIYAANGDAVSLTSTINDWYGSGFRSLTTGILYNNEMDDFSTPGQNTRFGYPPTAANYIKPNKRPVSSMAPVIMTDRLGDVKLVIGGSGGPKIITAVVQGIMYKTWFNDDLGQAVIRPRIHHQLIPNIVGGESNLPQVVSDGLSKIGHELRVVKPEYSAIQAIYVEPGEVYAKSDPRKYGHSSGY 610
330 8.000e-92UniRef50_A0A224YZ70 Gamma-glutamyltranspeptidase / glutathione hydrolase / leukotriene-C4 hydrolase n=4 Tax=Rhipicephalus zambeziensis TaxID=60191 Re  ali  39  373MTSRDFAAQAKNKINDSCTYDTEYYGFVNEAQEDTGTAHVTLYGSDGIAISVSSTINYYFGSLIRTNS-GVLLNDQMDDFSTPGKPNIYGLAPSKANFIKPGKRPMSSMSPMVLVDSAGKVQLSLGGTGGSLITSGIALVTVRALWQGYNIKQAIDEPRLHHQLIPNVLMVEPSFPEEYITALSELGHNVTKRRGRFNVILGVERDGARILANSDFRKGGTVDG. 597
331 9.000e-92UniRef50_A0A1Y1UA00 Putative gamma-glutamyltranspeptidase 1 n=1 Tax=Kockovaella imperatae TaxID=4999 RepID=A0A1Y1UA00_9TREE  ali  41  453..SKEWADAIRPLITDNTTHDYKYYGLVHDTPIDKGTTHLSVVDQWGGAASVTSTVNGIWGSKVMDPETGIIFNNEQDDFAIPGAADQFGLQPSPWNYPAPGKKPLSSTAATIILNDDGSLHAVLGGSGGSRIFPSIVQVILN-LECGYDISAAIERPRIHNQIVPQITTIEEGEDKGLSKSLRAKGHELLLFDVNLGIVQGVILDNGTLWAASDSRKHGVAAAY 679
332 9.000e-92UniRef50_F2UFF6 Gamma-glutamyl transpeptidase n=1 Tax=Salpingoeca rosetta (strain ATCC 50818 / BSB-021) TaxID=946362 RepID=F2UFF6_SALR5  ali  45  445MLNRSQGVHWHNRITNVTHHDPKYYGADYDIEPTPGTTHLSVVDSEGNAVGVTSTVNLYWGSKVLT-KHGILMNNEMDDFATPGVTNAFGVQPSPANYVGPGKRPLSSSAPCIAV-KNGSVRAVAGASGGTKITTATAQVLLNMLNFGMLTRQAVDSPRVHDQLLPDVVAGERAFPNKIRVALEARGHNWVQVDS-NAVTQAIYVDDGIIYPASDKRKGGHAAGY 667
333 1.000e-91UniRef50_A0A1W9RE95 Gamma-glutamyltransferase n=1 Tax=candidate division KSB1 bacterium 4484_87 TaxID=1970772 RepID=A0A1W9RE95_9BACT  ali  30  134LISDKFAQKMSENIHFDRAVPATELSANPFQFEGNHTTHYNIVDKNGMAVAVTYTINSGYGSKAAVDGAGFLLNNEMDDFAISGNANIYKIVSFSPNLIEPGKRMLSSMSPTII-RKNGKFFMAVGAMGGPKIITSTLQTILNVIVFDMSLQEAINAPRIHHQWLPDKIYVEKMFSLDVLDKLRAKGHTIETM-GYHSEVTAILFDKGELIGAPDFRWNGKASGF 361
334 1.000e-91UniRef50_J9K8W1 Uncharacterized protein n=45 Tax=Aphididae TaxID=27482 RepID=J9K8W1_ACYPI  ali  36  362..SDSYIDKIRSRIFDNFTSDPKYYGGDFDMPENHGTANMVVIDSMGNVVISTSTINTYFGSGFMSPSTGLLLNNEMDDFSTPGVVNIYGIPSSPANYIKPGKRPMSSMCPTIITDGKKDFVLAAGAAGGSKITLATAYVTALKLWYNKTLKEVIDKPRIFHQLVPMQVQYEYGTTRDVIQTLKDIGHPVRLSSTGFSAATAIAKSSGMIEAMPDFRRPGNSSGY 587
335 1.000e-91UniRef50_A8N5K8 Gamma-glutamyltranspeptidase n=1 Tax=Coprinopsis cinerea (strain Okayama-7 / 130 / ATCC MYA-4618 / FGSC 9003) TaxID=240176 RepID=A8N5  ali  39  388...KAYAHEIRKNLTDDRTHPPNYYQPEYDIITDHGTSHTSVVDKSGMAVALTSTVNLIFGSQVLDPVTGILLNDEMDDFSTPGTPNGFGLWPS------PWKRPLSSTAPTIIENEDGSFYLAIGGSGGSRIFGSLYQAVLN-LDWGMDASEAVEFGRLHDQLFPDITDADSVYPEDILEDLRRRGHHITVVDRVAAVVQLVLQKDGVFYAASDSRKNGIAAGW 627
336 1.000e-91UniRef50_A0A0D2WLC4 Uncharacterized protein n=1 Tax=Capsaspora owczarzaki (strain ATCC 30864) TaxID=595528 RepID=A0A0D2WLC4_CAPO3  ali  42  438..DTEYADDIAARIHDNETFDPEYYGAIYDVEPTRGTTHLSVLGTRGDAVAVTSTINTYFGAKFTSPSNGVILNDEMDDFSSPNITNAYGVPPSPANFIKPGKRPLSSSAPTIVFNAKNEVYMVVGASGGTRITTSTIQVMQSVLTFGEGIDDAITRPRLHHQLLPNILMLEPAFPTNLYTGMQAIGHNVT-TSTSIAVVQGIVQAPNVIYAKSDPRKGGEAVVF 676
337 1.000e-91UniRef50_A0A2P6RR44 Putative aminoacyltransferase, Glutathione hydrolase n=36 Tax=Mesangiospermae TaxID=1437183 RepID=A0A2P6RR44_ROSCH  ali  38  352MLSPKFAEELKKTILDNMTFDPSHYGGRWGQINDHGTSHLSIIDHEQNAISMTTTVNSYFGAQMLSSSTGIVLNNEMDDFSIPGNVSTV-PPPAPANFIRPGKRPLSSMTPTIIL-KDEQLKAVVGASGGAMIIPATAEVLLNHFARGMDPLSSVLAPRFYHQLYPNVVHYENWLPAQIRKSLQKKGHVLEPLAGG-AICQFIVIENGGFVAVSDPRKGGIPAGF 589
338 1.000e-91UniRef50_A0A2E4BPV7 Gamma-glutamyltransferase n=6 Tax=Bacteria TaxID=2 RepID=A0A2E4BPV7_9FLAO  ali  27  345LISDRYLKVRMDNFSFDKATSSDSLSGMIPGFESDETTHYSIVDNFGNAIAVTTTLNAAYGSKLYSNKLGFFFNNEMDDFSSPGEPNMYGLIGGKANAIEPQKRMLSSMTPTIVE-KNGTFWMTLGTPGGSTIITSVLQTILNVYEFDMNMQQAVDAPRFHHQWLPDIIRFEPNFPKDSLNYLRTKGYQVMENNSIIGKVDGIRIPDGKLEGGADHRGDDTAIGY 573
339 1.000e-91UniRef50_A0A2K3QIH4 Gamma-glutamyltranspeptidase 1 n=1 Tax=Tolypocladium capitatum TaxID=45235 RepID=A0A2K3QIH4_9HYPO  ali  41  391MLSDGTARRTRGSISDDRTQPVHAYDPGIYTPDSHGTSHIVTADASGMATSLTTTINLLFGARLMDPASGIVLNNEMNDFSIPGVPNEFGFQPSTANYIRPGKRPLSSITPVIATHRNGSLYATVGAAGGSRIISATAVALWHLLEHGMGMRDALREPRLHDQLMPNTVLLEYKFDNDTAAALAERGHNVTWVAEGLSAVQGIRILDGTFEAAGEPR........ 610
340 1.000e-91UniRef50_A0A2E7CJD8 Gamma-glutamyltransferase n=1 Tax=Proteobacteria bacterium TaxID=1977087 RepID=A0A2E7CJD8_9PROT  ali  33  327LLCEDRIEAVRAAFDAEKTLSAEEYGAPVDAGNDAGTQHISIIDKNGFAVALTTTINTTFGSKVVGEKSGVVLNNQMDDFAQPGAPNAYGLVGSEANAVAPGAVPLSSMSPTILVSPDGTQRIAIGASGGPFIITSTLQSIINIIDFEMNPSEAVSAPRVHHQWQPRQIFLDVGISSDTESLLIEKGHKVTHFEH-YSSVQVVHWDGEIFRGASDPRKGGWPVG. 550
341 2.000e-91UniRef50_H3B3P6 Uncharacterized protein n=2 Tax=Euteleostomi TaxID=117571 RepID=H3B3P6_LATCH  ali  50  1MTSEAFARDLYKKIKDNTTLPIEDYGSKFYIPDNTGTTHLSVVAEDGSAVSATSTINNFFGSLVLSNSTGILFNDIMDDFVQFGHKINTEVAKSLA---GESKRPFSSMCPSILLDKNHQVKMAVGGAGGTKITTATALVMMNVLWFDYDVNKAVKEPRVHNQLSPNNSSLEHGVDKSVREGLQMRQHNIDELKNKSSSVQIIVRKEGKWIAESDFRKGGQPAGY 226
342 2.000e-91UniRef50_B3SA54 Uncharacterized protein n=1 Tax=Trichoplax adhaerens TaxID=10228 RepID=B3SA54_TRIAD  ali  37  343MLSKNVGEELREKISDYQTFNVSYYGAQSDVQNTYGTTHVSILTSHGDAVSVTSTVNWYFGSGLITP-TGIVLNNQMDDFSSPNITNGFGVEPSKANYVKPGKQPLSSISPVLHLHRKCKENLAVGASGGTMIITGVSQVLLDLLSFKQNISSAIERPRLHDQLLPDAVEVETNFPKSIITGLEKLGHNVKDSAS-KSVVNGVSEFDRKFLAHADSRKGGTGA.. 565
