current user: public

If you have questions about the server, please let us know.

Query: sp|P36268|GGT2_HUMAN(removed signalp:1-30) Gamma-glutamyltranspeptidase 2 OS=Homo sapiens GN=GGT2 PE=1 SV=3, from H.sapiens

Results of PSI-BLAST search in nr85s
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380    .  390    .  400    .  410    .  420    .  430    .  440    .  450    .  460    .  470    .  480    .  490    .  500    .  510    .  520    .  530    .
# E-value Template Links and tools%idFirst KEPDNHVYTRAAMAADAKQCLEIGRDTLRDGGSAVDAAIAALLCVGLMNAHSMGIGVGLFLTIYNSTTGKAEVINAREVAPRLAFASMFNSSEQSQKGGLSVAVPGEIRGYELAHQRHGRLPWARLFQPSIQLARQGFPVGKGLAAVLENKRTVIEQQPVLWYVFCRDRKVLREGERLTLPRLADTYEMLAIEGAQAFYNGSLMAQIVKDIQAAGGIVTAEDLNNYRAELIEHPLNISLGDAVLYMPSARLSGPVLALILNILKGYNFSRESVETPEQKGLTYHRIVEAFRFAYAKRTLLGDPKFVDVTEVVRNMTSEFFAAQLRSQISDHTTHPISYYKPEFYTPDDGGTAHLSVVAEDGSAVSATSTINLYFGSKVCSPVSGILFNNEWTTSALPAFTNEFGAPPSPANFIQPGKQPLLSMCLTIMVGQDGQVRMVVGAAGGTQITTDTALAIIYNLWFGYDVKRAVEEPRLHNKLLPNVTTVERNIDQAVTAALETRHHHTQIASTFIAVVQAIVRTAGGWAAALDSRKGGEPAGYLast
1 0.000e+00UniRef50_A0A2H9TG31 Gamma-glutamyltranspeptidase n=1 Tax=Paramicrosporidium saccamoebae TaxID=1246581 RepID=A0A2H9TG31_9FUNG  ali  37  36......IYQNGGVAAEHPRCSEIGVQMMEMGGNAVDAAIAGLLCVGVVNNFAAGIGGDA--------SGAYEVIDFREAAARSAHQDMFNKNTLATDSTLGMGVPGEIRGFATAHARHGKLPWAALFEPSIRLARKGFP----------RFKNKLLKSKGMRETYFKDGRPKEVGDFIYRRNLARTLGKIAKNGPDIFYSGEIADHIISTVEDDQGGITKEDMMSYEVKIREPVVAEVAGFKII-TPGAPTCGPLIIQILKVVE-----KLGLGSPEN-VTTVQKIIEAFKFAYVDRMQLGDPDFVHMDDLVAKIISDERASEIAPRIR---------------KCDSHGTTNLVASDKYGYGVSAVSTVNLEWGNRIMDYETGIIFNNQLDDFSIPKMNNSFGLPPSEANFIMPFKRPLSSATPVI-LERDGKVFMVLGGAGGSRIITAVAEMIIRVVMLGMDPDKAMDSCRLHHQLIPDVILAEHRCDSALLKKLSGIGHTIIIMGAEQTSVNMVLVNGAGIVPISDPRKGGLAAGY 532
2 0.000e+00UniRef50_A0A075B599 Gamma-glutamyltranspeptidase domain-containing protein n=1 Tax=Rozella allomycis CSF55 TaxID=988480 RepID=A0A075B599_9FUNG  ali  33  50.........HYAISTEHEICTSIARKVMEE-----------LFCIGTVNPFSSGIGGGGVAMVRD-ENMQIHAMDFREMSSSSSTFDIFTDPSKSVKGALSVGVPGEVKGLWELYQRFGKAEWNTLIEPSIQLARNGFTVDRELARRIQIYKSDILEEPTLRQVFAPEGQLLGIGDTLQRPNYAQTLETISKEGANAFYSGSIATSLIKFIQSNGGILTADDFKNYSIKMRDVVQGEFNGLNVYSMGTPASGNIVVT-MLNVLNQFD------DREPHPVTFYHRLVECMKFGYGIRNLMGDADFNEMSNFVNSTTDETFAKRINSLINDAATYPMQYYDTVTQALKDQGTTHVSVIDRNGLSASITSSINHIFGSKLIDPTTGILLNNVMDDFSQPTHPNAFGYPPNPSNYIEPRKRPQSSMSPLII-EKQGNVFMSVGASGGAYMPSAVFQSVLNVLVRRMLPQMAVNEPRVHHQLNPDVVRVEVGFDRDILNGLTVIGHTVEEEGPR-SAVQMAMKEFGGYEAGADERKHGYAI.. 582
3 0.000e+00UniRef50_A0A2V3CWS1 Gamma-carboxygeranoyl-CoA hydratase n=2 Tax=Pseudomonas TaxID=286 RepID=A0A2V3CWS1_9PSED  ali  31  267...................................DAAIAMQAVLTLVEPQSSGIGGGALIVLWDGKA--VRTYDGRETAPAGATEKLFLQADGAQIGGRSVGTPGVLRALELAHKKHGRLPWAQLFEPAIRLADQGFPISPRLHSMIVAD-PYLAKSPDMAAYFLNDGTPKAVGTLLKNPQLAAVLERIAKEGPNALYQGPVAREIVAKVQANPGSLSLNDLQGYRAKEREPLCTDYKRWQVCGMPPPSSGGIAMAQILGTLQRYALPPLKPAGLEPAPEAVHLIAEAERLAYADRAYVADSDFAPVP--IAGLVAPQYLAQRAALIGERSMAKAEPGKPQGYAPDRSSTSQVVAVDDQGGAVSMTTTVEAAFGSHLMVQ--GFMLNNQMTDFSFIPEENG----QPVANRVQPGKRPRSSMAPTLIFDRNGEFLATVGSPGGSQIIEYVAKSVIGMLDWNLDPQAAISLPNFGSRNGP--TELEQGFTPGLKAALKAKGHELTDID-MTSGTQAIVRVRDSWAGGADPRREGAALG. 794
4 0.000e+00UniRef50_UPI000CD63B83 glutathione hydrolase 5 proenzyme isoform X1 n=1 Tax=Paramormyrops kingsleyae TaxID=1676925 RepID=UPI000CD63B83  ali  40  37...SDGYFQHGAVAADSERCSEIGRDILQQGGSAVDGAIAALLCTSLVNPQSMGLGGGSIFTVMD-KMGKVKVITSREKVPRRIKADLLQSCPKSVNGSEWIAVPGEIRGYKRAHDLYGKLPWAKLFEPAIRLARHGFPLPNYLGIFLHMLKQPIEGS-HLCDVFCNKNKVLRPGELLKFPKLADTMETIAKEGADAFYTGRIAHDLIADITDAGGSLTREDLASFQANVTDPLVMPL-GDYKMFTPPPPAGGALLGFTLNIMNGFSLSRSSIED-DQKALTFHRYVEALKFASGQRPTIRDPDFNPVMKEAEYLISDKFANHVRTMISSSMTHDPQYYN-ITPALDHFGTSHMSVLAEDGTAVSVTSTINHFFGSMVYSRRTGVILNNELADFSVGVVPLEFFPSP-------PGEQPPSSMAPSILYSKSKNKLLLIGGSGGTMITTGVASALMNHLWFEKDLQQAISDPVLYV-NAKSQIEVEKGFDGSVVDKLKKLGHSVGNMTYSLNVVNAISREGSCISAMSDTRKLGKAVGY 589
5 0.000e+00UniRef50_A0A1E4CK75 Gamma-glutamyltransferase n=10 Tax=Proteobacteria TaxID=1224 RepID=A0A1E4CK75_9RHIZ  ali  29  55.....AIARRHMVAAANPYASEAGREILREGGSAVDAAIAVQLVLNLVEPQSSGIGGGAFLLHFDSATRSLKAYDGRETAPAAARPDRFLDAAGAIASGAAVGVPGVLAMLELAHRQHGRLPWARLFAPAIQLARDGFVVSPRLALLLHWMGAD-AFSPAARRYFFDNGKAWSAGHQLRNPEFADTLEIIARDGARALHEGPLAERIVAAVATGPGDLALADLAACQPREREPVCILYRERRVCGIGPPSSGAHTIGQVLRLIESFDLGRGP--SAALNARAMHIIAEAEKLAYADRNFIADPEFVRVPL---GLLGTHYLERRRALIAPLRAAEVEAGNPGGDTIEASGTSHVSIVDGAGNAVAMTTTIEAAFGSRIWA--AGFLLNNELTDFSFRHTDAQGRPI---ANRVAGGKRPRSSMAPTIVLDAEGELKAVLGSPGGSRIILYVVKSLVALIDWEMDAQAAAALVNFGSQGRG--FELESTTASAIWQALRLKGHRID-FDLMTSGTHIIVRRPTRLEGGADPRREGVALG. 611
6 0.000e+00UniRef50_A0A2A8CXC5 Gamma-glutamyltransferase n=2 Tax=Bacteria TaxID=2 RepID=A0A2A8CXC5_9BACT  ali  25  42..RSPVVAPNGIAATSQPLASQVAVDVMKQGGNAVDAAIAANAVLGLVEPTGNGIGGDLYAIVYDPETDEVYGLNASGRSPQNLSYDELKDDEIPLVGTLPVSVPGTVSGWDKLHERFGERSMADNLAPAIQYARDGFPLSQVIAYYWASNIRAFLMDDNWRDTYLIEGRAPKEGEMFRNPDLASTLEMIAENGADAFYEGEIAQTIDAYMERIGGHLTAQDLADHTADWVEPESVTYRGVE-VFELPPNGQGIAALQMLQILEAYDLEDMGHNSTD----YLHVQTEAKKLVFEDRAFYADPDFADIP--IDELLSEEYAAERRSMIKMDGVSEPGHGEPRSERLEEGDTIYMTVADKNGMMVSLIQSNYAGMGSGLVPDGLGFMLQDRGALFTM---------EKGHPNVYEPGKRPFHTIIPAFA-KKDGKPWLSFGVMGGAMQPQGHVQVICNMVDFGMNVQEAGDAARYRHRGSTGTLHLESGVSQNVVNALRGRGHAVEIDAGGYGGYQAIMWDPGVYWGGTEMRKDGTVAGY 596
7 0.000e+00UniRef50_A0A1I3JBW6 Gamma-glutamyltranspeptidase / glutathione hydrolase n=1 Tax=Ruminococcaceae bacterium D5 TaxID=1520815 RepID=A0A1I3JBW6_9FIRM :_  ali  24  84.....AEGMNGMVASASPIASKVGVTILERGGNAVDAAVAVAYALGMVESNASGVGGDGYMLVYDANSGKSTFLDYKGEAPAAFTLEFLNEKGYKQTGYSAV-VPGFVAGMEKANELFGTMSMAELLQPTIDYAEKGVPVTPFMAHVYVDYYKTLMKYPETEATFLNDGFPYNEGELFTNQNYANVLKRIAAEGKDAFYTGEIAQSIVDSLAEHDGVMTLQDLANFRVEVREPVSTTYRGYRVVSA-PPGAGGAAVIEALNMAEHFDVHSMGHNTPE----TLHMWAEILKLSAVDRHYIGDPDYTD-PSGMYGITTKSYAADRVKLVNMERVLGKPKYG-KVEEVEGAHTTHVSIIDQWGNMVAMTNTVSDFFGCGITVKGCGFFMNNGSFNFSSVY----------KANQPRPGQKVRSSISPTLIFSPNGSPLATFGTPGGSRIPGTVTQIVSNIVDFGMDMQDAIDAPRIY-QNYNDGLYIEGHMDPETTYTMKLKGHQVIERDYFFGGVQGVKIDPGELHGAADPRRDGKALGY 608
8 0.000e+00UniRef50_A0A0M9VPJ8 Gamma-glutamyltransferase n=5 Tax=Malassezia TaxID=55193 RepID=A0A0M9VPJ8_9BASI  ali  33  52......TGTRGAVACELDVCSNVGAYILEKGGSAADAMIATLSCVGVMDSFHSGLSGGGFALVKTRYSD-PVMIDYRETAPQAAHRDMYAKPNSSIVGGLAVAVPGEVRGWEQLHRLYGRLPWEQLLEPSIVIARRGFRVPAQLYSKIQWGGNLACLAPTLVPTFCPDGEPLPAGSLLRLPALADTLEQIATYGPNVMYEGPIAERMIETIQQHGGIMTMDDLRQFQVRIGQAASIDFRDKYRVWTTTAPSSGSVILSTLKTMEQYPDEPY----YETDALHTHRFIEATKFSYGERTFLADPAFLNVTAWEEHIIQPSVAKKRFDKIRDDTVRRMHKYDPQWDVLSDKGTSHLNAVDAEGMSISVTTTINSGWGAFLSTPD-GILLNNDMDDFSQPDRSNLFGYAPSPANYIAPGKRPMSSMSPFLIENRHGEVEVIGGSAGGSRIITANLLLAYTYMSFHIDMQSVIDRPRWHHQLVPDLAFFEYGYSNRTVEALQAKGHHPYFFGPGVSTAQAIVRRDGHFVTASEVRQEGAAV.. 597
9 0.000e+00UniRef50_O18256 Uncharacterized protein n=11 Tax=Caenorhabditis TaxID=6237 RepID=O18256_CAEEL  ali  34  64.KSKSAIFKNAAAVADSRFCAEIARNVIIQGGNAVDAAIAATFCNGVVLPYATGIGGGDFIVIYLKEEKKCVFLNSRETAPSLATEKMYVDKDSAQFGYQSIGIPGELHGLWTAYQKYGSIPWSDLVMPAAQLA-KGFP----MHKAMHDYFDRISKYEALRNLYTSTGEFYKVGEIVANYPLAKFLRLIANDPVQLFYNGSIADGIIREMLANGGIITIDDLRNYRTHVMETLYADLGKYRICG-PPPPSSWAITQAIPRIVARLYRDKKMFNDAE----FYHTLIEAEKLAYGQRGQLGDYLFSPESMQIANLTENSFIKYLSKRLKD-KSQDVSYYVTSGPAIMDSGTSQISVVDDDGNAVSLTSTINTAFGSKMLSK-YGFIYNNQMDDFSTPGFQNHWGFEPTAANYIQPGRRPMSSMSPTIVFDSSGNVKMVTGGTGGSKIISAVAQTLIRGLLMGQSAAEIVEMPRVHNQLTPYETEVENDFSEKILEQLE-RDHKMKKTDESLAIVYPITRDGDKYNAAADYRRHSEPAGY 607
10 0.000e+00UniRef50_UPI000C20E03A glutathione hydrolase 1 proenzyme-like n=1 Tax=Onthophagus taurus TaxID=166361 RepID=UPI000C20E03A  ali  34  37.........KAAVVTNSFECTNIGLNILKCGGSVADAAIAALFCEGVSNPQSMGLGGGFLLTIFKKSSGTVQVLNARENAPYKAHKDMFNEENEMSSGGLSVAVPGELKGYWELHKKYGKLPWSHLVKPTIKLLQRGIYVSNYLSKMIKALENEIVRSPSLKLIFLNTGKLYQEGDVMNRPRLAETLAKIAEKGPNVLYNGPLTDCFIQDIQDAGGVITKDDLKKYKPRWMKPLSTTIATDFTIYTVPSPGAGSFLLLITDLMSRMIIN-------CSPVTFWHRLIEVWKFAYGLKTQQSGPN-MAIRNLDEHCYNSTVTHFIRCRIKDSCTSDPSNYFGVYEQPEDHGTAHISILAPNGDAISVTSTINLVFGAFFASPSTGIILNNQMMDFAIP---NRHPWKANPSNYIKPQRQPVSTMCPTIILSSDNSVRMIVGASGGFKILSATSLVVIRHLLLGECLEEAVAQPRLHHQLVPMEIEYESGFPPAILKGLSRRGHVIKQYKPITSAVNAISVCNDNIEAIGDRRRHGYGEGF 574
11 0.000e+00UniRef50_A0A069XN73 Gamma-glutamyltransferase n=11 Tax=Enterobacteriaceae TaxID=543 RepID=A0A069XN73_ECOLX  ali  31  1..............................................................................................................................MQPAFKLARDGFIVNDALADDLKTYSEVLPNHENSKAIFWKEGEPLKKGDTLVQANLAKSLEMIAENGPDEFYKGTIAEQIAQEMQKNGGLITKEDLAAYKAVERTPISGDYRGYQVYSMPPPSSGGIHIVQILNILENFDMKKYGFGSAD----AMQIMAEAEKYAYADRSYLGDPDFVKVP--WQALTNKAYAKSIADQIDINKAKPSSEIRPGLAPYESNQTTHYSVVDKDGNAVAVTYTLNTTFGTGIVAGESGILLNNQMDDFSKPGVPNVYGLVGGDANAVGPNKRPLSSMSPTIVV-KDGKTWLVTGSPGGSRIITTVLQMVVNSIDYGFNVAEATNAPRFHHQWLPDELRVEKGFSPDTLKLLEAKGQKV-ALKEAMGSTQSIMVPDGELYGASDPRSDDLTAGY 411
12 0.000e+00UniRef50_A0A2J6QV65 Gamma-glutamyltranspeptidase n=1 Tax=Meliniomyces variabilis F TaxID=1149755 RepID=A0A2J6QV65_9HELO  ali  33  23........TNGAVACESAVCSQIGLDIMKDNGNAADAMVATQLCIGTIAMYSSGIGGGGFVLVRS-KEGIYDFIDFRETAPAAAYERMFQNLTLSVRGGLAAGVPGELRGLKYLHDTYGKKPWKDLFTPSIKLAREGFKVSQDLYNDIGYDNDFFTEDVSWAMDFAPNGTRVGLGDTMTRKRFADTLENIAEQGPDAFYTGAIANATIVAIQQANGTMTLSDLKNYAIVNRPITNFTYHGFKI-YSGTAPSSGAVLASIMKIIEGYDMR-----TPAQLNFSTHYLDEAMKFAYGQRTLLGDPAFLNLTEYQLNMYSESTAEEFRSKIEADAVLETKDYEPPGDDFDDHGTTAVVTADKSGLSIALTSTVNFLFGNTMMVPEIGVILNNQMNDFSVFNTSNAFGVEDSPANYIAPFKRPLSSIAPVIVEFPNGKVYVVHACAGGSRITTEISQHLWHVLDQNLTSAAALLSPRMYDQLYPPEVSLEWGYNNQTAAFLKSIGANVTYV-GFQSAGQAIRRLNGTFEAAAEPRSGGYA... 570
13 0.000e+00UniRef50_A0A2K3QIH4 Gamma-glutamyltranspeptidase 1 n=1 Tax=Tolypocladium capitatum TaxID=45235 RepID=A0A2K3QIH4_9HYPO  ali  36  41.......ASHGAVASEDAECSAIGRDLLARGGNAVDALVGTTFCVGVVGMYHSGIGGGGFAMIRDAAGG-YEAVDFRETAPAAAHEDMYQGNNGSVFGGLAVGVPSEVLGLEYIHKKYGVLPWNKVMRGAIHVARDGFRGSYNMEASLRW---FVLRHADAATSLERHGAVHAEGAQLRRPELRRGLKKIADEGADALYAGELAEAMIECIQQANGTMTLADLANYTVVSRPVKTITYRG-LGLHTVGAPASGAVTLGILKTMEQFDLAE----HQGLPGLAAHRFTEAMRFGYGARVGLGDPDHVDVRVFEDRMLSDGTARRTRGSISDDRTQPVHAYDPEGYTPDSHGTSHIVTADASGMATSLTTTINLLFGARLMDPASGIVLNNEMNDFSIPGVPNEFGFQPSTANYIRPGKRPLSSITPVIATHRNGSLYATVGAAGGSRIISATAVALWHLLEHGMGMRDALREPRLHDQLMPNTVLLEYKFDNDTAAALAERGHNVTWVAEGLSAVQGIRILDGTFEAAGEPR........ 610
14 0.000e+00UniRef50_A0A2E4F8W6 Gamma-glutamyltransferase n=1 Tax=Deltaproteobacteria bacterium TaxID=2026735 RepID=A0A2E4F8W6_9DELT  ali  26  39RDIELVRGDRQMVSSADPSASRAGMEMLEAGGSATDALIAMSMVLTLTEPQSSGIGGGGFLLHYDKAAKAVRTYDGRELSPAGATSDQFLGPDGA---------PLELRMLEMAHKQHGKLPWERLFDPAIRLCEKGFYPTPRLSKLIASN-ERLKSSPTTRAYFYDEGEALSPIRLKTNLPLARVLEAVAKGGADAFYTGPIAERMVEAARRRPSTMTLEDLTRYEAVERKTVCAPYRDYKICGMGPPTSGGVAVHQILGVMSHFDLSEWAPGSPELT----HLFVEASRLAYADRAYLADPDRVDVP--VAGLIDPDYLADRAKLVSMDTTMGASAGRPGGAASEFPSTTHLVAVDRSGNVANMTASIEQGFGSHIMVD--GYLLNNELTDFSFEPERDG----APVANACGPRKRPRSTMSPTLVFNEADQFFMAIGSPGGSRIIEYVARTLVYVLDKKMSIQGAIAAPNIVNRNGVTELELDPQDAKRTTKALRALGHEVVIQRQS-SGLHGIVQTPYGLEGGADPRREGVAIG. 585
15 0.000e+00UniRef50_A0A1C6EJP0 Gamma-glutamyltranspeptidase n=36 Tax=root TaxID=1 RepID=A0A1C6EJP0_9CLOT  ali  26  82...RDATGKNGVVSAAKYEASQAGLEVLKAGGNAIDAAVAVAFALSVIE--------------QNAEEGENVFIAFRGDAPSAASPDMWVANKANRQGGKAVTIPGEVAGLLYAFDNYGSLTLEQVMAPAINLAQNGFYVTPTLYKDMVAADEKMSRFPEFYKFLRKDGELYQVGDLWKNEELADTLRIIAKNGRDGFYKGEVAEKIVEMTKKYGGILTMEDLANYQPKVSKPVEGTYRGYKILSSK---GGGTNIIEGLNILENFNMSDYDINSVERA----HVLSEMFKQVYADRAYMADP--FNTDVLIKGLTSKKYAKQLASKINMDYSQDYVPGSPEDY--EHEDTTHFSVADKAGNVVAITQTVNLEFGSGVMVDGYGFVLN---------DAMADFAADADSVNAVKPGSEPLSSMSPTIILNEDGSPFLVIGTPGGSRIVSLLTQVISNVIDYDLSIEDAIKQPRIYD--KPDTLVLEDTVDSSLIPKLSSMGHMVSVYEGHFGSVQAVMKKDGTMVGGADERRDGKALGY 609
16 0.000e+00UniRef50_A0A158S6N8 Gamma-glutamyltransferase n=31 Tax=Proteobacteria TaxID=1224 RepID=A0A158S6N8_9SPHN  ali  28  50......FAKHAMVAAANPLAVKAGVDVLRKGGSAVDAAVAIQAVLGLVEPQSSGIGGGAFMVYYDAKNRKATYYDGRETAPAGATDRLFLDDDGAVLGGISTGVPGAVAMLDMAHHDHGKLAWADLLEPARDLAADGFIVSPRLAGMIRMERAPQSTAPDAVTYFSPDGSRYAAGDRLRNPAYARTMERIAKFGASGLLTGPIAHDIVKRVSERPGTMTLADLAAYRPRTGPALCEPYRVYMVC-TPQAPSGGPGLLMALGILEHTDIAKRNAGDEK----AWFEFAQASRLAYADRRYVGDSAFVEVP--IKGLLDPDYLAARAKLIG-ERAGSVSFGHPEGAPAEPGGTSHFIVVDAQGNVVSMTTTVESIFGSGRMVD--GFFLNNQLTDFSFSPTDGDGAPAANAP---APGKRPRSSMAPAIVLTKDGRFHAAAGSPGGTSIQAYNLKALVAMLDWNMSPQDAVALPNLVA--KGDAFRADP-FPEPIMTGLAARGMPLSTSRSEESGIQAIVVRNGGYEGGADPRREGMARGF 584
17 0.000e+00UniRef50_A0A2M8Q3J9 Gamma-glutamyltransferase n=2 Tax=Bacteria TaxID=2 RepID=A0A2M8Q3J9_9CHLR  ali  28  31.QKGATVAENGMVATSNRYATLAGIEALRQGGNAVDAMAVVQFVLNVTEPYASGIGGGAFIMIYDAATGEVVAIDGREEAPAAYTEDVFLDEEGNTTGGNSVGVPGTLAAVARALEEYGTFTLAEAMAPAIQLARSGFTIDAYFADQIASNAERIKLFPATAAMYLDEGNPLPEGTVITNPELADTFELIASEGIDVFYGGEIGAAIVDAVQNNPGVMELSDLENYRAVRRQPVTTNYRGYDVYGMNMPTSGGTTLMLMLNLLEGFDMSSVEWGSLD----YITLMANVQNVAFADRNYMADADFVDV--NVAGLLDANYARERRALVSTNAAVGVPAGTPPVIEPEGESTTHFSIIDKDRNMVSVTSTIELLFGSAVSVPGYGFLLNNELTDFSFRYQDADGNPI---ANAPEGGKRPRSSMSPTLVL-RNGQPFMAVGTPGGSRIIGYVFNVLVHVIDYDMELQEAVNAPRVVGRNGALTVDPEF-FTPELVGGLQARGFDVRQ--PNTGSVQAVMVDDGLLYGAADYRRLGLALG. 601
18 0.000e+00UniRef50_A0A2U9BTG5 Putative gamma-glutamyltransferase 5 n=4 Tax=Percomorphaceae TaxID=1489872 RepID=A0A2U9BTG5_SCOMX  ali  42  32RKCPAGTFSNAAVAADSRRCSEIGRDVLQQGGSAVDGAIAALLCTSLMNPQSMGIGGGSIFTVMD-SSGKVKIINARETVPQSFQSDLLESCPKTLSGSQWIGVPGEIRGYEQAHRLYGKLPWATLFQPAIQLAREGFPIPQIQGRYI----PYIGTNQSLRKLFAKDGNLLKTGDTVRFEKLADTLEMIANHGADAFYTGRVAEDLIRDIQEAGGTLTVQDLASYKVAVTDAWAVPL-GEYQMYIPPPPAGGTILSLILNILKGYGLNSASL-TGEQKTLAYHRYVEAFKFANGLKKHIH-PQFTS-EEMARKFTEDSFADRIRSLISSDKTHGAQYYNITPY-LESVGTTHVSVLAEDGSAVSVTSTINHIFGSKVFSPSTGVILNNELSDFC------------GRVDSIFPGEQPPSSMSPAVLLSKT----LVIGSTGGSMITTGMASTLMSHLWFGKSLKEAIAAPVVFVD-SKNALRFEANFDKNVIKALKALGHSQDTSSIFYNVVNAVEKEDGCICAVSDARKLGQAAGY 551