343 2.000e-91UniRef50_A0A2D6MYT4 Gamma-glutamyltransferase n=10 Tax=Bacteria TaxID=2 RepID=A0A2D6MYT4_9DELT  ali  34  465LVSKSYAKAQRARIDASKATEIRRPGA---IPEDAGTTHLSVTDADGRAVALTMTINTPFGSGITVKGTGVVLNNEMDDFAVANIPNSFGLIDTRANLPAAGKRPLSSMTPTI-LDRDGQLFMVSGSPGGPRIISTTLLTILNVVDWEMDPQAAVAAPRFHHQWDPNRLRVEPETADEVVSELEAMGHEVERSSRRWSAAEIIVVEPGTHLGGADPRSDGAAI.. 687
344 2.000e-91UniRef50_J5KHL1 Gamma-glutamyltransferase n=8 Tax=Bacteria TaxID=2 RepID=J5KHL1_9GAMM  ali  29  348LINKTYANNIASKISKNKITPSSKIKPGLDDVESFETTHFSVADSQGNIISSTYTLNSSFGSGVVIKGTGILMNNEMDDFSAPGIPNQFGLLGSEANEIQPGKRPLSSMTPTIVT-KNNEFFFSTGSPGGSRIISAVLQSIINIVDFDMNLEDATKAIRIHHQWYPDLLQIENGYPEGLAATLENNGYNVKFIKPAT-CIQTIMKSNEIYYGYGDFRRDAFASG. 572
345 2.000e-91UniRef50_A0A246B7Z7 Gamma-glutamyltransferase n=29 Tax=Bacteroidetes TaxID=976 RepID=A0A246B7Z7_9FLAO  ali  31  336LISDAYLKNRWKSYNKDLATPSSEVGKIIPQPESTETTHISIIDKEGNAVSVTTTLNGYYGSKVVVEGAGFFLNNEMDDFSIPGVPNMFGAVGGEANKIEPGKRMLSSMTPTIVL-KNGKPYIVVGTPGGTTIPTSVYQSIVNVLDFKLNPNLSVNAPKFHHQWLPETIAVEKGFPESTIKALESKNYKFDRINQ-IGKTEIIVIENGNATAVADGRGDDSVA.. 559
346 2.000e-91UniRef50_A0A2V3GKG7 Gamma-glutamyltranspeptidase (Fragment) n=1 Tax=Pseudomonas aeruginosa TaxID=287 RepID=A0A2V3GKG7_PSEAI  ali  30  8LTDPEYLKQRAAEVNPTAISPTEKVRPG---LEPHQTTHFSIVDADGNAVSNTYTLNWDFGSGVVVKGAGFLLNDEMDDFSKPGVANAFGVVGSDANAIEPGKRMLSSMSPSIVT-RDGKVSLVVGTPGGSRIFTSIFQVLNNIYDFHLPLEKAVAAQRVHYQLLPDTIYYDAYAPGKVAEELKAMGYTLEDQGWNMGDIQAIRVDGKALETASDPRGRGV.... 228
347 2.000e-91UniRef50_A0A2A5E9R3 Gamma-glutamyltransferase n=11 Tax=FCB group TaxID=1783270 RepID=A0A2A5E9R3_9BACT  ali  32  348LLAKSYAAERISDISMETATPSSEISAGVPAPESMETTHYSVADNLGNAVSVTVTLNTAFGSCIVIDGAGFLMNNEMDDFSKPGVPNAYGLVGNAANXIAPGKRMLSSMTPTIIV-KDREPYLVLGSPGGSTIITTVLQNFLNVVTHGMNIQQAISAPRHHSQWLPDKIMFEPALSPTTLDELIVRGHETEERAS-IGQANAIMITPEGFWGAPDTRSDNAARGY 573
348 2.000e-91UniRef50_A0A177EUF2 Uncharacterized protein n=4 Tax=Fonsecaea TaxID=40354 RepID=A0A177EUF2_9EURO  ali  37  362MLSDATARDIRSKISDLRTLNVSAYDPGIESLETPGTSHIVTADASGMAISLTTTINLLFGSQILVPETGVIMNNEMNDFSIPGSSNAFGYVPSPSNYVRPGKRPLSSISPTIVEYGNGTLYYVTGAAGGSRIITATIQSLVHVLDQNMTAPQALAQPRLHDQLIPNQVTFEYAYDNETVAFMKSRGHNISFIAPGQSSAQSIRRPNGTFEAAGD.......... 578
349 2.000e-91UniRef50_B3S594 Uncharacterized protein n=1 Tax=Trichoplax adhaerens TaxID=10228 RepID=B3S594_TRIAD  ali  45  353MLNPTFNANLRRKINDNRSFLPSYYGGNFSATKNAGTSHMSVLAPNGDAVSVTSTVNLYFGSKVRSSTTGIIYNNEMDDFSTPGLVNAFGLRPSPANFIKPGKRPLSSMSPSIFVDNMGMVKFISGASGGSRITTATALVTMNHLWFHKALPEATKTPRFHNQVYPNVTLVERDFPQNLIDGLAKRG-NACAKSGSGAVVQSISQLKAMISAFSDLRKHSKAAGF 578
350 2.000e-91UniRef50_A0A1H0HPM0 Gamma-glutamyltransferase 1 Threonine peptidase. MEROPS family T03 n=3 Tax=Bacteria TaxID=2 RepID=A0A1H0HPM0_9RHIZ  ali  31  345LTSDAYAGAIRARIDDARAGVSE--GLAPVSGEKPETTHYSIVDAAGNAVAVTTTLNGSFGARVVAPGTGILLNNEMDDFTMPGVPNLYGLVQGEANAVAPGKTPLSSMSPTIVL-RDGHPLLVLGTPGGSRIITAVVEAFLNVVEYGMDIQEAVDAPPFHHQWLPDRIALEPRLSPDTQRMLREMGHRVEEDADWWGEAAAILVSDRPLFGAIDSRRAGAAIGY 583
351 3.000e-91UniRef50_A7RVG4 Predicted protein n=7 Tax=Hexacorallia TaxID=6102 RepID=A7RVG4_NEMVE  ali  40  354MLDQSTADYLRAQIWDNQTHDNVSYYANYFSYEDHGTSHLAVLAPNGDAVSLTSSINLRFGNQHRSTTTGIIYNDQMSDFDNPGSKRHAGLSPSELNFPAPGKRPFSSMTPVIITDNNGNVKMVFGASGGKQIITATSQAIMNKLWFGRSLKQSIEDLRIHTQLIPDDLYHEANFPRDILDGLRNLGHDLKELKH-YAAVQGIVRERGEIYAWSDSRKSGKPGGF 579
352 3.000e-91UniRef50_A0A2D6PV03 Gamma-glutamyltransferase n=1 Tax=Planctomycetes bacterium TaxID=2026780 RepID=A0A2D6PV03_9BACT  ali  32  339MASKAYAAKLRDRIRESEAMPPAY-------PEKEQTTHYSTMDASGCAVACTTTLNGGYGCAVTVPGAGFLLNNEMDDFSAPGVPNMYGLIQGEANAVGPRRRPLSSMTPT-LLQRDGRVIMVIGSPGGPTIINTVLQCVLNVVDHDMDIAQAIAAPRVHHQWLPDRIVHEPGINPDVLRGLRKRGHDTRARRGWMGDAHGILWDAERMTAASDPRNGGRAMGF 563
353 4.000e-91UniRef50_W0J0B7 Gamma-glutamyltranspeptidase n=14 Tax=Bacteria TaxID=2 RepID=W0J0B7_9BACT  ali  30  343LLRRDYLERRMADFDPERATPSSRVGGGPPPPESTETTHFSVLDADGNAVSCTYTINGLYGSGAVAEGTGILLNNEMDDFSKPGTPNAYGLIQGEANSIGPGRRPLSSMTPVIVV-REGRVRIVTGSPGGSTIINTVLEVVTNLIDHGMTPAEAVAAPRFNHQWMPDAISHEAGLPPEVLAALRAKGHTLRMRRLYANDVQGIVVDPGLRTGVADGRRPGGAA.. 579
354 4.000e-91UniRef50_A0A2H0DP51 Uncharacterized protein n=1 Tax=Elusimicrobia bacterium CG22_combo_CG10-13_8_21_14_all_63_91 TaxID=2014312 RepID=A0A2H0DP51_9BACT  ali  37  94MISLERAAKIRAGIVPGETRSPERYG-IAGLKDDHGTTHYSVMDKDGNAVAATETVNTYFGSLVMAGDTGIVLNNELDDFSIRDVPNAFGLLMSTRNVLSPGQRPLSSMSPTILL-QGGEAVLAAGGSGGPRIITATLQAVLQIVEFAKTPAEAVALGRVHHQWAPNQVFAEKRLPREVLLRLENDGHAVVELPSREAAVQVVYRDGGRLFAASDPRKGGRPAG. 317
355 5.000e-91UniRef50_A0A2D8QUK9 Gamma-glutamyltransferase n=14 Tax=root TaxID=1 RepID=A0A2D8QUK9_9GAMM  ali  25  332LIDKAYAKARFGNVNLRRASDSDEYPGAMPPAEGMETTHFSVLDKDGLMVALTTTLNSSYGNKIVVPGTGMLLNXEMDDFSKPNTENQXQLLGAEANAIAPNKRMLSSMTPTLVT-RQGEPFLITGSPGGSTIITTTLQVIXNIIDHGMSIEDAVSVPRFHHQWKPDRILYERAFSPDTIRELQARGHTEANWGRGIGDANSILFKDGVMQGVKDPRAEGMAVGF 561
356 5.000e-91UniRef50_A0A034WHE1 Gamma-glutamyltranspeptidase 1 n=1 Tax=Bactrocera dorsalis TaxID=27457 RepID=A0A034WHE1_BACDO  ali  35  217MLDPSFAAKSRELILDDHTYDFAHYGANFTNEEDRGTANIAILAPNGDAIAVTSTVNSHFGSKVRSRQTGIILNDEMDDFSTPGVINAYGIPSSPSNYIKPGKRPLSSTCPSIVLDHNGNVKLMVGGAGGSRITTSVAQVIIRYLMLNHTLQESLDAGRVHHQLAPMQVDVEPEVPEHVNNYLLKVGHDINYLGGAYSALTAIGLKTEMPQAACDRRRLGS.... 440