19 0.000e+00UniRef50_A0A0R2V5Q1 Uncharacterized protein (Fragment) n=1 Tax=Methylophilales bacterium BACL14 MAG-120920-bin58 TaxID=1655631 RepID=A0A0R2V5Q1_9PROT  ali  27  1..........GAVVTSNALATEAGEKILAEGGNAYDAATTISAMLSVVEPFASGLGGGAFWLIYDAKSKKYTMLDARETAPLQSYKNMYLDKNMSTLGPLSAGIPGIPAVLSYVNDKYGSKKLSTLLAPAYKAAINGFPVNERYLKGAKYKKKWLKKYKETEAIFLHKGEVPKKGWILKQTDLARTIKKLMKDGHRSFYTGSFAKKMVESVQNHGGIWSEEDLNRYKVLEREPVRSTYKGISIIAPGLPSSGGLVLSNALNILAGYELDKLSPTTQK------HLIIESLRRAYYERAKMGDPDFMDNT--LEYLLTPSYAAKQRENLNINYATDLEFADPPYQGQ-GNDTTHFAVIDKFGNRVAVTQSINFWFGSAFVPKGSGVLLNNEMDDFSIPGAENGYGLIGYDANAVEPRKRMLSSMTPTFLESDRG--FVILGTPGGSRIISMILLATLEWVNGG-DAKSMVSLPRFHHQYHPDYVLYEEEFISSEIDELESMGHIFKKSNRQFGNMQIISWDNNKIEVASDPRG....... 524
20 0.000e+00UniRef50_A0A1W1Z8H2 Gamma-glutamyltransferase 1 Threonine peptidase. MEROPS family T03 n=1 Tax=Polynucleobacter sp. VK13 TaxID=1938817 RepID=A0A1W1Z8  ali  26  57.EKKLAFGKSMMVATANSYASQAAYAILKKGGNATDAAIAASVMLTLTEPNATGIGGGGFLVHFDAKRKKIQAYDGRETAPALAYPDRFLSASGAMTSGRAVGTPGLLKMLEMVHQTHGKLPWKQILLPTIQQSQQGFIVSDRLHILIQKD-PYLKNNPESRKYFYDQGLAFEVGTLIKNPELAKVLNEVAEHGANAFYTGWIARDIERAVQKNPGDLTIKDLSSYKAKERPILCHTYRIWNICGMPPPSSGTLAILQMLGILESFPMTDYPANTWQG----IHLFSEAGRLAFADREYIADPDFV-VPP-IKGMLDSTYIQKRRDQINWNKSQKALPGQPEGSLSEAAGTSHISVIDSWGNAVSLTNTIEAQFGSRIMVD--GFLLNNQLTDFSLTPMVDGKLV----ANRVEPNKRPRSSMAPLLVFDQYGNLVMNVGSAGGSGIINYLAKTLVAVMDWNMNIQDAISLPNFGSRNK--ETELEQGSWDSVVGSLKEKSHMIKYFDAP-SGLHGLYIINGG................ 583
21 0.000e+00UniRef50_A0A2E8D890 Gamma-glutamyltransferase n=15 Tax=Bacteria TaxID=2 RepID=A0A2E8D890_9PLAN  ali  27  30...QVARASQGMVVSETPHASRVGRDVLTRGGNAVDAAVATAFALAVTWPEAGNIGGGGFMMVHPADGKPPVCVEYRETAPAAATETMF-ELGESRYNCKAVGVPGTVGGLQLAHESFGRLPWRDIVMPAVRLAESGFVVDDWLAYSLEQENVRLGRYAELRRVYSPQGRPWRKGDVMVLLDLARTLRTIAERGGNAFYEGRIADLLVAEMQRGNGIISKQDLEGYRAKIRKPIGGTYRGYDLYGPPPPCSGGTCVIETLNILEPFKLRE----HPRFGARNLHLIADRAK-------YLGDPDFTSIP---KHLTGKEYAAKLAGAIKLDEATPSEAIAPEIQADESPDTTHFSVIDGDGMGVSNTYTLEASWGSRIVVPGAGFLLNNEMGDFNWRGHTDRKGRIGTDANLIRPGKRMLSSQSPFIV-ARDGKVVLLTGSPGGRTIINTVLGNILNVLEFEMPIDKAIDTARLHHQWFPDEITFEGTKSDEAVKKLRDWGHTVR-YRSRQGSAHSIHVDTSKYVGVADWRRGGFAAG. 568
22 0.000e+00UniRef50_A0A132BZB9 Gamma-glutamyltranspeptidase n=904 Tax=root TaxID=1 RepID=A0A132BZB9_9RHOB  ali  26  61...RPVAAENWMVAAANPLAVEAGADVLRKGGTAADAMIAVQTVLGLVEPQSSGLGGGAFLVYYDARTGQLTTLDGRETAPLAATPRLFQDDAGAVVGGRSVGTPGTPALLEMAHRKWGRANWGGLFNAAIALAETGFAVSPRMADSIANDADRLGRFPDTAAYFLPEGTPLKAGQVISNQPYADVLRAIAADGAAAFYTGPIAADIVRTVQGNPGVLSAVDLALYQVKERPAVCASYRAFEACGMGPPSSGALTVGQILGMLGQYDLAELGADNPD----SWRLIGDASRLAFADRRYMADSDFVPMPT--KGLVDGDYLADRARLLAGETALEVEPGTPTFDSLEFPSTSHISIVDQYGNVLSMTTTIENGFGARLMTN--GFLLNNELTDFSFRSHSDGVPI----ANRLEPGKRPRSSMAPTIVM-RDDKPVLAIGSPGGSRIIGYVATAIVAWADWGMNVQEAISLP--HAINRFGTYDLEAGTAEALAEALTGMGFEVNP-RDLNSGLHAIEI-GDRLHGGADPRREGIALG. 600
23 0.000e+00UniRef50_V4YV19 Gamma-glutamyltranspeptidase n=1 Tax=Betaproteobacteria bacterium MOLA814 TaxID=1408164 RepID=V4YV19_9PROT  ali  29  64.......FQHWAVATANPLATAAGYRVLADGGNAIDAAVAAQMVLGLVEPQSSGIGGGAFLLHYDGNG--VTAYDGREVAPMAADEALFLDRNAAVVGGRAVGVPGAVSMLEKAHAAQGKLPWARLFESAITLAEQGFSVGTRLNKLLQAD-TYLRQDPQAAAYFYDNGQAWPVGHMLRNPELAGVLRLIAAQGAKGLMEGEVAQAIVNKVQQNPGRMKLDDLAQYQAIARAPFCSDYKRFRICGMPPPSSGAITVAQILGLLSHTPQAGASTLNPD----WLHYYMESSRLAFADRAYIADPDFVKPPNSWHSLVDPNYLSTRAKLMSERSMGTATHGNPGSPDQPEFGTSHISIIDGNGHAVAMTTTIENGFGARQMVK--GFLLNNQLTDFSFAPK-DGAGLP--IANRVQAGKRPRSSMAPTLVFDKDTKLLLSVGSPGGSLIIHYTAKTLVGMLDWQLSPQQAINLPNFAN--NNGTSLLEKNFEQATVDALEARGHVLRHID-MTSGLQAVEQNAGRIRAGADPRREGLVMG. 607
24 0.000e+00UniRef50_I0HVQ2 Gamma-glutamyltranspeptidase Ggt n=14 Tax=Bacteria TaxID=2 RepID=I0HVQ2_RUBGI  ali  27  46........KRGVVSTANPYAAEAGARVLGWGGNAVDAAVAIAYALNVVEPQSAGIGGGGFMMVHLVETGETFVLDSRETAPAGATPDMFVGVPNPSLQGVAVGVPGMVRGTAWALEHWGRLKLGQVMLPAIRLASQGFEATPRYVS--ASCNSRARNSPEAEAFFCPGGVPPAVGQLIRNEPLAETLRLIATRGPDCFYGCDIAKGIVEGQKSKGGSMSYADLQGYQPALRVPVEGRYRGWKLKSMPPPSSGGLTILQMLAMIERFPIGDASQGWGFGEPKTVQTMVETMRVAFADRAWAGDEDFVHVPA--AGLLDPEYVAQRSALIVPGRAQPPTAGDPRPYPIDGPGTTHFSVVDRWGNMVSYTNTIESSHGIGVFAGYTGFLLNNELTDFNLAPTVNPYTGAAGS-NDVQPGKRPRSSMAPTMIFTPEGQPVVAYGSPGGATIINSVFNVTLNLVDHGMGLQQAIDAPRVSVASAGSNVATETTMPQATVDALKALGYAVSITD--IGSVQAVLVDPGRQYGAADSRREGTVIA. 612
25 0.000e+00UniRef50_A0A1Z8QC64 Gamma-glutamyltransferase n=2 Tax=unclassified Betaproteobacteria (miscellaneous) TaxID=33809 RepID=A0A1Z8QC64_9PROT  ali  27  32........EKGVVVAAHPLASNAGKIVLENGGSAIDAAVAIQAVLGLVEPQSSGIAGGGFLMYYSNLDKKVTSFDGRETAPLNIDPSVFEKYTGSQSGGISIGVPGIPSMLDKAHKKYGLLPWKSLFEHPIQLAENGFNITPRFYALVKRDK-YLMKHKETREYFYKKFIAKPIGTLLVNAEYANTLKKISSLGASEFYSGSIPGLIINDLRQENTLLTKEDFSRYSANQRDPVCGFYRKYKICSVGPPSSGGIAILQILGILQNYD-----PSLIQNIVKKIHLLTEATRLAMADRMYLGDPEFVRVPT--KKLLSQDYLKLRSKLIKDSKITNVTAGKFEDYSFDSESTTHFVVLDKFGNAVSMTSSVESAFGSRIMSE--GMILNNQLTDFSFK-SKDKDGFPIS--NSVAPGKRPLSSMSPTIIFDPEGNLFALIGSPGGKSIIGYVAQTIVDLIDLNYSMQRSISEPRFIVR--GNTTILEN---KSTLEILKKLGHSVKIRNQ-YSGLHGIRLKKNKIDGGVDPRREGK.... 573
26 0.000e+00UniRef50_A0A1Y0N633 Gamma-glutamyltranspeptidase n=24 Tax=Bacteria TaxID=2 RepID=A0A1Y0N633_9BURK  ali  30  56........RTYAVAAANPLATDAGRQVLAAGGSAVDAAIAVQMVLALVEPQSSGIGGGAFLLHFDGKT--TQAFDGRETAPAAATPALFLDDKGAVVGGRSVGVPGAVAMLAQAHAQHGKLPWASLFQPAITLATQGFAVSPRMAALLA-AEPHLKKDPVAAAYFYDAGKPWPAGHVLRNPELAAVLQGIADRGPSALLQGEVGQAIARKVQSNPGSLSTQDLAAYRPVVREPLCFDYREVRICGMPPPSSGAIAIGQILRMLDSTPASTLPLAQGLPTADWLHLYTEAARLAFADRAYLGDPAFVQAPGTWTSLLNPAYLRNRAALIDMQMALPGQPYAPMPDQIE-YGTSHISVVDAYGNAVAMTTTIEDAWGSRQMVNRRGFLLNNQLTDFSFSPTGTDGRPV---ANRVEPGKRPRSSMSPTLVFDKSGKLLMSGGSPGGALIIHFTAKTLYAKLHWGLNAQQAIDLPNFGSLNGPTLLEA-GRFDAATVQALKTRGHTVLEVP-MPSGLQAIERTAEGYFGGADPRREGIVLG. 617
27 0.000e+00UniRef50_UPI0002657E08 gamma-glutamyltranspeptidase 1 n=1 Tax=Galendromus occidentalis TaxID=34638 RepID=UPI0002657E08  ali  36  107KSKYAGTFRTWATALDEPQCAHVSREIYALGGTVADATVASLLCLGVVLPESLGIGGGFFAVYFNKKTGKVHYLDAREMAPLAANQNMFVG-GNSRTGARVIAVPGELKGYRELLRLVGTVSQTELFEPAIAIARKGFKSGQHLAEAMRAKRNLILADPGLRKVYIDTNDTWREGDVIVNHELADTLERLSRS-SDEFYEGPTGLGLVKKITSLGGILSMADLKEYQPKWKTPTHWRMQNTYDVYSASLPGSGPILALMLNTLDAYNISRF-----EDDSRSYQRLAEIFKFAYAKRSLLGDPNFIDVKELVDQMESKAFAEEIRGKINETGTLSLEKYGGALNVPRDHGTSHASFFGPDGDVIAITSTVNYYFGSGVQID--GIVFNNEMDDFSTPNEDNGFDLMPSKSNYIEPRKRPMSSMVPAVIV-KDREAVMAIGGAGGSQITTAAAQVIFHYFYRGTKLEDAIKHKRIHHQYFPEHILYEDGFDSEIIADLAKYGHKTREKPPRGSVIVGIAREGDKLVACVDPRKGGGVLG. 642
28 0.000e+00UniRef50_H9J7F5 Uncharacterized protein n=17 Tax=Ditrysia TaxID=37567 RepID=H9J7F5_BOMMO  ali  41  43..SQHVRYQRAAVAANGHECATVGREILEKNGSAVDAAIATLFCEGISCAQCMGLGGGFLATVYDASTGRVRVLNARERAPAAMTLNMYENA-SSTVGGLAIAVPGELRGYGALYQEYGRLPWRELVQPTAELCRRGHRVTEYMGRVLQTFSDRIMAEPSMRELYVNTGKVWNVGDYITDPTFAKTLEIIAEEGPEAIHDGSLTARLVQDIQNFGGIITEDDLRNYRVEWQEPIAIPLTEQHTLYSVPLPGSGSVLAFILNMLRGW----IGVETPVGSDLYWHRIVETFKYAYAKRTGLGDPSRHNLNQSIQNLANAEWAASYRGRVDDTRTYDWKHYEAVFEGADDHGTAHVIVVAPDGSVVSATSTINFIWGSQRRSQSLGFILNNEMDDFAIPNRDSSYGLPPSPANMLAPGLQPLSSMVPSVVVSKSGAADLVLGAAGGTKITTQVALMATHIIVEGHDLPDVIRRPRLHHQLLPMEIQHEANFDSDVIASLRSKGHATTELGPGFAAMVAIHRDSGYLVPATDHRRIGSVDGF 586
29 0.000e+00UniRef50_T1EDV0 Uncharacterized protein n=1 Tax=Helobdella robusta TaxID=6412 RepID=T1EDV0_HELRO  ali  36  6........................REILLKNGSAVDAAISAMFCAALYNFQSCGVGGGFFMIAYDPKTGEFLTFDAREVAPLKAEKYMYANETLSKYGGLSIAVPGEIKGYHEAWSKFGRLPFYDLVKPSIKLCKEGFKISHQLARAIENEETLVRSSPGLSKLFVNEGHLRKKGEVIKLEKLAVTLEQIGKN-PNSFYEGDLARNIVDELKEVGGIISDMDLTKYSVKMKKPFMAELKSKLNIYTLPPPSAGPILSFMLRLMDSFNQSYNPSYTP---VDAYQILVETLKFGYSLKTHLGDPEFYDVTKVLADILSDEYIESIHKLVTLRETHDYSYYNPHPGFHEDAGTSHIGVVSPDGGVVAATTTINLVFGSGVIGNRTGILYNDEMNDFSLPVLKPQFG----EGNFIEALKRPLSSMAPSILLDHDGNFKYVIGGSGGTKITSAELYVLANRLWSGHKINEAVDKLRLHHQFVPNHILYERGFDQKILDELIDIGHDVKRMRKNMSVVQVIEVNKKCLIAVSDYRKEGKPDGF 528
30 0.000e+00UniRef50_A0A2H5YBA6 Gamma-glutamyltransferase YwrD n=5 Tax=Bacteria TaxID=2 RepID=A0A2H5YBA6_9BACT  ali  25  11..RSVVLTRNGMVCSASPLAASAGLRVLQEGGNAIDAAIATAGVEGVVLPPMCGLGGEVFALVYRAREGKVYGVTGSGKAPLKATRDFFVSRGMPQDGPLSVAIPGEVDAYATLLERFGRFTLARLLEPAIALAEEGFPLPQRIARYFAIAGPQLARSPSAGRIFLQEGRPYRPGAVLRQHQLAQTLQAIARHGPREFYEGEVARRILTALQAEGGLYTPQEWASHRTIYDDPLSTTYRG-VTIYETHLPSQGILVLQMLNLLEGFDLQGMGHTTAD----YIHLLTEAKKLAYADRAYLGDPEF--VPSPWQTLLSKAYAQERRRAIEMGRASPLVAPGALAVPADDGATSYFCVIDKEGNAVSFIHSLSNAFGACWVAGDTGVLLNNR--------VGRGFSLVEGHPNVIAPGKRTMHTLNAYMAFREDN-------------QPQWNVQVLTRLLDFGLNPQEAAEAPRFTHFDNPPELRLEEPFLKDTVEELRRRGHRVGPYPAFLGGVQIIMVDPGVRMGGSDPRCDGGAYAY 552
31 0.000e+00UniRef50_A0A2R6F0L3 Gamma-glutamyltransferase n=4 Tax=Halobacteria TaxID=183963 RepID=A0A2R6F0L3_9EURY  ali  28  72.....ARSSEGMVSTVHPQATEVGAEVLRDGGNAIDAAVATQFALNVVQPHSSGIGGGGFMVVYIAEEDELYTVDNRERAPLGANAEMFLDDEGEPIPGEAVGVPGTLRATDVATKRYGTRYIDELIEPAIELAERRVTVDEYLAGAIEEEKGKF--NDAARERFAPGGEALDAGDELVQEDLAETFRLIRDEGIGALYGGEIGEAVADVVQDNGGSMTVDDLARYNVTIDTPEYGEYENVAVRTQPLPSSGGLTIAQILKLIEAFDLGGYERESAE----TFHALIEAFHLAYADRAFMGDKAFADAP--WQGLLDEEYLEERRGRITFDEATNAEPGDPWAYQPDRGQTTHFTTADSEGNLVSWTTTIEQLFGTGIVVPEYGFFLNNELTDF---------DAVPGGPNEVAPTKRPLSSTSPTIVFS-DGEPVFTVGSPGGTTIITTVAQIIQNVVEYDMDLAEAIAAPRIYADADP-TVFYEPDVPADLRERLHELGHELAEEPSELGNVQAVDRETGEYVGAADYRRNGSVIG. 631
32 0.000e+00UniRef50_N1MR85 Gamma-glutamyltranspeptidase n=15 Tax=root TaxID=1 RepID=N1MR85_9SPHN  ali  26  44....PVIGRKGMVASQSAPATDVGVEILRQGGNAVDATIAVAFAEAVTLPRAGNIGGGGYMVIHIAKDGKTITINYYGTAPRATTPGLLLGPDGKFDRSKSVAVPGTVAGMWEAHRMFGSLPWKKLVEPAIRLAAQGYRLSDGEAEATAGRREVMMKDPGAKAFFKRDGSAYKPGDIFKQPDLAWSLKQVAARGRDGFYKGPLAQKMVAGIRSGGGIVDEQDLADFKVEILEPIWGSYRGHDIAFM-PPTSSGATLAEIMNLLEHFPMKDYGWGSVQG----LHIMSEAMKVAGSDRRLIGGPDW---KTPAKGIASKAYADERVKLISPTASLNGANLDGNPYPHESPDTTHYSVADKYGNAVSNTYTLTASYGAHVVPQGTGVLLNNSLGNF------NWGREKGREANWPAPGKRLGSTITPLIVF-KDKKPWLVTGSPGGGYIISAMTQVLVNTIDHGLNIAEAAERPRIHQSSADDPLELEEGFSPDLKPLLEAKGHKVRLSDT-MGSTQSIMVEGEKFLGAADTRRP...... 568
33 0.000e+00UniRef50_A0A1D2NG32 Gamma-glutamyltranspeptidase 1 n=2 Tax=Entomobryomorpha TaxID=730330 RepID=A0A1D2NG32_ORCCI  ali  37  98...........AVCSDSSICSNIGKDVLQNNGSAVDAAVAMTLCVGVTNPQSSGLGGGLFMVIFNSTGSAMHAINARETVPSGVNPALYEDPSSSVNGGLAVGIPGEIAGLWEAHQKFGRVAWPDLVKFSQDLALNGFAVSKQLAVSLVQHKEKISGDPTLRSEFINTGEPWLEGDVMARPRLAVTLETLGAEGVQGFYNGTIAANILRDIQNANGIITAEDLSSYRPIWDTPISYSVTSNLTMYSPPFPSSGPVVALALGILDGFGRKRHEEMTVADIGVDTHRLAEVLKYATSYRSLVADPMYANTTGIEERLLSPVFATELRDKLEEYKTYDPRQYGAQFSLTEDAGTAHISIIGPDGDAVALTTTINLAFGAGFMGDASGIIFNNELNDFSLGTENDKFGLPGNPDNKIEAGKRPASSMAPLIFLNHNHVPVFATGGSGGLQILPAVISTSWRALYRYMDIKQATDYPRIAPDFYNTRLNYEYGLPKSVVEELKRRGHTVENPERYIGSVNSVCRTNGMILANADFRRHGEPAGF 639
34 0.000e+00UniRef50_A0A2M8PC98 Gamma-glutamyltransferase n=29 Tax=Terrabacteria group TaxID=1783272 RepID=A0A2M8PC98_9CHLR  ali  30  30...ATARGTGGAVASVDARATQVGIDVLKAGGNAVDAAVAVMAALGFIEPYSCGIGGGGFMVIYWKATGEVITIDGRETAPLSANVDMFKDPDNPISNGAAVGVPGTVALWARALERYGTKSLAELLAPTIELAERGIEVDAVFAAQTEQNKARFAAFTSTAELYLVNGEAPAVGSIHRNPDLARTYRLIAEGGVRAFYQGEIAKAIVETVQNPPGGMTLADLSAYDAIVRRPVVTDYRGYKVYGMGLPSSGGITPAQILNLIEGYDLKNLD------RAQAWHYVIEAMRLAYADRAFLGDPEYVDVP--LAGLLSKEYAAERRALIGDRAPFRAKAGDPLPFQKDGGSTTHLTVADKDGNVVSVTFTIESIGGSGIVVPGYGFLLNNELTDF---------DLADPHPNSPEPGKRPRSSMAPTIVLAPDGTV-MAFGSPGGATIITTVLTIAVNLIDFGLPMDEAIAAPRI-SQRNTGFTQVDSKFEEEIGKALIALGQDLRGTAE-IGAATGIVIPDGSMLAAAEPRRGGGSA.. 591
35 0.000e+00UniRef50_A0A2T7PJY4 Uncharacterized protein n=2 Tax=Pomacea canaliculata TaxID=400727 RepID=A0A2T7PJY4_POMCA  ali  37  98..........GAVAADHTDCSEVGRDVLARGGSAVDAAISSLLCTGVRQPHSTGLGGGVYLAVYQKKPQAVEMFDGREVAPLLATYDQYFNKSF-FRGGLSIAVPAEIKALWQAHQKYGRLPWKDLFAPAIKMAAEGHPLSHSTARALALDSSKLSSIPGLCRLFCKDGRTPKEGDVVFMPALAKTLEGFANHGPDYLYNSQVAAKLIEEVSSMGGLLKQEDLTRYQVLTAPPVSAQL-GDLTLHTLTAPSGGPVLSLVLRIISGFGLTPDDIRDPERSGATLHKMVESFKFAYADRLKIADP----------MMASADHADRLRQAIDPHRTYDPQHYNLSAASWTEEGTTHISIISPEGDAV---------FGSLVVSESTGLILNNHMADFAKSEGPVLDTQKVGSPNYVTPGKRPLSSMAPAIIVDKDGNPRLVLGSAGGVRITTTNAQVIARNLWLGQSLEDAINEKRLHHQLFPNVLVWEEGLNQDILTKLQSYGHETKPHTSYMAVVQAVARDTGEITAFSDPRKHAEA... 609
36 0.000e+00UniRef50_A0A098VZ35 Uncharacterized protein n=1 Tax=Mitosporidium daphniae TaxID=1485682 RepID=A0A098VZ35_9MICR  ali  39  83......VYTKAAVSSEVGLCSTIGKNTLLAGGSAVDAAIASLVCIGVVNNFSSGIGGGGFILIREP-NGTSIVIDFRETAPSLAYKEMFENDSQIVKGPLSIAIPAEIKGFSEAHKRFGKLPWKDLFWPSIKLAREGFRVPSELAMRLKKFESVILNEEGLSKTYTRNGSVYSEGEILKRGNLASTLELIAEQGADVFYHGQLAKTMVKNLRKAGAIISLKDLGSYNVVIRKPLEGFYRDRKVITAGIP-ASGSIVLQVLGILERFKLNR-------NTVENIHILVEALKHGYASRSLLGDP----VPPFKEQ------------------TFPPEYYDVQFEEKDDHGTTHVSVLDEHGMAVSCTSTVNLEFGSKVLDHETGILFNNEMDDFSLSSFNNSFILPPNPHNFIGPRKRPASSSSPLIILGRNSKVEAVLGGAGGSRIISATIQVVINLFDYKMNAEESVSHLRLYHQYKPDFVRSIPDFDTNIVKHLKSRGHIVNILSAYLSMVQLVYRNPGVIEAVSDPRKQGAPDGY 599
37 0.000e+00UniRef50_A0A2E6ZSQ6 Gamma-glutamyltransferase n=4 Tax=Acidobacteria bacterium TaxID=1978231 RepID=A0A2E6ZSQ6_9BACT  ali  27  48.DTRPNVAANGMVASPEPLATDVGLAILKAGGNAFDAAAAVQFALAVTYPTAGNIGGGGFMVGLLA-DGDTFALDFREEAPSAATTDMFVDPELSTNTHQGVGVPGSVDGMLKLVERYGTLDRQQILAPAIELARDGFPISYSLARSLKRSQ-RLRRFPSSIKTFGLDGDSPEMGNRLTQSELATTLQAIADHGRDGFYAGVVADLIVADMEANGGLISHNDLAAYEAKWREPLVFHHDRYELITHPVPSSGGMTIAQTLALLNMPVLQRIGYHSAEAVSM----VTEAQRLAFADRNWLGDPDFFDVP--VDRLLSREYMEQRRRLLQDGMAGRSE--GVSHGPAESEETTHFTVADRWGNVAAITTTLNSGYGLGAVAIGAGFVWNNEMDNFSAPGIPNQYGMLGAEANSIKPRKRPLSSMTPTIV-REFGDFYMTMGSPGGPTIINTVLQIYLNITLWGMDLQQAIDAPRIHHQWLPDRIDHEPALSAETKKELERLGYELRERRS-IGMAAGILKTPEGYYAGADRRGSGTARGY 584
38 0.000e+00UniRef50_A0A212L7K5 Putative gamma-glutamyltransferase YwrD n=198 Tax=Bacteria TaxID=2 RepID=A0A212L7K5_9DELT  ali  25  49.......STRGIVTSPNYLASQAGLEILRKGGTAVDAAIATASTLAVVYPQMCTLGGDNFWLIYNAKTGELKALNASGRSGEKATIDFYKSKGVSKRGYLAATVPGVVSGWGAAYE-YGSMKWKDLLASAIDYADKGFPVSTSLAFWSKINTNNLQRFDAFRKTYLPDGSPYTVGQVMRLPELAGTLRQLADKGSKEFYTGDIAKRIVADLQANGGLLTLSDFAAHKADWVKPIYADYRGYKAANF-PPNTQGMASLEILNVLNNFDIKAMGQGTAD----YYHALIEATKEAFADRKYLSDPDFVTIP--LDYLLSAQHGKEQAARIRMDKAAEVTPLDPK------GDTIWLGVVDSEGNAVSLIQSIYHDFGSGIVAGGTGVLLQNRGSFFS---------LDPNHVNHLEPRKRTFHTLNPAMLL-KNGKPFLVYGTMGGEGQPQTQAAIVTRVVDFGMTPQEAISAPRWYGRTWGNDLKLEGRIPKNVVDELQRRGHPVRSVEDYMGHAGAILVDSGVLQGATDPRGDGLAAAY 585