357 5.000e-91UniRef50_W7MNJ5 Gamma-glutamyltransferase n=1 Tax=Gibberella moniliformis (strain M3125 / FGSC 7600) TaxID=334819 RepID=W7MNJ5_GIBM7  ali  37  176MLNATTAERIRSKIDPRKTQKNEKYNPGIYSSDGHGTSHVVTADGDGMAVSLTTTVNLIFGSFLMDPLTGVILNNEMNDFSIPGVPNEFGFAPAEANFIRPNKRPLSSCTPLIVSNKDGSLFAVIGAAGGSRIISATTQVAWRVLW---SIKDAVREPRVHNQLIPNTLLVEKKFSSYDVPSLVERGHNITWVDEGLSTVQALTRDPGVFEVAPEPR........ 395
358 5.000e-91UniRef50_A0A0C2MWN5 Gamma-glutamyltranspeptidase 1 n=1 Tax=Thelohanellus kitauei TaxID=669202 RepID=A0A0C2MWN5_THEKT  ali  36  99LTNREYGEDLNKRI-LNQTQEEDYYGPEFVAKEDHGTTHISILAADGSAVSITNSINIWFGSGYRSTKTGIVYNNHIDDFSIENRTNAFLLKPSHRNNIQAFKRPMSSMSPLMIT-KDDKLKMILGGSGGTRIISSVASVIIYKIWFDLSLKQAIFQPRVHHQLTPNKAVIEKKYPKNIVQILKKYKHEIGFTSPEYSSVQAVYIENGEIFGKSDPRKYGIEAGY 325
359 5.000e-91UniRef50_UPI000C6CF05D uncharacterized protein LOC111620813 n=1 Tax=Centruroides sculpturatus TaxID=218467 RepID=UPI000C6CF05D  ali  41 1000LLNKSFADETRLKIRRNETHDPKYYGIEQFMDDDSGTAHTSVLAPNGDAVSVTSSVNAYFGCKRVSPSTGIILNNQMDDFSLPNIVNIFGIPPSKRNRIRPGRRPLSSMSPTIVLDDKGKVWLIVGGNGGTQITTGIALVTMQLLWLEKNVKEAIDMPRIHHQLLPDYISYEKNFPKIILDDLKKLKHKVKEKYGKMSIMMAVRRNDGKWTANADYRKNGENDGF 1226
360 6.000e-91UniRef50_D2R0Y5 Gamma-glutamyltransferase n=1 Tax=Pirellula staleyi (strain ATCC 27377 / DSM 6068 / ICPB 4128) TaxID=530564 RepID=D2R0Y5_PIRSD  ali  30  351LIDEKYLMARASLINPQETTAAVAGEPPHPQSDSKHTTHITAADRAGNIVAITATVNTTFGSKVIVPGTGLVLNNEMDDFSIPGVRNAFGLIGGQANEVAARKRPLSSMSPTIVLDVDQKFRLTTGAAGGPTIISQVLLNVLRTLEFGENLATAIAAPRIHQQWSPDELRCEKTLPQEVQDDLSSRGHQLKLVDSM-GVSQGIERRDDTLVAVHDPRVPGSARGW 577
361 7.000e-91UniRef50_A0A2A2TJC7 Gamma-glutamyltransferase n=1 Tax=Calothrix elsteri CCALA 953 TaxID=987040 RepID=A0A2A2TJC7_9CYAN  ali  33  351LISPEYAKIRRQQIDMERAKPSSQVKPADTGLESQETSHLNVVDGQRNAISLTFTINTGFGAGVVAEGTGILLNNEMDDFAIPGIPNSYGLVGNEANAIAPRKTPLSSMTPTIIT-ENGKLRMVTGTPGGSTIITQVLQVVLNVLEYKMNASAAVSAPRIHHQWLPDELRVEAGLDTMTLQELRRRGHNIVEKPFW-GNANIILVNDGILEGATDTRGEGEPRAF 605
362 7.000e-91UniRef50_A0A1W9RJD2 Gamma-glutamyltransferase n=1 Tax=Candidatus Latescibacteria bacterium 4484_7 TaxID=1970771 RepID=A0A1W9RJD2_9BACT  ali  33  334LISKEYADSLRRTITGN-ATPSSTLQGSFNVKEHLQTTHYSIIDCMGNAVATTTTLNSSYGSKVLVERGGFLLNNEMDDFSIPGAPNIYGLVGNEANSIAPGKRMLSSMSPTIVLDG-GKIFMILGTPGGSTIITTVAQIIVDVIDFRMSVSDAVSMPRFHHQWLPDEIFYEKNFTEKEMEELKTMGYELSERSS-IGDVQVIQVVDSIRCGVSDPRGMGEAA.. 557
363 7.000e-91UniRef50_A0A2P6TRP8 Gamma-glutamyltranspeptidase 1-like n=4 Tax=Chlorellaceae TaxID=35461 RepID=A0A2P6TRP8_CHLSO  ali  41  442LNSSDFIDSLRSSISDSGTLPFSAYGGAFAHPEDHGTSHLSVVDADRMAVAMTTTINTGFGSKVLSPSTGLLLNNQMDDFSTPGQPNVYGIAPSKANFIRPRKKPFSSMSPLIAE-RNGSLVLAIGASGGPRIISAVLQACVRLVAYGEGLFPAVANPRLHHQLTPNLLYVEDWYDADTAELLATRGHNVSSTA-WGAVTQAILVDTGELHGVSDPRKDGAPAA. 679
364 8.000e-91UniRef50_Q31EW6 Gamma-glutamyltransferase 1. Threonine peptidase. MEROPS family T03 n=14 Tax=Proteobacteria TaxID=1224 RepID=Q31EW6_HYDCU  ali  33  350LISNAYLRKRAADVLMDEISETQTIKPGLA--ESTDTTHFSVVDAQGNAVSNTYTLNMPFGSGVVVSKAGFLMNDEMDDFSTPGVANVFGVVGGKANEIAPEKRMLSSMSPTILV-KNGAVEMVVGTPGGSSIITSVFQTIVNVIDRHLSPQRAVDAPRVHHQLLPDVIMYHPDLSTETKQALRLMGYQLKR-NNYLGDVQLIVRQHGKLQAASDVRGRGV.... 568
365 8.000e-91UniRef50_A0A1E3NS22 Uncharacterized protein n=8 Tax=Saccharomycetales TaxID=4892 RepID=A0A1E3NS22_9ASCO  ali  35  387.LSKEYIQSVKEKINDNFTNPWENYDPAYEPNDPHGTSSLSVVDKGGNAVTLTTTVNLLFGSCVHDPNTGVIMNNEMDDFSVPHTRNAFGLSPSVYNYIEPYKRPLSSSAQSIVVNSKGNVELVIGAAGGSRITTAILQGIVRTFIQGKNITNVIANPRIHHQLLPDNIFFERPVSDVLIKELEGKGHTVELISPMTA-MNAIRVTSEGMWGQGDWRKFGVAVG. 609
366 1.000e-90UniRef50_E2CH20 Gamma-glutamyltransferase n=1 Tax=Roseibium sp. TrichSKD4 TaxID=744980 RepID=E2CH20_9RHOB  ali  32  311........................YPIGEFGLNSADTTHYSVVDKGGNAVSNTYTLNFSYGAGMTADGTGVLLNNELDDFSKPGVPNAYGLIGGDANAVEPNKRPLSSMSPTLVF-KDGKVLLVTGSPGGSRIITTTLQIIMNVIDHQMNIAEASAAPRVHHQWYPDEIRIEEGLSPDTIRLLEARGHTLAVKNVMGST-QSIMQIDGVLAGASDPRRRGATAGY 511
367 1.000e-90UniRef50_A0A2A6BRC6 Uncharacterized protein n=9 Tax=Chromadorea TaxID=119089 RepID=A0A2A6BRC6_PRIPA  ali  37  453MITPNFITSIVNKIKD-HALPMEDYDVPMSMPEDHGTSHVSAIDEEGNAVSCTSTVNQLLGSMKISPTLGIIWNDEMDDFSTPGQANLFGFAPSETNFIAPGKRPMSSMSPVIIYSKDGEVKMVSGAAGGSFIISSVAQAIIHTLFFNQTVKESLDAPRFHHQYLPHKTDYEYTVPAEIIDALRTRQQNMTVVDKIASVVQSLQVDDGYIHGNSDWRRKTYPSGF 681
368 1.000e-90UniRef50_A0A1E4T5V4 Elongation factor Tu n=1 Tax=[Candida] arabinofermentans NRRL YB-2248 TaxID=983967 RepID=A0A1E4T5V4_9ASCO  ali  39  691..SPEWSKEVNKKINDDHTLPSKDYEPAYQPNEPHGTSHLSVIDQYDNAVSITTTVNLLFGSMVHDPETGIILNDEMDDFSLPNMPNAFGLQPSVYNYIEPYKRPLSSTTPSIIVDKTGKIDMVVGAAGGSRITTAVLQAIIRTYHYNLPLLETIAFPRLHHQLLPETLFIEN---PEVLEAMEDRGHHIEMIGHQTA-MNAIKVDDDVIFAQSDWRKLGKAAGY 915
369 1.000e-90UniRef50_A0A2E6N2F6 Gamma-glutamyltransferase n=1 Tax=Balneola sp. TaxID=2024824 RepID=A0A2E6N2F6_9BACT  ali  31  363....DYAAERMESFDPNRATPSNEIGEVTILQESYETTHFSIMDAQGNAVGITTTLNGSFGSKIAVDGAGFLLNNEMDDFSAPGTPNMFGLLGGEANAIVPGKRMLSSMTP-IIVSKNGQTKMIAGAAGGPRIINATLQNVLNVLLFGMNAQQANAAPRIHHQWYPDQLFFDPSLSADTQALLRTKGHSLAQTT--LARVHSIVVDKGRLTGGVDPRGDGYAAGY 585
370 1.000e-90UniRef50_A0A0B2VMC3 Gamma-glutamyltranspeptidase 1 n=1 Tax=Toxocara canis TaxID=6265 RepID=A0A0B2VMC3_TOXCA  ali  41  600MTSDEFARSIVERITD-RSHATSYYGGKFAPTTDRGTTNIAVIDKDGNAVVSTTTINLLFGARVASESTGIIWNCQMDDFSLPDRPNFYGYPPAPANFIRPGKRPMSSISPLIFVNKSNKVELALGAAGGSTIISTVSTIATRVLKLGWDLKTAIDAPRLHDQLLPNVTEYERNFPQEYVSKLSRRGHIMQKI-QAIGEATGIHVKEGQLYATCDFRKGAEPAGY 825