39 0.000e+00UniRef50_A0A1W9X972 Gamma-glutamyltransferase n=1 Tax=Desulfobacteraceae bacterium 4572_88 TaxID=1972444 RepID=A0A1W9X972_9DELT  ali  26  18..........GVVSVSYPQAAEAGAKVLENGGNAIDAAAAIQFALNVVEPQFSGIGGGGFMMIHLAETGETFILESREKAPAAATPDMFMSDGEATSSGIAVGVPGTLMGVATALEKWGTISLSDAMEDAIDLAETGFYVNEFLATAIARDETQYQ--PETAAVFRHDGTPYQEGELLRQLDLANTFKLIAENGTDVFYHGEIGQAIVQAQTRAGGRMTVDDLAAYDVKIRQPIVGDYRGYTMMSMSPPSSGGLTVVQMLKMMERFPLGDESQGFGFGATKTIHVMCEAMRLAFADRAWMGDEDFVAVPKV--GLLADAYVQKRSDLIQLDSRMDPSHDDPWPYQNDGAHTTHFSVVDKWGNMVSYTTTIESYWGTGIMVPGYGFILNNELTDFNGEPAQDAVAENPG-ANDVAPMKRPRSSMSPSILF-KNGKPVAAYGSPGGSTIINSVLQITLNLVDHGMNIQEAIDAPRMSHNASASWDRLEPGFQPEVVQDLIDLGHPFNLDDDSVGSVQGVYIDPGMQSGGADNRREGTVI.. 573
40 0.000e+00UniRef50_A0A2P6NL42 Gamma-glutamyltranspeptidase 1-like n=1 Tax=Planoprotostelium fungivorum TaxID=1890364 RepID=A0A2P6NL42_9MYCE  ali  34  67..PESILVEKGAVAADSRRCSIMGLNILKEGGNAIDAAVTTAICLGVIQPFASGLGGGCVINIRMA-NGTEEVIDAREVAPAASNMNMFDDNTLSKDGPLSIAIPGELKGLELAWQRYGRIPWARLFRDSISAARDGLAVNQLLSETMKKYKNDIRKY-NMKDIFAPRGPLLDQGEILQQPQLAETLQTIAEKGSSVFYEGEIARNMTRDLSELGASITLDDFKNYAPKITKPLYGSYRGYNISAAGPPFTGGPVILQTFNILEGF--TDLPELWKKNDPMATHLTAEALKFGFANRVGLCDPSFVDV---IENMTSKAHGETLRKRISSEKAYESSWYQDVVDPSRDAGTAHISVIDEERNAVALTSSINDAFGSFLVSPSTGVLFNNQMDDFSTPEHPHNINIPPSAANYIAPGKRPISSMAPLI-FHKDGKTRIIIGGGGGARCITSVMQVLNEILDGGQAMADALWRPRFHTQWIPDEIIIEPEYSEAVYQKLKEAGNKM-VTEDPSTAVQAVVIEDNMIEAASDPRKLGVPAGY 624
41 0.000e+00UniRef50_UPI000DD3AE56 gamma-glutamyltransferase n=1 Tax=Piscinibacter caeni TaxID=1861917 RepID=UPI000DD3AE56  ali  27  65.....VAFRGGVVAVSHPLAAQAGRDVLARGGNAVDAAAAIQFMLNVVEPQFSGIGGGGFMMIHLAHRHRTFAIDGREKAPAAATPTQFVRFTIASTSGLAVGVPGTLAVVDHALKRYGTIRLAEALAPAIEVAEKGFRINRFLAANIAGDGGRTGFQPETAALFRPGSVPLAEGALLVQPDLAKTFRLIARHGPKVFYQGEIGQALVAAQQAEGGRMTMQDLADYRVVERDPVKVDYRGWTVADMAPPSSGGLTVGQMLEMVERFPIGDASQGFGFGSPTTLHVMTEAMRLAFADRAWMGDEDFVPVPKT--GLLNPEYVASRSAMINSSRMATPAAGNPLPYEKEDSHTTHFSVVDKWGNVVSWTTTIEATWGTGITVPGYGFLLNNELTDFNFDPTKDAASGNPG-ANDVAPGKRPRSSMAPAIVF-RGREPVLAYGSPGGATIINSVFNVTLNLIDHGMSIQQAINAPRLSVTSATGTISCEPKFSVATQDALRSLGHGVNGCVSTIGSVQGVVIDTGRQYGGADPRREGTVLG. 645
42 0.000e+00UniRef50_A0A1E7WI41 Gamma-glutamyltranspeptidase n=1904 Tax=Bacteria TaxID=2 RepID=A0A1E7WI41_9BURK  ali  28  48.EKAGKSSQKFMVAAANPLATQAGYQMLKQ----------TQLVLTLVEPQSSGIGGGSFLLYSDGK--RVQSYDGRETAPAAADEHLFQDKDGKVVGGRSVGAPGVLRMLELAHQQHGRLPWKALFAPAIKLADDGFAVSPRLNALLKWDK-YLARDPVARAYFFDDGQPRPVGYILKNPELARTLREIADGGADAFYKGRIARDIVAKVSSNPGKLTAADIAGYQARERAPICSDYKAWTVCGAPPPSSGGIAIAQMLGILEVKDISPYKPVGGMLTAEGIHLFSEAGRLAYADRNYVADTDFVPLPKGVSALLDKRYLAKRAALIGDKSMGRANYGTPADTAIDKPSTSHLVAVDAFGGGLSMTTSVEDAFGSRQMVD--GFMLNNQLTDFSF----DSQDENGPIANRVQAGKRPRSAMSPTLVFDKTHRLVLATGSPGGSTIINYVAKVLVGTLDWQLDVQQAISLPNLGSRNGP--TELENRVSASVIAQLKARGHEVRETEQN-SGLQGIQRRGGKWFGGADPRREGVVLG. 599
43 0.000e+00UniRef50_A0A158QAB5 Uncharacterized protein n=1 Tax=Enterobius vermicularis TaxID=51028 RepID=A0A158QAB5_ENTVE  ali  35  54......RYSRAAVSSQSVYCSEIGRETMLKGGNAVDAAIATMFCIGVLDVLHSGLGGGHFMTIYNATTQRCSVINAREMAPKAANETMFVGPDRSSLGWLAIAVPGELHGFWTAYKRFGKIPWKQLVQPTIDLLEMGHPTSYIMARALDSEEDHIMKEPSLKQFINPTGRVYKEGEQITRKAFTRTLKAIAKDPVKLFYNGTLTLRFVQEFKKNGGILELSDFNSYRSKVDEVIYSKLSNGRYVCGPPPPSSSAVTQSIINVLDDYAVRNAGNFT---TASFLHYFVEASKFGYAVRSKLSDPQFNPESMKLKEITSEAYVNKLRSLIT-EKTHDIPYYGIDSTGFDDHGTTHASVVDYDGNAVSVTSTVNLLFGAGVGSESTGVIWNDNMDDFSSPGSSNYFGFKPSECNFIKPGKRPMSSMSPIIIYSTSHTEVLSIGASGGSRIISGVSYVALRSLHFNEDLQDSTFAPRVHNQLHPSKTFHERGVPEDQLEELQKRGHTLIEWNTPKTSISAVKRSRGTLFASAEYRCGSAPAGF 609
44 0.000e+00UniRef50_A0A2D5Y5L0 Gamma-glutamyltransferase n=2 Tax=Micavibrio TaxID=213485 RepID=A0A2D5Y5L0_9PROT  ali  27  40...QTASGSEYMVVTANPLATRAGYEILNRGGHAVDAMVAAQSMLGLVEPQSSGLGGGAFVLYYDAKEKRLTSFDARETAPGLAGPFLFYKNGKPQLGGKAVGVPGVPKLMADLHQAYGRKTWMELFSPSIRAAEEGFTVFPRLEAMIRAHSDDLKRAGAAADYFFNEGVPLRAGDVLKNKAYAETLKDIAFYGANVFYDGAIADDIIRIVQNNPGIMTAEDLRRYKVEPRKPVCAPYRVYKVCSMAEPSSGGLTILQILGMLEGFDLKALGPDSPQ----SWRLIAQASAMAFADRMYMADPDFVNTPGVL--LLDPAYIQQRRDFMAANRPLDIQAGKPPGNGIDKPGTSHISIIDQDGNIIAMTSSIESAFGSHLMTG--GFLLNNELTDFSFEP----FGADQAIANMVEGFKRPRSSMAPVIVFDLAGNPVLTLGSAGGSRIIGYVVQRIISVLDWDMDLQQSVAMAHTIARSA-KHIEVEEKSARS--KVLEENG-DVVVQGIMNSGLTGIAIQGDNLKGVADPRREGMAMG. 582
45 0.000e+00UniRef50_A0A0H5NDY1 Gamma-glutamyltranspeptidase n=9 Tax=Corynebacteriales TaxID=85007 RepID=A0A0H5NDY1_NOCFR  ali  29  56....PVETGSYAVSTANPIATEAACAVLRDGGTAADALVTAQLVLGLVEPQASGIGGGAFLLYYDAASGGIEAYDGRETAPAAATENYLRDRTEPRASGRSIGVPGVLRMLELAHREHGKTGWRELFDPAIALADQGFAISPRLAAQIAESAPELARDEAARAYFLPDGTGKPAGTTLTNPALAKTLSTIATDGADAFYTGVLAENIVAAVARTPGLLSTADLAGYQVKKRTALCSAYRAHEVCGMPAPSSGGSTVAATLGILENFDLAALGPQEVDRDAEAVHLIAEAERLAYADRNYVADPDFVPLPGNSAQLIDRNYLKQRAGLIDPQRTAQPGDLGPVPPQPPEHGTSHISVVDRYGNAAAMTTTVESAFGSFHMVD--GFVLNNQLTDFAADPVAPDGAPV---ANRLEPGKRPRSSMAPTLVFDRAGQLTHVTGSPGGAVIIQFVVKTLIGMLDWGLDPQQAVSAVSFGAGNSPTTVGGEPAIDATLVRRLRELGHDVSVAPQ-TSGLSALRRAEPGWIGGADPRREGAVLG. 626
46 0.000e+00UniRef50_A0A1H8HXF2 Gamma-glutamyltranspeptidase / glutathione hydrolase n=2 Tax=Proteobacteria TaxID=1224 RepID=A0A1H8HXF2_9BURK  ali  28  29.KTPVVTGTGGAVATISEPASRAALAILDQGGNAIDAAVAAAATLGVTDPFSCGIGGGGFMVIYLARDKRVITIDHRETAPAGFTPTVFQENGAPRDSGMSVGVPGTVRGWHEALDRYGSMSFKQVLAPAIAVATDGFAVSENFSRMAGENKAKFSMFPATAALYLKNGEAVAAGGTLRNPDLAKAYRELAAGGVKAFYSGKMARAVVDAVNRRGGNMTLADLANYEARLRQPVHSTYRGYDIYGMPLPGSGGIAIAEALNILEGYDLKSMPRARAE------HLYLEASRLAFADRAYLADPEYVDAP--VAGLLSKDYAALRRQQIDPAQARKPAAAGPVKMLKESAHTTHLTVSDKDGNIVAYTYTIEDWGGSGIVVPGYGFLLNNEMTDFDFSGPR---------PNVPEAGKRPRSSMSPTLAF-RNGKPAFSIGSPGGATIITTVLQTIVNHVDLGMAMPDALNAPRL-SERNGEATDVEPGFPGSAQAALEKSGQRWSATPEEIGAANALVFNDGTVTAVSEGRRHGI.... 580
47 0.000e+00UniRef50_A0A1Y6F283 Gamma-glutamyltransferase 1 Threonine peptidase. MEROPS family T03 n=2 Tax=Altererythrobacter TaxID=361177 RepID=A0A1Y6F283_9SPHN  ali  31  37...KPVTGS--AVSAADPRAEEAGRAMLAAGGNATDAAIAVMLALTVVEPQSSGIGGGGFM-VRGAADGSLITYDGRETAPAGATPEWFLAEDGSVLSGLSVGVPGNLRLAEKAHAEHGSLPWAKLFEPAIALAREGFAVNNRLAGYLERLPERAGGNAQSRAIYYPGGEPLAAGSIVTNEKLAQSLERIASEGADAFYDPDFAGEIVQTVAQAEGAMTLADIEGYAAKSRDGICSTYREYRICGMGPPTSGGVAVLQILGQLERFDLGALGQDSP----VTWHLFVEAQRLAYADREYLADSDFVSVP--VAGLIDKGYLAQRSALIDPDRAANVGPGRPEGAPPEEKGTSHFAVVDDAGTMVSYTSTIEGPFGSGLMA--HGFYLNNELTDFSRSPEVDGRLV----ANRVEGGKRPRSSMAPMVIWDPDGRPFMAVGAAGGTTIPVTTARAIIGVIDFDLSAEEALALP--FIMSFGEAVFLEEGWLADSQSAFETLGHTRLVVREAPIKGNAVLRENGRWVAARDPR........ 568