371 1.000e-90UniRef50_D4B387 Glutathione hydrolase proenzyme n=314 Tax=Eukaryota TaxID=2759 RepID=GGT1_ARTBC  ali  40  358MISDEAANKNRMNISDEYTQDIAVYDPGLESLNTPGTSHISTADRSGMAVSLTTTINLYFGSRVIVPETGIIMNNEMDDFSVPGRSNSFGYKPSPSNFIRPGKRPLSSICPTIITRPDGSLYFVSGAAGGSQIITGTLQSVINVMDRKMNVRQALKAPRLHDQLVPNVALMEDEFDKKTVDFMISRKHNVTREKSG-STVESIMRKNGVFEASGEPR........ 575
372 2.000e-90UniRef50_A0A1V3YIY5 Gamma-glutamyltransferase (Fragment) n=3 Tax=Alphaproteobacteria TaxID=28211 RepID=A0A1V3YIY5_9RHIZ  ali  32  1......AAEIRSRIDPYRAGVSEALKPA-EFKESNETTHYSIVDKDGNAVAVTYTLNGSFGTAKVAEGTGILLNNEMDDFTIPGVANLYGLIQGEANAIEPRKSPLSSMSPTIV-SKDGKPFMVIGSPGGSRIITITLEAIMNVIDHGMDIQEAIDAPRIHHQWLPDRVYMEANLSPDTIRLLAGMGYTVGEDHNWWGEAAGILVGDNRYYGAIDSRAAGAATGY 233
373 2.000e-90UniRef50_A0A2R4XPB9 Gamma-glutamyltransferase n=1 Tax=Bordetella sp. HZ20 TaxID=2163011 RepID=A0A2R4XPB9_9BORD  ali  33  393LTSMAYAQALADEISLTEATPSSAISAGEPAPQGTETTHLSAVDRWGNMVSLTTTLNLNFGSGWMAPGTGVLLNNEMDDFSSPGVANAFGLIGSDANRIEPGKRPLSSMTPVIVF-RDGQPAFATGTPGGARIITMVLQVILNVADHKMNIAAAGAVPRMHHQWLPDRIDLEPGFSPDTIRILQQSGHQVEPSRAA-GRVQSVVQNDDRWLGASDPRSDGAAIG. 632
374 2.000e-90UniRef50_A8TLV5 Gamma-glutamyltranspeptidase n=4 Tax=Bacteria TaxID=2 RepID=A8TLV5_9PROT  ali  29  365LISKDYAEARRISIDLANATASATLGPGQPNVESNNTTHLSVMDREGCAVALTTTLNFAFGTGIVAEGTGIFLNNEMDDFTAPGASNGFGLVQGEENAIEPNKRPLSSMSPTLVLDGPNTA-IATGGQGGSRIITAVLQTLVNTLDHGMNLAEATLAPRVHHQWLPDELAVEEGFSPDTLALLERMGHRVVVKRP-LSTVQSARRVIEGYRGMSDPRREGLAAG. 589
375 2.000e-90UniRef50_S3M9R4 Gamma-glutamyltransferase n=1 Tax=Treponema vincentii F0403 TaxID=1125702 RepID=S3M9R4_9SPIO  ali  28  93..SKKYAKEIAKEIDMKVSHESKAHDPWLYESED--TTHYSIADKDGNMVAITKTVNGLFGNSVVVDGYGFVMNNEMDDF---------VLGAGHPNSVAPNKTPLSSMSPTIVL-KDGKPFMVLGSPGATKIISTVSQVISRVIDHKMGMQEAIDVPRLWD-NTSNKINVETRIPDETVKQLEAMGHKVNKTSDWMGSVQGVLYKNGTLEGGADPRRDGKAVGF 306
376 2.000e-90UniRef50_UPI000BA7E943 gamma-glutamyltranspeptidase 1-like n=1 Tax=Limulus polyphemus TaxID=6850 RepID=UPI000BA7E943  ali  41  292LASKEFAKETKNNIYDNQTFDPSHYGVEPFIQADWGTSHLSIVAPNGDAVAVSSTINSYFGSKKASISTGIVFNNEMDDFSSPNITNAYGIVPSKYNKISPGKRPFSSMSPTIVVDGNGNIRLVIGGTGGTKITTATTLVSILNLRAGLSIKNAIDSPRIHHQLIPNTIMYEPNFPEELLEGLKRKGHNVTEISGRSSFIMGIARKKGTLYANADYRKGGASDGF 517
377 2.000e-90UniRef50_UPI000B932128 gamma-glutamyltranspeptidase 1-like isoform X2 n=1 Tax=Myzus persicae TaxID=13164 RepID=UPI000B932128  ali  36  243.TSDMYMNSVQNNMSDECTTDPKFYGADFSLAEDHGTENIAVLDSFGNAVAVTSTINTPFGSGFVSESTGIIFNNEMDDFSTPRSNNFYGFPPSLSNLIQPYKRPMSSMCPTVITDSKGDVALVIGGAGGSKIPLATAYVSALVLWYNKTLKEAIEEPRIYHQLIPMQVDYEYGVLKPVVEKLKNVGHKVRRMKKDKSAVTGIFKTPGIITAMSDFRQQGNISGY 469
378 2.000e-90UniRef50_UPI0007AFAD3B gamma-glutamyltranspeptidase 3 isoform X2 n=4 Tax=Mesangiospermae TaxID=1437183 RepID=UPI0007AFAD3B  ali  36  230MLSPSFAQKIQRRIFDNTTFPPEYYLNRWSPLRDHGTSHFCIVDSDRNAVSMTTTVNSHFGAGVLSTSTGIVLNNEMDDFSIPTDISPDKLPPAPTNFIEPKKRPLSSMTPIIIT-KDDHLIGVIGASGGMNIIPAVIQVFMNHFILGMEPLDAVQSPRIYHKLIPNVVRYENELLKSSRIFLQERGHQLSE-SGALAITQLIHKKNGILTGVSDPRKGGRPAA. 472
379 2.000e-90UniRef50_W6TPB1 Gamma-glutamyltranspeptidase n=75 Tax=Bacteroidetes TaxID=976 RepID=W6TPB1_9SPHI  ali  29  324LLDNAYIKSRMNNFSWNKATLSAEVEGKLNTAEHEETTHFSIVDRDGNAVSITTTLNGSYGAAVVVKGAGFLLNNEMDDFSVPGTPNMYGLVGGEANAIAPGKRMLSSMTPTIIE-KDGKLFMVVGTPGGSTIITAVFQTILNVIEFDKNMQQAVSAKKFHHQWLPDEVYTEENLDSLTALKLKAKGYNIVPRGP-IGRVDAILKTKGYYQGGADPRGDDSIAAW 550
380 3.000e-90UniRef50_C0SFS2 Gamma-glutamyltransferase n=9 Tax=leotiomyceta TaxID=716546 RepID=C0SFS2_PARBP  ali  39  389MLRVSTAAQIRAKIFDESTQNVSAYDPGHQILETPGTSHLVSTDRTGLAVSLTTTINLIFGSKLMVPETGIVMNNEMNDFSIPDTSNKFGYIPTPANFIRPGKRMLSSMCPIIVTHPDGSLFFVTGAAGGSRIITATVQSVINVIDRKLNASRALEEPRLHDQLVPNLTLFEWAFDNSTVEFMAERGHNVTPVAPGFSSVQCIQVLGNTFEAVGEPR........ 607
381 3.000e-90UniRef50_A0A1L8E275 Putative gamma-glutamyltransferase (Fragment) n=17 Tax=Nematocera TaxID=7148 RepID=A0A1L8E275_9DIPT  ali  37  353LTNPDFAHYIRTLIDDDTTYNTEHYGAEFTNVEDHGTAHVSILAPNGDAVAATGTINYIFGAMRRSQSTGIILNDEMDDFSIPGKDNVYGIPPSPANPIAPRKTPMSSMCPAILIDNEGNARMIVGGAGGSKITTSVSYLIMRHLLFKEDLIDAMNAKRIHHQLAPMRIDFENGFSEEVLHGFMQRNHDLNEVSPGFAALTAISFDGAKLEAVFDPRRNGSPS.. 579
382 3.000e-90UniRef50_UPI0008112ED2 gamma-glutamyltranspeptidase 1-like n=1 Tax=Rhagoletis zephyria TaxID=28612 RepID=UPI0008112ED2  ali  41  312LTSDAFINHIIKEINDEKTFPSSYYDAKMYNGMDKGTAHVAVLDGQGNAVTVTSTVNLYFGSKVLSPSTGIILNDEMDDFNI-GTKNEFDLPASFANIIQPGKRPLSSMSPAIFTDDTG-IRLVIGASGGPKILTSVAYTALRQLWFGDNIKQAIDSCRVHDQLFPEKVTYEPCFPETILRSMKQRKHNTTELPVGGAVVMGIARRNNSIEANSDYRKGGTVA.. 538
383 3.000e-90UniRef50_UPI000C77B13D glutathione hydrolase 2-like isoform X1 n=3 Tax=Eurytemora affinis TaxID=88015 RepID=UPI000C77B13D  ali  35  445LSSHHHTMKIKEKINDFQTQDPEFYGAKTTFEEDHGTCHHCFLSPQGDAISVTASVNLIWGCKFMSPSTGIIMNNQMDDFASPNITSAYNVPPAPNNFIYPGKRPMSSMSTTIVVDDQGRVVAVAGASGGTKIISATAQVLMNVLYLGKDVKEAVDARRLHHQLFPMNLNYEDGTTTWIIDALKGYGHNMTYSKYRVGGVQAIVVDPGSITANADFRKRGAVDGF 674
384 3.000e-90UniRef50_A0A1B2J5K4 BA75_00597T0 n=5 Tax=Saccharomycetales TaxID=4892 RepID=A0A1B2J5K4_PICPA  ali  38  397..SDEWAIETHAKINDSYTLPSKDYAPAFLPNDPHGTSHFSIVDQYGNAVAMTTTVNLGFGSKIHDPVSGVILNDEMDDFSVPTSSNAFGLHPSIYNWVEPYKRPLSSCAPTIIVDSSGVPHFVIGAAGGSKITTTILQAIIRVYHYHLDLLDVIAYPRFHHQLLPEEVLLEFPRDNKLIRHLKERGHDVRVQAP-ISTMNGILRKSGSLIAVSDWRKLGRPWGF 621