48 0.000e+00UniRef50_A0A2D7SKX1 Gamma-glutamyltransferase n=5 Tax=Alphaproteobacteria TaxID=28211 RepID=A0A2D7SKX1_9PROT  ali  26  69KEGKPVXSDKWMVVTANIQASKIAAKILKNGGTATDAMISAQLVLGXVEPESSGLGGGAFLVYFDNKTKEXITXDGRETAPLLIKEXIFQDTNGAVVGGKSVGTPGTPALLEEAYKRWGKTEWSLLFXDAINLSKNGFVISKKLSXSIXRSXXSXSKFLNTKTYFLPNGIPLKSGNIHYNKNYADTLKAFAKDGSKVFYQGFIANDIISTVNNNPGVLSLKDMHNYKVIQREPVCSKYREYEVCGMGPPSSGALTIAQILGIIENYDISKLGPKNPE----TWRLIGDASRLAFADRSYMADSDFVDVP--INELISKIYLNERSQLINRNKIEKIKAGNGKDHSIELPSTSHISIVDKYGNALSMTTTIENGFGSRLMTNG-GFLLNNELTDFSFKSFKNGKKI----ANNIEPGKRPRSSMAPTIIL-KNNKPVYILGSPGGSNIIGYVANAIISMIDWKYNAQEAASVA--HGINKFGTYYIEKDYMGKLLPSLEAMNYKVK-LRSFSSGLNIIHIDD-KLYGGSDHRREGIAVG. 612
49 0.000e+00UniRef50_J9K3U5 Uncharacterized protein n=3 Tax=Macrosiphini TaxID=33386 RepID=J9K3U5_ACYPI  ali  36  94............VVSNGGPCAQIGVDVMKNGGNAVDAAIATILCDGVVCPHQMGVGGGFIMSFYNATTKKVMSINARERAPAAAETNMFVNDPMSSIGGLAVGVLGAFKGYSDIYNLYGGVTWKSLFEPTIKLCEDGIKISKHLEISLKDDVELIKADPMLRQTFFDENRSKKTGEIYKLPKLAETLRTVAEEGVGAIYNGSLTSKIVDDLKKVNGIITKEDLAEYYVEIEESFSVKLKNGYTIHAGPPPGSGIILAFILRVLDG-------ILPAPNAGLDAHRLVEAFKFGYGERTHLGDHNFVEVSKIYDKVKSDSYMDSIRNKISDNTSSDPKYYGADFNMPDNHGTANLATIDRMGNVVVCTNTINTHFGSGFMSPNTGIIFNNQMNDFSTPGVSNHYGIPSSPSNYIKPGKRPMSSMCPTIFTDENGDFALAVGAAGGSKITLATSYASALRLWHNKTLKEVIDKPRIYHQLMPMQVQYEYGTTRDVVQKLKDIGHTVIRLKDNGSAASAIARSPGMIEAMPDFRRKGNSSGY 623
50 0.000e+00UniRef50_A0A2N6ES69 Gamma-glutamyltransferase n=2 Tax=Proteobacteria TaxID=1224 RepID=A0A2N6ES69_9DELT  ali  29  1...........MVVTANPLATEAGAKILKLGGTASDAMIAVQTVLGLVEPQSSGLGGGAFVVYFDEKTGKTTTIDAREKAPAAATEDRFLEHGTPIQSGLSVGVPGVPRLMEYMHNRYGKLPWQRLFVTAKTLAQGGFELTERTSSQVADDKRLFFRDPAAFSYFVNSNTAKPAGTLMRNKAYANTLEAIAKKGARTFYRGPIAQDIVAAVRNIPGDMTVADLQNYQVVEREPVCFDYRGHNVCGMGPPSSGGLAIGQILGVIEK---RPDLMGAAPLAVDTVHLFAQAGRLAFADRNYVADSDFVTVP--VEGMLDKDYLAERAALIDMGAAAPGIPYAPDGAAKTS-GTSHVSIIDRYGNALSMTTTVESSFGNGVMVR--GFLLNNELTDFSFS-FEDADGAP--IANRVQPNKRPRSSMSPTIVFDSNGHVEFVTGSPGGSRIIGYTAQSIMNIIDFGRDPQEAINIP--HYMNRNGRTDLEAPIPETLAAELIARGHSIITQASGLSIIQVGESDTGKFIGGADKRRDGAVGG. 567
51 0.000e+00UniRef50_A0A0E1RNS7 Gamma-glutamyltranspeptidase n=4 Tax=root TaxID=1 RepID=A0A0E1RNS7_HAEPR  ali  30  7...........................................................................................................................RKILEPSIKLAEEGFVVSGTLASTLKEETETLGKWESSKKIFFKDGRPLIAGERLVQTDLANSLRQIAKEGSKAFYEGDIAKKIVAEMEKHNGLITLDDMKGYQAVERKPITGEYRGYKIVTMPLPSSGGIHLVQILNMLENYPLNEFGSNS----AKTIHHLAETMKLAYADRSYLGDPDFVKVPA--KGLTSKEYAKSLIQGIDEEKARPASDIKPGQPQYESDQTTHYSVMDKEGNAVAVTYTLNLNFGSGIVAEGTGILLNNEMDDFSKPGVANAFGLIGGDVNAVEGKKRPLSSMTPTLVLKED-KPWLVTGSLGGARIITTVLQSILNTVDHGMNPAEAIVTPRVHHQWLPDELRIEEGISPDTLKLLEQKGHKINVKAP-MGRIQIIQAREDGFYGYSDPRNDGRTIGF 418
52 0.000e+00UniRef50_D5DC05 Gamma-glutamyltransferase n=102 Tax=Bacillaceae TaxID=186817 RepID=D5DC05_BACMD  ali  24  18...ETAVGKTGMVASAHPIATDAGEQVLKAGGNAIDAAIAVQFGLNVGEPMMTGIGGSGFFMVYHNESKTTKIFDGHSQAPKAAYPEMFLDEDKEVTHATAIGIPGILKAMEAARKEYGTKPLAELIEPAAKAAEAGVETNWVLGDILKTYAYRLGEH--AKQLYSPNGKPMQEGDMINKKDLAKTFRILQEKGIEAFYEGEIAEAIISTIKEHGGFMELSDLKEYEIKIDEPVWGDYKGYRIASSNMPSAGGATVLQILKLLEDFDVSQYDVKSWEK----YYLFAEAMRIAFSDKAFSGDPAYSDIP--LKGLLNDEYIKERQKLINWKHKNEVDFGNPWDYEKELSETTHFTVVDRWGNIVACTSTVEHPFGTGIMVKDHGFLLNNELTDF---------DAIPGGLNQADAGKRPVSCKSPTIVF-KDSEPVLTLGSPGGPTIVGSVFQTLMNVLDYGMDIKEAIEEPRIFNS-TGSLIGWEAGVDMNAKGELEAMGFNFGDEPFPIGNVQGIQIDKGRLFGAADSSREGKATG. 559
53 0.000e+00UniRef50_A0A2E5UEM8 Gamma-glutamyltransferase n=1 Tax=Phycisphaerae bacterium TaxID=2026778 RepID=A0A2E5UEM8_9BACT  ali  32  20......RFEGGAVASDHPXASQAGAXXLEQGGNAVXAAVATSFALSVVRPFSCGIGGGGFMLI-ASEEMXPVALNYRETAPINTLPLMYQD-HSSLLGPFAVGVPGXVAGLLDAHERYGTLPREVVLAPAIELSKQGFXPDDAXARALXSALDGSGAYAEQLRXLFDQQEVLQLGQSLV-------FERIAEHGKSGFYEGMVAEAIV---RATDGWLTLEDLKTYTPVWVEPIVSYEHDGVVLAMPPPSSGGVAVGQVLSIMERLNAFELELHSPD----YCHLYVESSKHAFADRAHMADPLFSXVP--VDXXLSESYLXELAQSXDRERTKETTEYGSQVXLPDDSGTSHICVADLDGMVVAMTETINTYFGSKVIVEPYDFVLNNEMDDFSSPKGANTYGLVQSEKNLPEHGKRPLSSMTXVIVLDGE-KPVFLVGASGGPRIISSVLQVLIHHLWYGMSPVDAITKERLHHQWSPNVLYVESRLP---LNELKERGHEIKTRRD-IGIVQAIAIEGSIQRPASDPRKGGKPAG. 535
54 0.000e+00UniRef50_A0A2A4M0T3 Gamma-glutamyltransferase n=7 Tax=Bacteria TaxID=2 RepID=A0A2A4M0T3_9BACT  ali  25  53..RSVVMAPSGMVATSHTLAAQAGVEVLKRGGNAIDAAIAANAVLGVVEPMSCGIGGDLFAIVWDAKSRKLYGLNASGRSPLGISRQLIRERGIPLRGPLSWSVPGCVSGWQALHDRFGKLPLAKSLAPAIRYARDGFPVTQIIAGYWKSGEVILSETPTASRAFLKDGRAPGEGERMTNRDLAKVYRAIGKEGAKAFYEGWIAGEIVRYSESVGGLITLRDLKQHTADWVEPVSASYRGYD-VWELPPNGQGIAALQILNVLEQHDIAAMGHNSAD----FIHLYTEAKKLAFADRAFYADPQ-VEKNLPVAVLISKPYAKRQAKRIDMAKALRVPAGDPRLAK---GDTIYLTAVDKDRNVVSLIQSNYYGFGSGHVPGNVGFXXQNRGTLFAM---------DENHHNRLEPNKRPFHTIIPAMVT-RDGKPFLSFGVMGGDMQPQGHAQVLVNIIDHGMNVQAASDAARVRHDGSGGRLIVESGVSDAAVEELKKRGHNVSR-GGAGGGYQAIRIDTGLLHGGSEARKDGAAIGY 586
55 0.000e+00UniRef50_A0A1W2WJ85 gamma-glutamyltranspeptidase 1-like n=1 Tax=Ciona intestinalis TaxID=7719 RepID=A0A1W2WJ85_CIOIN  ali  38  96.......YTSAAVAAGQAECSKVGVGVLEEGGNAVDAAIATLLCQGVVEPHFCGIGGGFFMTIYNKTSRTSTVIDARETAPQASTADMFVGNQKAVKGGLSVAIPGQLKGYSYAYKKYGGVSWARLFEPAIHKARAGFYVSGELAAKLEQNKLSVMQQSTLCELYCNNDKVIKEGELVKNTKLADTLEKVKKNGHEVFYSSPMVDQFVHDINKHGGIVGKEDFVDYTVIERTTLHVPLTNGLTLIVPPLPAGGPILSIIMRVMDSYKITPKLFAS--NKALHWHRVVESFKHAFGYRTRFGDPNFNPVNHLVSNLLSEKGILNITSKIFDNQTFPPAYYGAMVNNLTESSTSHLSVLSPSGDAVSVTSTINYHFGSFVMSPTTGVLFNNEMNDFNTQDNIG--------ANKVEPGKRPQSSMSPCVLVDSTHQVVYIFGAAGGKRIPTAVAISLIRLLYFGNDFDDAIQLPRLHHRLIPDVLMYEEEFDQNILNQLSALGHKLASNPNHTSEVNGIKNHIDHIHAYSDARNEGAADGW 629
56 0.000e+00UniRef50_Q5KJX7 Protein-glutamine gamma-glutamyltransferase, putative n=21 Tax=Cryptococcaceae TaxID=1884633 RepID=Q5KJX7_CRYNJ  ali  31  4..........GAVTSEQIRASDIGTTILKAGGSAADAIIATVLAVNTLSPYHSDIGGGGFAIVKEPDSGQVKCLDFRQCAPEGATPELFKTSNTSTVGGLAVAVPGELKGLEELHKAYGTLPWSRLFKESIELAEGGMEVRGDLYDFITQEANWMMEDPTYTSLITKDGQAIPIGSIWKRPEYATTLRKIAAEGAAAFYQGEIAEGLVKAVRARDGVMTVDDLKNYKLKWREPLSTKFKDY-TLYAPPAPASGAIWLSVMGMLSQFEPAGYG------SVTDLHRLTEALRLAYGQRTALGDPAYIDVEEKQRDWLTEKRIKARARMIDENHTKEPDYYKPPKVALDDNGTSNITATDSSGLTISITTTVGLGWGSRIMVPGYGFVLNGSMDDFSVEGRPNGFGYEPQVTNYVAGGKRPLSSSCPYIITNSTGKVIASGGAAGGSTIISSNAQVALFVLVYGFSASQALAANRLHNQILPNVTKVEEGFSEEQVEGLKQKGHVIEWVDKSFSTPCVMVWTDDGWEGDGDPRKH...... 543
57 0.000e+00UniRef50_A0A257CRN1 Gamma-glutamyltransferase n=4 Tax=Proteobacteria TaxID=1224 RepID=A0A257CRN1_9BURK  ali  31  55........RTYAVAAANPLATEAGQQMLRAGGSAVDAAIAVQMVLALVEPQSSGLGGGAFLIHFDGK--QVQAFDGRETAPAGVTATELMGSNGAIVGGRTVGVPGTLRMLELAHRQHGRLPWAALFAPAIRLAQQGFAISPRMASLVADDK-HLHKDPVAAAYFYDDGKPWPAGHVLRNPELADVLQAIAKQGADAFMQGEVAQAIANKVQGNPGKMTLKDLADYRAVVRAPLCFDYHTYRICGMPPPSSGTLAIGQILNLLGNTPTANVPLQAGLPPADWLHLYTEASRLAFADRHYVADPDFVQPPASWQSLLQPGYLAQRAKLINTARMADPAPGKPGPSDAREAGTSHISVIDAQGHGVAMTTTIEDAFGARQMVNRGGFLLNNELTDFNFAP-TDAAGLP--VANRIEPGKRPRSSMAPTLVFDKTGQLLISAGSPGGAVIIHYTAKTLYGMLNWGLNAQEAINLPNFGTLGGPAFLEA-GRFAPTTAQALRTRGHKVYEVDLP-SGIQAIARTPQGFFGGADPRREGVVLG. 614
58 0.000e+00UniRef50_A0A0F7SS40 Gamma-glutamyltransferase n=1 Tax=Phaffia rhodozyma TaxID=264483 RepID=A0A0F7SS40_PHARH  ali  33  26........KKGAASCEVQLCADIGASFLQKGGSAADAMVGMVACVGTIANYHSGFGGGGFALVRSP-DGTFESIDFRGAAPGALNGTIFEDDPSTMVGGLAVLVPGELRGLEAIHKKHGKLPWKDLFQPAIKLASDGFEINRDLFVAMNYNESFLITDSELSKVFAPNGTLLSVGSLTTRPTYARALQAVADHGPDAFYNGKIAEDIVASVRKNGGVLSLDDMANYQAHVRPALSMRYRNH-TVYAPQAPSSGSLVLSTLNTMNGYEPFGRE---ADPSDVNIHRLVESMKFAYGERTLLGDIGYTNASTLQRAFLLPSTAQHVRSLINDHTTHEGDYYDPGWEVLDDKGTSALVVGDEDGLAVSVTTTVNLYWGSRIMTPEYGVILNDGVDDFSVKGRRNAFGYIPSPANYIVPFKRPLSSMSPLIIDDPSGKFMFASSCAGGSRIISAQIQMVLNAVDRGMSALQALTAPRLHDQVYPAVTAIEKGFSMETRDYLSSLGHNVTYVPTGLSVACAVKFSPEGWEAAGDPRK....... 587
59 0.000e+00UniRef50_A0A2E2DZL5 Gamma-glutamyltransferase n=1 Tax=Rhodospirillaceae bacterium TaxID=1898112 RepID=A0A2E2DZL5_9PROT  ali  30  67.ETKAVTAQDYMMVAAHPVAAQIGAAILDDGGSAVDAIIAAQIALTLVEPQSSGIGGGGFLLVWDAETGGLTSYDGRETAPALGSGDYFRPFMEAVTGGASVGVPGLLRMLELAHQDHGTLPWGPLFTPTIQLAENGFPISPRLNGLLQ-NAPYLKDMEPAGSYFYDTGAAHPVGTILRNPDLARSLQAIATGGADAFYTGPLAEEIVSAVQRNPGALSLTDLANYSAKRRDNLCLTYRVYQVCGMAPPSSGGSTVLQILGLMENSDIRQAEPHSTDG----IQIFGEAMRLAFADRRFLADTDFVSVP--LKEMLSPAYLVRRARTMDFSHAVPREAGNPTDDSPELPSTSHLVAVDRTGSVATMTSSIETGFGSRVMVG--GFLLNNQLTDFAWSDVK--GGLP--IANRYEPNKRPRSSMAPTLVFGPDGQPRLALGSPGGSRIIGYVAKTVMAVLDWDMSLQRAIETPHFQNRNGAMEIE-EAPNLDGIAATLTARGYDIQR-PAMASGLHGVEFIGGQYISGVDPRREGLAVG. 615
60 0.000e+00UniRef50_A0A165LJL8 Gamma-glutamyltranspeptidase n=45 Tax=Bacteria TaxID=2 RepID=A0A165LJL8_RHOFA  ali  27  74....PVETPSYSVSTANPVSTAAACEVLRDGGTAADALIVAQTVLGLVEPQSSGIGGGAFLMYYDAASGEVQSYDGRETAPMSATGDYYIDDPDARSSGRSIGVPGVVRMLEQAHEDHGDKPWGDLFRPAIELADNGIEISPRMASSIADSAPKLALDPASKDYFLPDGTGKPAGTVLNNPAMSKTLSSIATDGADAFYTGDIAQAIVDATARTPGQITVDDLAGYEPKTRTAVCTPYRDHDICGMPGPSSGGIAVASTMGILSNFDLAQMDANGGKPIAEAVHLISEAERLAYADRKYVADPDFVPLPGSPDALLDPEYLSSRAGLIDEGKTAKPGDFGPASSTDPEHGTSHISIVDGEGNAASMTTTVESAFGSFHMVD--GFLLNNQLTDFSAAPVAEDGTPM---ANRVEPGKRPRSSMAPTLVFDRSGDLVLVAGSPGGSVIIQFVVKTLVGLLDWGMDTQQAVSMVDFGAANTPSTVTGEN---DPVVVTLREKGHQVSVADQS-SGLSALQRTDGGWIGGADPRREGEVLG. 639
61 0.000e+00UniRef50_A0A2D7BVZ8 Gamma-glutamyltransferase n=5 Tax=Bacteria TaxID=2 RepID=A0A2D7BVZ8_9GAMM  ali  25  27...HPTVSDKGMVVSQNYIASDIGAEILSKGGNAVDAAVAVGFALTATLPRAGNIGGGGFMLIYDAKNQTIVSLDFRSMSPELATPDVFRKDGLSRSGYKAIAVPGTVDGLFTAHELYGSMDMKDLIQPTIDLCIEGIPLTNDLYGAIQNTKT-LTRDKESTRVYLDEN--LKVGGKIKLLDLAETLIKIRDEGKAGFYDGKIADKIEKAMIENGGLIRKSDLKRYKTNITQPISIEYRDKSIFAQGPPSGGGVVILTALQILKNFNYSDLKPNS----AQYLHILAESLKHGHQNRSFIGDPKFYSAP--LEDMLSDDNGIRRAKEIDFKKTTSSDRINIESDYKESEDTTHYSIIDDSGNAVSVTYTLGYSFGSGVTIPGTGILTNSQMNNFAS-----NYGLEKSEANKLDPFKRPMSTMSPVMVFDKDGSLELITGSPGGSKIPAINLQVLINVIDFDLDIGLATMMPRIHQDWPYYSLQVEKTLNNDTKRILETYGHKPKESKT-MGSTQSIHIKDGVNFGFADLRRP...... 558
62 0.000e+00UniRef50_J4KS56 Gamma-glutamyltransferase n=47 Tax=Bacteria TaxID=2 RepID=J4KS56_9GAMM  ali  25  27...HPTTSSNGMVVSQNALSSNIGTQILDMGGNAVDAAVAVGFSLATTLPRAGNLGGGGFMLVYIKDKNEIFYIDYRSKSPRNSSIEKLLGAKKIPYTYLASGVPGTVYGLLEAHKNFGVLTLEQIMKPVIEQAENGIVVSSDLNYVI-DVTPQLRTDPESFSIFFDNGEPLKEFSIMKRPDLANTFKEISKHGAKGFYEGIVADKIVEAMEKNGGLITHDDLKNYKSFFRMPIALNYKGHMVYTAGPPSGGGITLLTALGVLNNIDIKKYKSDSTK----AYHFLAEALRRGHNNRSHVGDPEYFDVP--VSKLLSSKRIKELSSSIDSNKASSIEEVIPFKPRINSKDTTHYSIVDKNGNAVSNTYTLGLSFGSGVTIPGTGILMNSQMNNFAYRGDKNDISRGASPGNRFEPGKKPMSTMAPTIIFDKNNELFLITGSPGGSDIPAAILRVITGVIDFDLDIGEATMLPRIHKDWPYVGLEHERAVSRDIVRRLKSMGHE-TEYENTIGSTQSIHIINGVNYGFADLRRP...... 561
63 0.000e+00UniRef50_A0A0P5VP67 Gamma-glutamyltranspeptidase 1 n=4 Tax=Daphnia magna TaxID=35525 RepID=A0A0P5VP67_9CRUS  ali  41  1............................................................MTIYDPVERQTRCLNAREVAPINAHEDMFKGNSISQRGGLAVAVPGELAGYWAAYQQYAKLPWSRLILPTAELIEEGIPVNKHLENSLKEFQKLIEAEPSMR-IFVNEGKLKSYGDIVKNSRLAHTLRAIAHYGIDIFYKGTLGRRLVEDIQKRGGIITKEDLIQYRPEWMDPIKVELNNNITLYSMPPPGSGVLTAFMLNILDG-NLVGDNASKVSHHLINYHRIAEAFKHAYAQRTKLADPHFVPVHELTSNLSSEVMAAETWAKISDLFTFDPGSYGAVTYSPDDHGTSHISVLDGNGMAVSLTSTVNLKFGAGWISEQTGILMNDQMDDFSSPNVINYFGLPPSPANFIKPGKRPMSSMTPTVIVNSTGRVRMVTGAAGGTKITTATAYSIIRNLWFGETIKEAIDSKRMHHQLFPMSLEYEKGFPSRIVNDMMTRGHRTSKLHGDGAVVCGIAVEDGYIYGNSDWRKSGDVDG. 505
64 0.000e+00UniRef50_A0A210QPN6 Gamma-glutamyltranspeptidase 1 n=3 Tax=Mizuhopecten yessoensis TaxID=6573 RepID=A0A210QPN6_MIZYE  ali  40  78..........GAVASDHETCSEIGRDILARNGSAVDAAIATLLCDGLMSSHSMGIGGGSFFAIYDAKTKRTKTINAREAAPAALTKSLNTG-TGPRSKVLSIGVPGEIRGYWEAHQRYGRLPWKELFLPTIGLAEDGHYLSQPVHRAITVLREKLSDNAEFCKIYCDDGKTVPEGALIKMPRLAQTLRGIAENGPSYLYEGPVADAIMREIQEQGGVMTKKDLAEYIPVVEDGIAVDL-GDVTLLTMGAPSGGPVLGLILDILKGVLKGKSDMATSQMQSATFHALIEATKLAYGERWQLADPAFVDVKQVVNKMISGSFATFLREKLDLRRTHDWSYYSNITYQPKDQGTAHVSVLSPDGSAVSVTSSINYYFGSTIVSQSTGIIWNNEMSDFSKDN----------PRNFVEPGKRPLSSMVPAIFVDKAGEVQLIIGGAGGATITPVVSEVSAFLLFLKDSVDEAIRRKRLFQRLDSNTLQFEKGFQQDIANDLATRGHQVVEYGGYMAVVQAIARNPGEITAFSDERK....... 598
65 0.000e+00UniRef50_E4XKP5 Uncharacterized protein n=2 Tax=Oikopleura dioica TaxID=34765 RepID=E4XKP5_OIKDI  ali  39  49RESETSIFKNAAVATDSTLCSSLGKKILKMGGNAVDAGIVTASCLGLQNFHSCGIGGGSFFMVYNGLDDQS-FINCREKAPAAASEQMFVNPENSTYGGLSIAIPSEMACLAEAHTRYGSLEWSVLIDEIVTLLENGIIVTTVQEKSLADHAAKCTN----AEMFFNDGQIKKAGDVIYNSKLADTFRKIGKD-KNAFFKGALGQDVVDDIQENGGIVTIQDLTSYKPNVEMPKNIDI-GDMRFYIPSAPSSGPVFQFIFNIFANFE--KEGVL-PMDQLDFNHRIIEAFKFAYGKRSALGDPKFITNQTTLENLPTMNFAKQFADKIDDE-THPLEFYEPEFEIVEDSGTSHMSIVDANGMAVAITSTINTILGSKMIGKRTGIIFNNEMDDFSTPGVSNNYGLPPSPSNFIKPGAQPLSSMCPIIVVDKVNTMIHATRASGGSQITTATANVAIRTLLYGDGMNEAIQRARIHHQLLPNEIRKEDRFDLNMIKELEKKGHVYYNGTGRGAVVQGILRRNGLLEAVSDVRKGGKPDGY 582
66 0.000e+00UniRef50_A0A2E6DJ26 Gamma-glutamyltransferase n=2 Tax=Proteobacteria TaxID=1224 RepID=A0A2E6DJ26_9DELT  ali  28  21.EARPVFGTKGMVSTAHPAATDAGVKMLRLGGNAADSAAAAAFALAVVEPYSSGIGGGGFALIKFGS--ELHFMDFRETAPAQARHDMYIEDGLSRDGPLSVAVPGAVMGYLELQEKYGKLKRRDILKPAIKFATKGIRVDSRFQEYLNWRLEQLRADPESAKIFLDKGQVPEVGHIIKQKDLAWTLRQIEKYGAKAFYRGKVAKRLAKDMKNRGGILTLKDLKEYKVRYRKPLVGSFRGHAIASSPPPSSGGQIVLTILHALEN-----ISAKTDWRDPQTLHKYIEISKRAYADRALLGDPGF--VPDITPDLIRKDRAKLLTQMIKPQAAINIPAGQGADHIKESNDTTHLCTLDKEGNAVSMTTTINYGWGAALVAKGTGVVWNDEMDDFAVPGTPNAYGIVGSTANAVMPGKVPLSSMSPTLVFAGDSPLYMVVGSPGGSRIPSTVAQAIWHFIDHGADAERALGIGRVHHQHLPDTVFIEPSLEPATRQVLESLGHRFTVKNPW-SNATLIAVDPEVRSAAADPRGVGTAAA. 578
67 0.000e+00UniRef50_A0A1V6BND6 Gamma-glutamyltranspeptidase n=1 Tax=Tenericutes bacterium ADurb.Bin140 TaxID=1852919 RepID=A0A1V6BND6_9BACT  ali  26  47...RDVISSNGVVSAASPYAAKAGLDVLKAGGNAFDAAVAVSFALGVVEPNASGIGGGGIMVAYEAKTGQFISYNFREFVPAAGEASAFPNRDADVDGIKASGVPTQVIGLLTVLENHGNLDRQTVMAPAIRYAKDGFPVTPELANAISENFNKVMRSEETKNVFADMGTPLQEGDLLVQANYGKALEMIAQQGASAFYEGEIADAIVALQEEKGGLITHDDLNNY-PIMEQPIQGTYRGYDIATVTSPSSGGMILLEALNMLEVYEISGMKRDSAEL----LHVLAVAQQLAYGDRKYIADTKFVDVP--IAGLINKQYAAERWQKFDPARAYDNDYGNPWPYNTEHYSTTTFSVVDKEGNIVSVTQTINYFFGNGLVVPGFGFFMNNQLSGFSFTS---------SSASYIQPYKQPVSHIMPTIVM-KDGNPYATLGSPGSMRIPAAVLQVLINMIDFGMNIQEAIEYPRIYCYAVGSDLYLEQAFDDDVRDGLRALGYNLIDIDLYFGGVQGVRIDGNKMHGGADPRRDGKALGY 607