385 3.000e-90UniRef50_A0A2H5ZML5 Gamma-glutamyltranspeptidase n=1 Tax=bacterium HR30 TaxID=2035425 RepID=A0A2H5ZML5_9BACT  ali  35  336LLDPNLTASLRRRILSTRTLPIEEYGSHLAPPSDAGTAHLSVMDSEGNAVACTTTINTSFGAMLVAGSTGILLNNQIDDFAIPNVPNAYGLVGNAANAVAPGKRPLSSMAPTVVLEGD-RAVAAVGGSGGPMIISGTLQVLLNVLAFGFGAEHAVAAPRIHHQWQPPVLLVEPQIDPKARNVLERVGHTVREVPEM-GAIQLVRRMSSGFEGAADPRKGGGAKGW 563
386 3.000e-90UniRef50_A0A2E0UMB6 Gamma-glutamyltransferase n=1 Tax=Ectothiorhodospiraceae bacterium TaxID=2026737 RepID=A0A2E0UMB6_9GAMM  ali  28  359LISKEYAQAKARSISMTVATPSEQIGEKQLIREGMNTTHYSVADKFGNVVSVTTTINSTLGSKLVVDGAGFLLNNEMDDFSIPGIPNQYGLVEGDANAIEPGKRMLSSMTPTVVL-RNEKPVMVAGSPGGPTIITAVLQVILNILEHNMLASDAAAAKRIHHQWVPDQIRYESGLTANTQQSLQEKGHILREVSEM-GRIDLIVLDPGMKYGCSDPRGYGAALGY 585
387 4.000e-90UniRef50_A0A0K0FYS7 Uncharacterized protein n=1 Tax=Strongyloides venezuelensis TaxID=75913 RepID=A0A0K0FYS7_9BILA  ali  39  112LTDRKYYRSIAKKIK-NISQPVEYYSSNTSQVSDHGTSHVTVLDEDGNGVSCTSTTNHYFGSVRASSKLGIIWNNQMDDFSTPGVTNDFGYVPSPSNFIKPGKRPMSSMSPTIIYHKSGDIKMVVGASGGSFIISATAQVIIRNMLFNQTVKEAVDAPRFHNQYLPYLTAYEYSSPNKLIEILEKFKQNMSGLEKQASVVQVLKRDDGYIYGNSDFRRKTYPTGY 341
388 4.000e-90UniRef50_A0A1J1HT73 CLUMA_CG004935, isoform A n=1 Tax=Clunio marinus TaxID=568069 RepID=A0A1J1HT73_9DIPT  ali  39  371LTSLEYAREIRKKIDDKKTHEIGYYGSHFATPDDHGTAQISVLAPNGDAISVTGTINYILGSLRRS-KTGIILNDEMDDFSTPGLNNIYGIPPSESNYIAPGKRPISSMAPSIILQPDGRVSMVIGSAGGSKITTAIANTIIQYYYMKLNIKDMFALKRLHHQLIPNAVIYEDGFDKAIIDGLIAKNHTMKNVTSTIGALVGILVEDDVVTGAFDPRRGGSVA.. 597
389 4.000e-90UniRef50_A0A1I8PLR5 Uncharacterized protein n=2 Tax=Stomoxys calcitrans TaxID=35570 RepID=A0A1I8PLR5_STOCA  ali  34  377LLSPEYAKNISHLIDDQKSYDLAHYGAKEDSTPDYGTAQISVLGPNGDAVSATSSINYYFGSGRMGSRTGILFNNAMSDFTIEGQQNYFNLPNFHNNYVEAHRQPMSSMVPLIVTHKSGETRLVTGAAGGTRIISTLVQILIRSLWMNKNIKQAIDYARFHHQLLPNVLEYEFGVLQEVVEDLESRGHATERVRHKNTAVCGVEMVKGAILANVDYRKEGGVDGF 606
390 4.000e-90UniRef50_D7W6H7 Gamma-glutamyltransferase n=167 Tax=root TaxID=1 RepID=D7W6H7_9FLAO  ali  31  337LISDEYLKGRWKNFSFDKATPSAEVGKIIEQPESMQTTHISVLDKDGNAASVTTTLNGYYGSKVLVSGAGFFLNNEMDDFSIPGVPNMFGAVGGEANSIQPNKRMLSSMTPTILL-KGGKPYMVVGTPGGTTIPTSVYQSIVNVVDFKLNANLSVNAPKFHHQWLPETITVENNFPESTISELKSKNYVIEKTK-YIGKTEIIVLDNGNIHAVADGRGDDSVA.. 560
391 5.000e-90UniRef50_UPI0008F9BAF4 gamma-glutamyltranspeptidase 1-like isoform X1 n=5 Tax=Hemiptera TaxID=7524 RepID=UPI0008F9BAF4  ali  40  385LQSDEYANETFHQIRDDKTFDPQHYGATLASKDDAGTAHISILAPNGDAVSVTSTVNLYFGAQVTSSQTGILLNSGMDDFSTPGLINYFKLPPVPTNFIEPGKRSISSTSPSIIVSDNGDVRMVIGASGGTKIPTALAQVIMRHLWMDLGIKAAIDAPRLHNQLIPMNVTYEEGVSEEILKGLEALGHVMEKRPYRDSVVCAIVRLGDDIVANADYIKKGIAAG. 609
392 5.000e-90UniRef50_Q9M0G0 Glutathione hydrolase 3 n=212 Tax=Magnoliophyta TaxID=3398 RepID=GAGT3_ARATH  ali  36  382MLSKAHAEEIQKRIFDNTTFPPEYYMNRWSQLRDQGTSHFCVVDADRNSVSMTSTVNYRFGAGVLSPSTGIVLNNEMDDFSTPTEITPDMLPPAPTNFIEPNKRPLSSMTP-LVITKDGEFVAALGGAGGMHIIPAVLQVFLNCFVLNMKPKEAVESARIYHRLIPNVVSYENGVSEDTKMFLAERGHELKELSGG-AIVQLIVQSKGLLTAVSDPRKDGKPAA. 636
393 5.000e-90UniRef50_A0A2E6D5W1 Gamma-glutamyltransferase n=5 Tax=Planctomycetes bacterium TaxID=2026780 RepID=A0A2E6D5W1_9BACT  ali  33  379LLSPAWIAERRVSIGERARPDVQPL--VVAGEESAETTHLSVVDRAGNAVSLTTTLNASFGSGILVPEAGFLLNNELDDFSIPGTPNMFGLVGGQANQLMPGKRPLSSMSPTVVRNGAGQVTLVIGAPGGPRIITSVTQVILRVLGYGQSLEEAVSAPRIHQQWVPAKTRLEPGWDEQLVEGIRDHGQEVERARAWFGSVQAIHVPGGTVSAVSDPRRGGVA... 602
394 6.000e-90UniRef50_A0A0K8WBE5 Gamma-glutamyltranspeptidase 1 n=7 Tax=Schizophora TaxID=43738 RepID=A0A0K8WBE5_BACLA  ali  37  358LTNSSYARHLAYLIDEERTFDATSYGASESLVTEHGTAHISVMAPNGDAAAATSSINFYFGSGKIGARSGILFNNAMSDFTIEGLQNYFDLPNMPYNSIKPGVSPMSSMSPIIVTDQHGVVRLVTGAAGGTKIISVLVHILVRILWLEQNIKQAIDAPRFHHQLEPNILEYEYGILQNVVKALEAKGHRTKRYRERGSAVCGIEKVRGQIFANADYRKEGDVRGF 586
395 6.000e-90UniRef50_UPI000C6C9B2D glutathione hydrolase 1 proenzyme-like isoform X1 n=4 Tax=Centruroides sculpturatus TaxID=218467 RepID=UPI000C6C9B2D  ali  35  374LLDKKFAETIRAKIQDDRAMDTNYYGGNSESNYGSG--HVSVVAPNGDAVSVTSSINHYFGCKRVSPSTGIVLNNHMDAFSSPSVSDSFVFSPNKRNQIMPGKKPMSYMSPTIILDDKRKVWLVIGGGGGPRINTGIALVTMQLLWLNKNVKEAIDMPRVHHQLFPDYISYENNFPEAILRKLEEMGQKTKEKEDIMSVIMAIHRKSGMWHSNADFRQNGKSDGF 605
396 6.000e-90UniRef50_I1S273 Uncharacterized protein n=62 Tax=leotiomyceta TaxID=716546 RepID=I1S273_GIBZE  ali  36  337MLNHTTAEKIREKIDPWTTQDIEKYDPGIYSSEGHGTSHVVTADRDGMAVSLTTTVNLIFGSLLMDNLTGVILNNEMNDFSIPGVPNEFGFAPAEANFVRPNKRPLSSCTPIIVSNKDGSLFAVIGAAGGSRIISATTQVAWRVLW---SIEDAVREPRVHNQLMPNTLLVEKKFSSYDVPSLKERGHNITWVDEGLSSVQALVRDDGVFEIAAEPR........ 556
397 6.000e-90UniRef50_W8EXW0 Gamma-glutamyltransferase n=23 Tax=Hymenobacteraceae TaxID=1853232 RepID=W8EXW0_9BACT  ali  28  390LLEKDYNWRRMATTLPYRATPSAQVGANLPGYESDQTTHYNVVDAQGNAVSCTTTLNGAYGSKVVVAGAGFLLNNEMDDFSSPGTPNSYGLVGGAANAIAPGKRMLSSMTPAILT-RGKKLALVTGTPGGSTIITSVLQSILNVVDYGMNAQQAVAAPRLHHQWLPDQLDVEAGLLPAAQDTLRARGYILNPRNAW-GRVEIIRVPDGRLEGGADPRGDDAAAGY 617
398 7.000e-90UniRef50_Q1IHQ1 Gamma-glutamyltransferase 1 n=23 Tax=root TaxID=1 RepID=Q1IHQ1_KORVE  ali  32  338LIDKHYGVAWRKSIDEQHATPSNEVKPATNVYEPEDTTHYSVVDNAGNAVAVTTTLNGGFGNYVTVSGLGFLLNNEMDDFSSPGVPNQYGLIQGEANAIGPGKRPLSAMTPTIVL-KDGKLFMVLGSPGGPRIITTVANILMGVVDYGLNIQQSVNAPRYHNQWLPDLEYLEPGFSPDTRAALVKMGHHIAKEEGYWSDGECILVDPGERQGASDGRNNGHAVGY 583
399 7.000e-90UniRef50_Q9I406 Glutathione hydrolase proenzyme n=1096 Tax=cellular organisms TaxID=131567 RepID=GGT_PSEAE  ali  30  331LTDPAYLKQRAAEVNPTAISPTEKVRPG---LEPHQTTHFSIVDADGNAVSNTYTLNWDFGSGVVVKGAGFLLNDEMDDFSKPGVANAFGVVGSDANAIEPGKRMLSSMSPSIVT-RDGKVSLVVGTPGGSRIFTSIFQVLNNIYDFHLPLEKAVAAQRVHHQLLPDTIYYDAYAPGKVAEELKAMGYTLEDQGWNMGDIQAIRVDGKALETASDPRGRGV.... 551
400 8.000e-90UniRef50_A0A1B0D2V9 Uncharacterized protein n=4 Tax=Diptera TaxID=7147 RepID=A0A1B0D2V9_PHLPP  ali  37  362LTNPNFADYISGLIDDSKTYDYQHYGADFSNVEDHGTAHISVLAPNGDAVAATSTVNYIFGAMRRSPSTGIILNDEMDDFSIPGKDNVYGIPSSPSNYISPRKTPMSSMCPAIIVDHQGNVRMIVGGAGGSKITTSVGYLIMRHLLFDEDVYDAMHAKRLHHQLAPMRVDFENGLSEEIIQGLIERNHSMYEVSPGFAALTAISSDAKRVEGVYDPRRNGSV... 588
401 8.000e-90UniRef50_UPI0004574A52 gamma-glutamyltranspeptidase 1-like n=2 Tax=Callorhinchus milii TaxID=7868 RepID=UPI0004574A52  ali  47  357LNSDLFAGAIKDRITDDTTHDEDYYGLPVTVPNTHGTTHLSVVAEDGSAVSVSSSINKYFGSNIRSRVSGIIFNNQMADFSV--------LDGSGKNIVQPGKRPLSSMCPSIIIDENKEVKMVIGASGGRKIITATALVIMNAFWFGDNLMEAVEKPRVHHHLVSNKAELEAKIDQVIRDGLLQRNHELTNY-TYSSTVQVIMKKDGKWVAKSDSRKGGYPAGY 574
402 8.000e-90UniRef50_A0A2N1VSM4 Gamma-glutamyltransferase n=1 Tax=Ignavibacteriae bacterium HGW-Ignavibacteriae-2 TaxID=2013809 RepID=A0A2N1VSM4_9BACT  ali  29  339LTSKEYGKIIASGF-ENYAVPSKEIKPVLPEYESKETTHFCVLDEEGNAVSLTTTINGLFGNKVVVEGAGFFLNNEMDDFSAPNVPNSDGLLGSVANSIQPGKRMLSSMTPTIVL-KDNKPVLIVGARGGSTIITTVLQIVMNVLQFDMNIQEAIDLPRFHHQWSPDRIDYEDGLSEDLKMKLSAKGEIIGRLRE-LGMATGIQVDKNIIYGAPDKRGDGKALGY 565
403 1.000e-89UniRef50_A0A1M6WP02 Gamma-glutamyltransferase 1 Threonine peptidase. MEROPS family T03 n=2 Tax=Bradyrhizobiaceae TaxID=41294 RepID=A0A1M6WP02_9BRAD :  ali  30  360LIDKGYAAKIRDTIKPDRAGISGDIRQGVAPHEGSNTTHFSIIDDAGNAVSMTVTLNDWFGAKVVASGTGVLMNDEMDDFSNPGAANSYGFVQGDANAIVPGKTPRSSMTPTIMT-RDGKPVLILGTPGGSRIITTVLQTILNVVDFQMNIQEAVDVPRIHHQWMPDVTNMEYALSPDTSKVLESMGHRFENSEP-TNHVAAILIGRNRFYGANDPRGGGQALGY 595
404 1.000e-89UniRef50_A0A2E5UEM8 Gamma-glutamyltransferase n=1 Tax=Phycisphaerae bacterium TaxID=2026778 RepID=A0A2E5UEM8_9BACT  ali  35  314.LSESYLXELAQSXDRERTKETTEYGSQVXLPDDSGTSHICVADLDGMVVAMTETINTYFGSKVIVEPYDFVLNNEMDDFSSPKGANTYGLVQSEKNLPEHGKRPLSSMTXVIVLDGEKPVFLV-GASGGPRIISSVLQVLIHHLWYGMSPVDAITKERLHHQWSPNVLYVESRLP---LNELKERGHEIKTRRD-IGIVQAIAIEGSIQRPASDPRKGGKPAG. 535
405 1.000e-89UniRef50_A0A2D6EL81 Gamma-glutamyltransferase n=2 Tax=Magnetococcales bacterium TaxID=2026759 RepID=A0A2D6EL81_9PROT  ali  26  360LMSDLYAIRTAKGISMASATPSELVGGKFLPDESPQTTHFTIVDKWGNVVTNTYTLNFSYGSGHMVAGTGILLNNEMDDFSKVGVANAYGLIGNEKNAIEPEKRPLSSMTPTLVFDADDQFYMALGSPGGSRIITSVLNVLMNVIDHNMNLAEAITAPRMHHQYMPDKVQVEKGFSLDTLKLLNHKGHTVEEVAPM-GAVMAVKRAPKGYVAFADTRR....... 581
406 1.000e-89UniRef50_E9E104 Uncharacterized protein n=1 Tax=Metarhizium acridum (strain CQMa 102) TaxID=655827 RepID=E9E104_METAQ  ali  39  364LLDEVHAKHTRERISDKQTLPVKEYDPGVELPESHGTSHIVTADESGMATSLTTTVNLLFGAQIMEPSSGIILNNEMNDFSIPGVPNEFGFQPSVANFIRPGKRPLSSVTPVIAAFPDGKLFATVGAAGGSRIISSTTSALWRTIEHGMTMKEALREPRLHDQVMPNTLLLEYGFDAETAAGLRERKHNITWVRPGLSAVQGIRRGDGLFEAASEPR........ 602
407 1.000e-89UniRef50_T1HY76 Uncharacterized protein (Fragment) (Fragment) n=9 Tax=Panheteroptera TaxID=33351 RepID=T1HY76_RHOPR  ali  41  346MTSEDYIKDVRRKVGMSRTNNNTKYGGRYFVPNDNGTINVVVLAPNGDAVCATSTINTLFGSLLASSSTGIILNNEMDDFCAPEIVNSFGLPPSPSNFIAGGKRPLSSSCPSVIVGPNKEARLVVGAAGGTHITSATAQVIINNLWLQQTIKQSVDIPRVHHQLIPMVLKFEYGIPKSVVDGLIKAGHKVKKQSPH-SSVTAIEQRNGGVRAIYDYRRGGSTSG. 570
408 1.000e-89UniRef50_A0A2M8JYP6 Gamma-glutamyltransferase n=16 Tax=Bacteria TaxID=2 RepID=A0A2M8JYP6_9BACT  ali  30  337MISDAYLAQRMSDYIPNKAGSSKEINAG-KISESEETTHLSVVDGAGNIVSVTTTLNGSYGSKVVVGGAGFLLNNEMDDFSVPGVPNMFGAVGGEANAIAPGKRMLSSMTPTLVM-KNKKPYIVIGTPGGTTIPTSVYQALVNVIDFNMKLGDAIDLPKFHHQWLPDEVMIETNFNPKTKEALQKMGYILKDRSS-IGRTDGIRIPNKTREAAADRRGDDSVAGF 560
409 1.000e-89UniRef50_UPI000BA83405 gamma-glutamyltranspeptidase 1-like isoform X1 n=2 Tax=Limulus polyphemus TaxID=6850 RepID=UPI000BA83405  ali  42  366LTSKEFAEEILQKIDDDQTFEPSYYGVETFLSEDEGTSHVSIVAPNGDAVAVTSTINTYFGSKRASPSTGVVFNNEMDDFSSPGISNKYGIPPSKFNTISPGKRPLSSMSPTIIVDNKGDVKXXXXXXXXXXXXXXXXXXXXNTLWAGKNIKEAIDYPRVHHQLLPNVLMSEPNFSEEILYGLKKFGHKLQGFPAGYSNIMAITRGDGNLYSNSDYRKKGDTDGF 592
410 1.000e-89UniRef50_A0A2H3EBW3 Gamma-glutamyltranspeptidase n=2 Tax=Diplocarpon rosae TaxID=946125 RepID=A0A2H3EBW3_9HELO  ali  38  391MLKPSTASHIRDRISDHHTHNVTDYNAGFELPENHGTSHIVTADWCGMSVSLTSTVNILFGSQLVVPETGVIMNDQMNDFSIPGVRNAFGFEPSPINFIAPQKRPLSSISPIIATYPNGTLALSIGAAGGSRIITATALAIWDVLERGMSLAEALAEPRMHDQLVPAMTTVEYAFEQSTVKALIQMGHNVTFVKPGFSAVQGVRRWNGTFEAASEPR........ 609
411 1.000e-89UniRef50_UPI000A2A7288 gamma-glutamyltranspeptidase 1-like n=2 Tax=Exaiptasia pallida TaxID=1720309 RepID=UPI000A2A7288  ali  43  334MIDLNFAESTRQKINDNKTYNNASYYGGFFAEDSGSTTHASILAPNGDAVAITSTINLYFGSKFRSRVTGIIMNNQMDDFSTPGEKNFFGVPPSPANYIKPKKRPFSSSSPIVILNKNGAVRMATGASGGTTITTSTALAVINYLWFGRTLSQAVDDPRVHHQLIPMYVLRDAQFDPEIVDGLKRLGHTFSDKN-FTAVVQAVAKDDGLLYGKSDPRKGGHSAGF 560
412 2.000e-89UniRef50_A0A267G2V4 Uncharacterized protein (Fragment) n=1 Tax=Macrostomum lignano TaxID=282301 RepID=A0A267G2V4_9PLAT  ali  43  154MTSSSYASELRSRITDDTTHDVNYYGPMFEWKEDSGTTHVSLVDSDGNAISITSTINTYFGSLIRGVRTGIFYNNEMDDFSQPNKTNYFGLPASPTNFIAANKRPMSSMAPVIVVNADGDVQFVSGAAGGSRITTAVAYTLARQLYLNETVKAAVDSYRLHHQLVPNVLNYNPDAPEIIKEELRRKGHKLKPFRRISA........................... 354
413 2.000e-89UniRef50_A0A192X028 Uncharacterized protein n=1 Tax=Acidobacteria bacterium Mor1 TaxID=1660251 RepID=A0A192X028_9BACT  ali  29  338LLDPAYLRLRAADISMDEATPSEKVAPGEPAVESRQTLHFSVADRDGGAIAMTTTLNGPLGTGMVGEGTGVLLNNEIDDFAAQGVANTWGLLGGEANAVKGNKRPLSSMTPTLLEQQEGKLRMVLGSPGGGKIITSVLQVLLNYVDHDMHAQAAVNAPRFHHQWHPDELMLEPGFVHDVIQALEKRGHRVTVQRGMFGNVNAIEAEDGGWIGAPDPRRESRAAG. 568
414 2.000e-89UniRef50_A0A2G2MQD2 Gamma-glutamyltransferase n=10 Tax=Proteobacteria TaxID=1224 RepID=A0A2G2MQD2_9RHOB  ali  30  356LTDKSYATRLRGTIDRGKASRSEDILPGYLVKESPDTTHYSVMDKWGNGASVTTTLNFSFGGGYSVDGAGFLLNNEMDDFSKPGAPNGFGLIGGVANKIEPGKRPLSSMTPVII-KKDGXPYFVTGSPGGSTIITVVLQNILNVIDFDMNAMEAVTTPRIHHQWLPDIVITEPGISADTVRILEERGFNFKYKRTTLGRANAIKQKRGYLYGAADPRSPSGAAG. 587
415 2.000e-89UniRef50_A0A142WVQ4 Gamma-glutamyltranspeptidase n=12 Tax=Planctomycetales TaxID=112 RepID=A0A142WVQ4_9PLAN  ali  35  344LLEPARLERLAGRIDPAGTKPPGTYG-RFEPPRDGGTSHFSVMDREGNAVACTETINLTYGSFVVVPEYGVVLNNEMDDFAVPGKPNAFGLIQSAGNAVAPGKKPLSSMSPTLVFRKEENPVAALGASGGPRIITTTLQVLLNVTAFELSPTEAVVAPRFHHQWMPDELLLEPGLFEGSAGALEGLRHK-AIRRGRLAVGQLVVRGKEGLWGVSDPRKHGAPAGW 568
416 2.000e-89UniRef50_A0A076NS95 Gamma-glutamyltranspeptidase n=746 Tax=root TaxID=1 RepID=A0A076NS95_FLAPS  ali  28  333LSDSDYLKNRMSNFSLEKATLSSDIQGKINFNESTETTHYSIVDSFGNAVSATTTLNDNYGSKLYCKELGFFLNNQMDDFSIAGTPNLYGLIGGKANSIAPQKRMLSSMTPTIVE-KDNKLFMVVGTPGGSTIITSVLQTILNVSQFNLTMQEAVNAPRFHHQWVPDVVTFEPGFPKDTLDALKQKGYLINEKNPIIGKVDAILIPNGNIEGGADKRGDDKAVGF 561
417 2.000e-89UniRef50_A0A061DI76 Gamma-glutamyl transpeptidase 1 isoform 2 n=12 Tax=Pentapetalae TaxID=1437201 RepID=A0A061DI76_THECC  ali  38  352MLSPKFAEELKKTIYDNMTFGPGHYGGRWNQIHDHGTSHVAIVDIKRNAVSMTNTVNAYFGSKILSPSTGIVLNNEMDDFSMPTNSSGNTPPPAPPNFVRPGKRPLSSMTPTIVL-KDERLSGVVGASGGANIIAGTAGVFLNHFARGMDPLSSVMAPRIYHQLIPNVVTYENWVPAHIRRDLQKKGHVLRGLAGGT-ICQFIVKGNGGLVAVSDPRKGGFPAGF 589
418 2.000e-89UniRef50_R4XHI3 Uncharacterized protein n=1 Tax=Taphrina deformans (strain PYCC 5710 / ATCC 11124 / CBS 356.35 / IMI 108563 / JCM 9778 / NBRC 8474) T  ali  36  377LQDKHFAASCAANISESQTFDWEHYNPKYDFTEDHGTTSLSVIDAEGNAVSITTTVNLIFGSGLMDPVTGIILNDEMDDHSIPGVTNAFGLRPSVLNYIEAGKRSMSSQTPTVVTR--GNELLTLGGSGGSRIVTAILDAIVKRYDWSFDLFETIRQPRVHHQLLPNVVSAESTLDGRVKAGLLERGHVLELYSMGLSEIQAVEKKAGLVSAMSDARKRGQAAAY 601
419 2.000e-89UniRef50_A0A182I7B4 Uncharacterized protein n=6 Tax=Cellia TaxID=44534 RepID=A0A182I7B4_ANOAR  ali  40  361LASKTYARYISETIQNDRTHEYAHYGAEFSNERDQGTAHVSILAPNGDAVAVTSTINSVLGAMIRSPSTGIVLNDEMDDFSTPGLINSYGLPASPANFIVPGKRPLSSMTPTIVTDDTGDVRIVAGSAGGSRITTATMQLIVRHLLFGETLGTIIRAPRMHHQLAPMSIEYEKGFDPVVIAGLEARGHVCVQSDGGFAALTAIVRHARGIEATYDPRRSGS.... 590
420 3.000e-89UniRef50_A0A2D7G7H6 Gamma-glutamyltransferase n=10 Tax=Bacteria TaxID=2 RepID=A0A2D7G7H6_9GAMM  ali  25  363LTSKDYARERFADFDPNKASVSADIFAGVAAREGLETTHVSVIDAMGNAVAYTTTLNLSYGSKIVVNGAGFLLNNEMDDFSKENSPNAFGLLGRKANAIEPGKRMLSSMTPTIVL-KNEKPLLVTGSPGGSTIITTVLQIVSNVIDHEMNLAEAVSAARFHHQWQPDRVIHEKTFSDTTKVELAKMGHNLNEVPAFYGGGNSVLSTDVGFQGMADPRNXGXAXG. 592
421 3.000e-89UniRef50_A0A2E6QU82 Gamma-glutamyltransferase n=1 Tax=Flavobacteriales bacterium TaxID=2021391 RepID=A0A2E6QU82_9FLAO  ali  28  329LLNFDYNQDRAKKIKLKKATPSNKINGEFKKLESEETTHFSITDKYGNAVSVTTTLNTNYGSKVFVNKYGFLLNNEMDDFSSPGHPNVYGLLGSDANAIEPEKRMLSSMTPTILE-KNNNLFLVLGTPGGSTIITSVFQTILNVILFKMPIQDAVDAPRFHHQWMPDNIYVEKVYTDSLVNPLNAIGHNIKERSS-IGHVNAILYNQNSISTGADHRGD...... 548
422 4.000e-89UniRef50_A0A2T7PHA4 Uncharacterized protein n=3 Tax=Pomacea canaliculata TaxID=400727 RepID=A0A2T7PHA4_POMCA  ali  42  386MTSPEVGQEIRAKISDDHTHDIPYYEPSFFNKNEQGTSHLSVLDGEGNAVAITTTINLQFGSKMIGYRTGIIFNNEMDDFSTPNTINAFGVPASPANFIQPGKRPLSSMSPSVFVDSKQER-------------SNWWLTAIRTLWLNNSLVEAVEDSRVHHQLFPPEIHVDPGFPKDVQDGLVAKGHRI--ATHIGSKVQAILKDGSRLYAVSDWRKGGAPDGY 595
423 4.000e-89UniRef50_A0A2E6ZUU2 Gamma-glutamyltransferase n=6 Tax=Bacteria TaxID=2 RepID=A0A2E6ZUU2_9BACT  ali  32  345LISKEYAEELRKTINLDRASVSSPSSFEWP-TEGDETTHVSTVDAERNAVSLTYTLEQGYGSKITVPGAGFLLNNEMGDFNAPGMTTETGLIGTGPNLAEPGKRMLSSMTPTIV-ARDGNLLMVTGSPGGRTIINTVLLTLVNVIDFGMNIQEAVDAPRLHHQWLPDETRYERGLSPDTLALLRARGHQMVETR-VQGAVSAIYHDNDMLEGAEDRRRTSAAVGF 570
424 4.000e-89UniRef50_A0A2D9SLQ1 Gamma-glutamyltransferase n=14 Tax=Gammaproteobacteria TaxID=1236 RepID=A0A2D9SLQ1_9GAMM  ali  34  346LITEDYIKRRAAQVS---ATTISELKGVSPGLESPNTTHYSIVDARGNAVSNTYTINWSYGSGVVVEGAGFLLNNEMDDFSKPGVPNIFGVVGDQANEIQPGKRMLSSMSPTILL-KDGGVEMVLGTPGGSTIFTSVFQVIVNILDFNMSPYEAVAATRFHHQLLPADLITYNGFPEEIIAALADKGYRTTPHGYEYGDVQIVMKQGDSWIAASDPRDRG..... 568
425 5.000e-89UniRef50_A0A0A2J932 DNA glycosylase n=2 Tax=Penicillium TaxID=5073 RepID=A0A0A2J932_PENEN  ali  36  354ILEQSTIDDIRSKISDVRTQNVSAYDPGLESLDTPGTSHIAVADHTGLAISVITTINLLFGSQVMVPETGIIMNNEMNDFSIPGSSNSFGYIPSPSNYIRPGKRPLSSITPAIVERPNGKLFLIAGSAGGSRIITATVQSIIHSIDQGLSAAKALAKPRLHDQLVPNQVSFEYTYDNATVASMKARGHNVTWVAPGQSSAQLIRVPNGTFDAAGEPR........ 572
426 7.000e-89UniRef50_UPI0006B109E0 gamma-glutamyltransferase light chain 1-like n=2 Tax=Limulus polyphemus TaxID=6850 RepID=UPI0006B109E0  ali  37  2..........RQRIDDYQTFKPIHYGIKTFLSTDEGASHLSIFAPNGDVVGVSTSINSHFGSKRASLSTGIIFNNAMNIFSSPNNRSRHGLPPAEYSTVSPGKRPLSSMCPTIVIDGDGNVRLVIGGTGGVKIITGAALVSVLNLWAGKSIKEAVYSPRAHHQLLPDIVEYESGFSQEVLQGLQQKGHDVEEMGSFSSVIMGIVRDKDELYASADYRRGGATDGF 216
427 7.000e-89UniRef50_A0A1H9PV69 Gamma-glutamyltranspeptidase n=2 Tax=Gammaproteobacteria TaxID=1236 RepID=A0A1H9PV69_9PSED  ali  30  29LTDHVYLVQRAHEVNPNAISPTEHIKAG---LESHQTTHFSIVDSKGNAVSNTYTLNWDYGSGVVVKGAGFLMNDEMDDFSKPGVANAFGVVGGDANAIEPGKRMLSSMSPSLVT-RDGAVTLVLGTPGGSRIFTTVFQVLNNLYDFHMPLKDAVAAARVHHQLLPDTIFTEKPLPTPVVEELETMGYTLKDQGWSMGNVQAIKIDGTKVETASDPRGRGV.... 249
428 8.000e-89UniRef50_UPI000C1CFA3A glutathione hydrolase 1-like isoform X1 n=3 Tax=Olea europaea var. sylvestris TaxID=158386 RepID=UPI000C1CFA3A  ali  39  363MLSTKFAAKLKKTIFDNMTFNASHYGGKWNQIHDHGTSHISIVDGKRNAVSMTTTVNSYFGSKFLSPTTGILLNNEMDDFSMPAKNLKNVPPPAPANFIYPGKRPLSSMNPIIVL-KGKKLKAVIGASGGSFIIAGTTEVFLNYFAREMDPFSSVMAPRSYDQLIPNVLQYENWVSETTREALKRKGHVLQSLAGGT-ICQFIVLEEGKLVAVSDPRKGGFPAGY 600
429 8.000e-89UniRef50_A9FZ92 Gamma-glutamyltranferase n=20 Tax=Bacteria TaxID=2 RepID=A9FZ92_SORC5  ali  35  378LLSVAWAEKQRATIAADRATPTDELARGAAVKDSGGTTHFSVVDAQGNAVALTTTLNGWYGSGVTVTGAGFVLNNEMDDFATPGTPNQFGLVQGEANSIAPGKRMLSSMSPTIVTGKDGRVELVLGAAGGPTILTAVFQILSNVVDFGFDVTTGVNAPRFHHQDYPDKLFVEQGFPDELRSALGAMGHTLDDRGH-IADAPSIGREGAAFAGAREPRRPGAAAG. 608
430 9.000e-89UniRef50_UPI0009D6A3F5 gamma-glutamyltranspeptidase 2-like n=4 Tax=Sesamum indicum TaxID=4182 RepID=UPI0009D6A3F5  ali  34  342MISDNTAENLRKLIDDNKTFDPPHYGSKWSQLNDHGTSHICIVDRQRNVVTMTTSINTHFGSRFMSPSTGIFLNNQMHDFSIPTSKVR---PGAPSNYVGPFKRPLSSMAPAILE-KGGRVRAVVGSAGGLLIPDAVSQVLINFFVLKKPSYNAVKAPRFYHRLYPNVLLHEYAFSVRTLNELKRKGHQLKRAASVMTVCQFVVKNSGQLIAVSDPRKGGFPAGY 576
431 1.000e-88UniRef50_T1ESM8 Uncharacterized protein n=2 Tax=Helobdella robusta TaxID=6412 RepID=T1ESM8_HELRO  ali  37  365MISKEFAEFIRAKIDDRKTFNTTHYNNSYNQFEDHGTSHVSVYGPDGSAVAMTSTINTGFGSLVKGSKTGILYNNEMDDFSSPFQQNYYGYVPSPTNYIQSGKIPMSSTSPSFLMDSQGNVKYVFGAEGGSRIITALAGVAVGALWGNETLNQSVDRARVHHQLLPDRILYEDWISQMHIDGLKSKGHEVISPEGWTAVCNIIKINEDCIESVADGRKGGEPDG. 594
432 1.000e-88UniRef50_A0A2B4S5M9 Gamma-glutamyltranspeptidase 1 n=1 Tax=Stylophora pistillata TaxID=50429 RepID=A0A2B4S5M9_STYPI  ali  39  351MTNQTFAEFLRQKIWDNQTHSNASYYGKFQFERDHGTSHLSVLSPDGDAVALTSTINYYFGCKFRSTLTGIVYNNEMGDFSTPDHLNPDEIKPSKSNYIKPGKRPQSSISPVIFTDGSGRVKLVAGASGGPHITTAVSLTVVNQLWLSRGISNAVNDPRVHHQLFPNTVIIEYTIPLGIQDGLRARKHNVT-MESEFAAVQAIRKKDEEIFGKSDPRKYGWPDGF 578
433 1.000e-88UniRef50_Q6CC93 YALI0C11363p n=2 Tax=Yarrowia lipolytica TaxID=4952 RepID=Q6CC93_YARLI  ali  36  432LLTQDWTDKAVNNISDYHTRPWEDYQPAYEVSDSAGTAHFSVLDENGMAVSMTTTVNLLFGSLVYDHVTGVILNSEMDDFSIPSRDNAYELRPSIYNYIAPGKRPLSSTTPTIVYNKKDHVELVLGAAGGSRIVTCVLQAIVRKYSYGLSLLQTVAFPRLHHQLIPEIAYVEIGGRKSIGQALKARGHGVEYWIPR-SVMNAVSRDNGEIHAVADWRKGGGSDGY 658
434 1.000e-88UniRef50_A0A136PHL4 Gamma-glutamyltransferase (Fragment) n=1 Tax=Chlorobi bacterium OLB7 TaxID=1619898 RepID=A0A136PHL4_9BACT  ali  33  203LTSQEYAAARAANITP-RATPSSHGDPKAFQRESQQTTHYSVVDRHGNCVSVTTTLNSAFGSKLVVGGAGFFLNNEMDDFSAPNTPNQFGLIGRSANAIQPGKRMLSSMTPTIVL-RDGKPWMVVGTPGGSTIITTVLQMIHSQIDYGMDLAAAGNAPRIHHQWLPDTLFHERGFTAGAADSLRAMGHRLVGAANGIG--QGIAWRNRCLLAGA........... 425
435 1.000e-88UniRef50_UPI00077AF90F gamma-glutamyltranspeptidase 1-like n=1 Tax=Acropora digitifera TaxID=70779 RepID=UPI00077AF90F  ali  38  207MLDPKLGDQLRQKIQDNRTHDNVCNYAKYFSHPDSCTTHISVLAENGDAVAVTTSINLRFGCRYRSMDTGIIYNNDMADFDTPGYEVVDNIHPSPFNLPEPGKIPFSSMTPAILTDNNGEVQVVIGAAGGRRITTAISLVLMNMMWFGMTLSDAVDKPRLHNQLVPNQVSTERYYPKQIVEGLRRIGHTVQPGRKGFAVVHVVYRKGGLIHAKSDPRKFGAPAG. 435
436 2.000e-88UniRef50_A0A2P5XCD6 Uncharacterized protein n=1 Tax=Gossypium barbadense TaxID=3634 RepID=A0A2P5XCD6_GOSBA  ali  37  459MLSPKFALELKKTINDNRTFGPNYYGGRWNQIHDHGTSHVSIVDTKRNVVSITNTVNGYFGSKILSPSTGIVLNNEMDDFSMPNNSSGVTPPPAPPNFVHPGKRPLSSMTPTIVLKQDEKLKAVVGASGGANIIAATTQVLLNHFALGMDPLSSVMAPRVYHQLIPNVVRYENWVPETIRTDLRKKGHVLERATSAT-ESQFIVHDHGELVVVSDPRKGGFPAGF 707
437 2.000e-88UniRef50_A0A2E5JIW9 Gamma-glutamyltransferase n=9 Tax=Oligoflexia TaxID=1553900 RepID=A0A2E5JIW9_9PROT  ali  31  347LISKEYAKQIRTKIPSHRALKKDEVKATDYKFADHDTTHFSVMDSEGLVVSSTQTINGWFGSGVVAQGTGIVLNNEMDDFATAGASNLFGAIGGEQNLVEPQKRPLSSMSPTIVL-RYGKPFLALGTPSGTRILTCVAQTLINRLEFGMPLWESVSALRYHQQWSPDQLRFEEEIPSNLKTRLTSMGHEIVQKD-LGCKIQAIEKEGTWIKAVSDPRGEGRALA. 571
438 2.000e-88UniRef50_A0A2G7FWW1 Uncharacterized protein n=1 Tax=Aspergillus arachidicola TaxID=656916 RepID=A0A2G7FWW1_9EURO  ali  37 1230MLEQSTIDEIRGKISDLHTQNVSAYDPGLESLDTPGTSHIAAVDHTGLTISTITTINLLFGSKVMVPETGIIMNNEMDDFSTPGLSNAFGYVPSEANFIRPGKRPLSSITPTIVTHQNGSVFFVAGSAGGSRIITATVQNIIHAVDEGLSAAEALARPRLHDQLIPNQVRFEYAYNNETVAFMKSLGHNVTWVAPGDSTAQAIRVPNGTFDAAGE.......... 1446
439 2.000e-88UniRef50_A0A2D9VFJ0 Signal peptidase I n=1 Tax=Candidatus Marinimicrobia bacterium TaxID=2026760 RepID=A0A2D9VFJ0_9BACT  ali  28  329LISDQYAEMRFSNFDFDVVIPSNNMGPGLGPVESSETTHYSIVDKWGNAVSVTTTLNGKYGNGIVVDDAGFLLNNEMDDFSIPGHPNKYGLVGKEANSIKPKKRMLSSMTPTIVENXSGELILVLGSPGGSTIITTVAQIIINIIDYDMSISDAVQAPRFHHQWLPDVVFYEEGISNKTMNXLKNKGYXFHRRKS-IGEANCIQIPNGIIFGAADSRREASTRAY 557
440 2.000e-88UniRef50_A0A063BZZ6 Uncharacterized protein n=2 Tax=Hypocreales TaxID=5125 RepID=A0A063BZZ6_9HYPO  ali  38  155LVDASHVRRTKDR