68 0.000e+00UniRef50_A0A2D9XRH8 Gamma-glutamyltransferase n=3 Tax=Candidatus Marinimicrobia bacterium TaxID=2026760 RepID=A0A2D9XRH8_9BACT  ali  26  24........TQGGVSSTSSLASQIGIDILKQGGNAFDAIVATGFTLAVTSPSNGNLGGGGFLVAYT-EDGEAISLDFREKAPALSYETMFLDEDLALNSHKSSGVPGTVNGLLKIFNDYGSFTLKEIMAPAIHYAENGHYINATDAKGFDSYKALFLTDAGSTKIFFKNGDLWKPGDLLVQKDLADTLKRIAQYGKAGFYEGETAELIIEEMNANDGFITKEDLFNYDSVYRNPVVGTYRGNKVISMGPPSSGGALLIQMLNMIENFEIKSMERNSTE----FVHLLTEVQRLAYADRAHLGDPDFWPNPIPM--LTSKEYAKERLALISMNSATRSTKIAAGKTSKESIETTHYSVIDNQGNVAGITTTLNLSYGSKKIVDGAGFLLNNEMDDFSSPGTANAFGLIGYEANAIQPFKRPLSSMSPTVIIDNEGNPIVTIGAAGGSRIITGVLQTIISIVDHGLNIQEAINVPRTHSQWLPDNVRYEKDLTQQTISELEALNHIFEHNGTAENGIHGVHLKNNKFITGFDKRG....... 586
69 0.000e+00UniRef50_A0A0D7ARE5 Gamma-glutamyltranspeptidase n=2 Tax=Fistulina hepatica ATCC 64428 TaxID=1128425 RepID=A0A0D7ARE5_9AGAR  ali  34  5.........RGAIVCELDTASEIGAQVLRDGGNAADALIASVLAVGTLACYHSGIGGGGFALVRRP-DGQYECLDFRSAAPRAAHPSLFIGKPESGVGGLSVAVPGELRGLGELHRKYGKLPWRCLVEPSIQLARDGFPATKDLHGPQTDERSWIHKHPALSAMYVRDGRFVSEGTTLYRPEFARTLEKIAEKGADAFYEADIAQDIVDAVRKEGGVMTVEDLRDFKVRYAKPLCINYRGY-TVTATSAPSSGSIVLQALSILSNF--KPAGPGT----IVDTHRLIESLKFAYAHRTLLGDPPYVKLDQAQDASIDTERGKHFASLIDDSKTQPPGFYNTGLEIKTDHGTSHIIAADDDGLVISMTTTITLYWGSRIVVPSSGIVLNDSMADFSVQGQPNFFGYLPTPANYIEGGKRPLSSTSPFIVDDAQGCFCYSGGAAGGSRIISCNVQQARNFLDYGMAPADALGQPRLHDQLAPQETHLEDRFDDATADALRALGHPVMRIPRAESVGCSISFNANEWVVSGEPR........ 533
70 0.000e+00UniRef50_A0A2G6S380 Gamma-glutamyltranspeptidase/glutathione hydrolase n=1 Tax=Rhodanobacter sp. TND4EH1 TaxID=1907399 RepID=A0A2G6S380_9GAMM  ali  29  61....................TEAGFEVLARGGNAVDAAIAVGSALSVVQPEASGMGGGFLAVIHDATTGKNTFIDAREMAPQAVSEKDYLDRDTSLNGPLAAGIPGFPAGLAYMAGKYGKLPLGVSLSPAIRLAEAGFHPSGSLVRSIGHKADVLRRYPASSAKFMPGGKPPLETGLFRDPNQARTLKALAEKGADGFYKGAVAKELVKSVRAAGGTWTLTDLANYQAKERQPIELNYAGYKVITAPPPSSGGVAIAEMLNIIAPLDLKSMD------EAHRIHYLVEAMRRAFRDHNYLGDPDFVKMP--LDMLLSPYYADGLRQSILPEQATRSAWLPSVHAKDPGMHTTHYSILDKDGNMVSMTATVNTTLGSSFVAGNTGILLNNEMDDFAVSGQPNAFGLIGGSANAPVGGKRMLSSMSPSFVIGKDR--LAVIGSPGGSTIITQVFEAMLAFID-GKDAGQITAQKRIHHQFLPDRIDIEKGIPADVLAKLKAMGYEINDSESW-GNMNVVVWDGNTKTAASDPR........ 571
71 0.000e+00UniRef50_A0A090MYY0 Gamma-glutamyltranspeptidase family-containing protein n=5 Tax=Strongyloididae TaxID=6246 RepID=A0A090MYY0_STRRB  ali  35  49.......FRNAAVVSENLLCSEIGRNIMFEGGNSIDAAVAIQICIGVTNFHSSGIGGGFFMVFYEQKTKKCITINAREAAPLQSSKTMYINETESLIGWKSIGVPGEIHGLWTAYKKYGKVSWSKLLEPSINLAYNGFPISQSLETFIEIRSKQLENFPELKEYLTNTKQYYKDGDIMKRPSLAKTLQELANDPTYLFYKGKIGRIISRDITQNGGYITLQDLSEYFSIVDDPILVDSLGNLTMCGCKPPSGFIVTQSIISIIEKYKRKKIDIDNPKL----WHRIIETQKFAYAQRTKLGDMNFVETAEFINYMKSDKFIKKVLNDL-PEKAQNLKYYNDLYFDPLDNGTSHLSVIDNEGNAVSLTSTINREFGSLCLSKELGIVWNDQMDDFSSPNYSNSFGYPPSPSNFILPKKRPMSSMSPMIIYNNTGKVRLVIGASGGSYIISSVAQTTIRNLIFNQTIKEAVDAPRFHNQFIPSKTKVEYGVPDSITTILQVKNHQLMKIPKLKNHVAALEKEDGFIYGATDPR........ 583
72 0.000e+00UniRef50_A0A2E6NZC7 Gamma-glutamyltransferase n=5 Tax=Rhodobiaceae bacterium TaxID=2026785 RepID=A0A2E6NZC7_9RHIZ  ali  26  25........SKSIVVTSNPYASKAAAXILRXGGSAVDAAITAQFVLTLTQPQSTGLGGGAFMLYWDXSSEKLYALDGREKAPASASPXLFLNKDGAVVGGISVGVPGMXRFLEQAHKKFGKLEWSVLLEYPIRLAEEGFELSPALHRTL-SFLPDLKKIEPTSSYFYRENRPLPIGTILTNAEYVKTLKRIAKFGPEEFYSGKTANLIISAVNNSPGLITLEDFANYTAVWRDPICGLYRKYKVCSMPPPTSGGITMLMMLKMLERFXIESEHPNSPN----FIHLFSEAGSLAYADXDYIADPDFVXIP--VNGMLNEDYISERSKLIXKEXSLDPKPGKPKGHTKFSPSTSHLVIVDNFGNSISLTSTIEGPXGSHLMAG--GFMLNNELTDFSLIPKKNGLFV----ANRVEANKRPRSSMTPTIIFNPEGEIYALTGSPGGSSIIGYVTKSVMAMIDWDLSPQDTVSLPHF--MRKGENTELESGTDIRYKQFLEKKGHXVVIIPK-VSGLXIIKKKNKGFIGGTDPRGEGLVI.. 563
73 0.000e+00UniRef50_F0SJ07 Gamma-glutamyltransferase n=4 Tax=Planctomycetaceae TaxID=126 RepID=F0SJ07_RUBBR  ali  29  41..PDVAESANGMVVSQTPLASEVGRDILEAGGNAVDASIAVAFALAVTWPEAGNIAGGGFMMV-APVDSDVVCIEYRETAPVAVNADSFVG-WANRKHPRMAGVPGTVRGMQLAHIKFGSLPWKDLVSPSVKLARNGFVVDEQLAYSLNAALHKQKNSPEFRRVFDPDG--WKAGEKLTQPDLAETLEQIATSGADAFYEGPIAEKLVASMKKHDGLITAADLEDYNATLRKPVRGNIAGYDFFGAPLPSSGGTTVLMQLTMLEALGLKRADEELW--TTEHLHLISEAMKRGFRERAWLGDTDYVAIPVRLQQ---QKFARSLASRINPERATPSEDIAGDIPPYESMETTHFSVIDADGMGVSNTYTLEARYGCEFIPEGTGMVLNNEMGDFNWPGYTNLSGAIGTPPNLMAPGKRMLSSQSPTII-KKDGEVRFLVGSPGGRTIINTVTGILTQVLLFDRSLEDAVNAPRFHHQWLPDQIKLEDRFSPH-IDKLKAMGHEINQPEGWTGSAQCIAVDPGVATGVSD.......... 575
74 0.000e+00UniRef50_A0A2E7GF20 Gamma-glutamyltransferase n=1 Tax=Bdellovibrionaceae bacterium TaxID=2026715 RepID=A0A2E7GF20_9PROT  ali  27  54....PVVGTRGMVAVDSREAALWGAEILRRGGNAIDAAVATGWMMAVTRPQHGTIGGGGFMIYCPAKKGKCRALNFREKAPQKAHRNVYVRTDLSQNHPMASGVPGIVDGYFYALKKWGTRSHSELMKKPIEVAENGFVFTGELESSALDRWSSM--NPEAKKIFCNHGKPCRPGKKVIQKDLSRVLKTISQKGRKGFYEGWVAQKIVKGLRRKGGMMSLKDLQSYRSVEMDPIQGDYLGYQIFSMPPPSAGGAMIAQMFQYVKHAD-ENKAFENGDLSSQTVHALSHAMNLSFADRAHFGDPDFYPVP--LKKLMDPAYLKERWE----STYHPNSAYFPGIHVSEGQHTTHFAVIDKKGNAVSITITQNNNYGSGFVPPGTGIVMNNEMDDFSIPGTPNLFGLVGSEANAVAPEKRPLSSMSPTIVTDSQGRPRIALGAAGGPTITTSVFLTLVRRMRLGLTLPDAMMATRFHQQWKPKTLFVENGFSDETLGRLQQIGYSLRE-KGHIARMHAIERPDGTLWGVSDRRSEGAAV.. 595
75 0.000e+00UniRef50_A0A1F4R1M9 Gamma-glutamyltransferase n=1 Tax=candidate division NC10 bacterium RIFCSPLOWO2_12_FULL_66_18 TaxID=1801659 RepID=A0A1F4R1M9_9BAC  ali  26  10.......GRHGVVASPHPLATLAGIQILQQGGNAVDAAVATNAVLAVVHPHMCGLGGDLFALIYHAKERRVLALNASGAAPQAATLERYREAGMPFRGLWAATVPGAVDGWAAALTRCGGMDLKDVLRPAIHLAETGFPTPPELVRAAEVERSLLEATPETARVYLPGGRPARAGEILVQSDLARSLQTLAEGGRDAFYAGPIAAEIARASQAKGGLLTAEDLAGSHAEWVAPLSVPYRGLR-VFQCPPNSQGIATLMALQILAGFDLAGAS------EADRLHLMVEAKKLAFADRDHVSDPRFVSVP--VDHLLDPQYADARRRLISPDRAMAAPSLG-----QLDGDTICLCTADGQGNWVAWIQSLYSTFGSGVVAGTTGILLQNRGAYFS---------LDPEHVNRLAPGKRTLHTLTPLLATRED-QPVLATGTRGADGQPQTLLTIVTGLMDRGLPIQDALDAPRWVHGRRPQSLRIEARFAPEVVSALAARGHRVTVTDFNMGFAQGILRDPGCLVGAADPRGDCLALA. 530
76 0.000e+00UniRef50_A0A2D6JFK0 Gamma-glutamyltransferase n=1 Tax=Bdellovibrionaceae bacterium TaxID=2026715 RepID=A0A2D6JFK0_9PROT  ali  27  24...APFEGRDIVISGASPEAVQTAKKIYAKGGNVVDAAVAMTLSMGVTNPYFSALGGGGFALVKM--DGKIKALDFREVGPKAINENSFKGEKSSITGGLAVGVPGIPKGLWELHKTYGKLSWQELFDDAIDLSKNGFQLSGNYVERLNRNWDRFNK--AGKNLFGDDLKKIKPGQNFKQLKLAKALSFLRHKGVKEFYEGRIAKDLIASVKKAGGKITTEDLKNYEVKWREPLEAEYKGFKIHMMPPPSSGGVIIKTALYLMEKWELDNYQAYSTQE----IHLLGEILSRSYRSRALLADPEYFENP--LGKILDQKYLDRLVSSISSYKTLKLDPLDEKDYIPESTETTHLSILDKNGNAVSMTVTLNGSFGSGIFTEKYGINLNNEMDDFTTPGEPNMFGLVQGSMNQAEAGKRPLSSMTPTIVENKDKSTRLVLGSPGGPRIISSILQVMYRNLVSGYDIDEAIQAPRFHHQFLPHKLYYEKNVFPELIKDLKKKGHDLEE--SWAGRVYGATKEGEVLKAAFDSRLPGAANGY 552
77 0.000e+00UniRef50_A0A258RRN9 Gamma-glutamyltransferase n=3 Tax=Sphingomonadales TaxID=204457 RepID=A0A258RRN9_9SPHN  ali  29  17...QPVVAENGVTSSADPRVTDAGMEMLRQGGSAADAAMAMMLTLTVVEPQSSGIGGGGFLLYQDNAKGILATINGRETAPAAATSDRFVGPDGAFQGGRSVGVPGNVQLMAQAHQKWGKLPWATIFKPAIRLSQKGFIVNKTLESRLATIQGLWPNFDEARATYWRDGKPLKAGMQFKNPKLAATLTLLAKKGPDAFYTGPIANQIVDAVKLNPGDLTMTDLAQYRAKEQQAVCAPYRVYVVCGMAPPSSGATTVLQILGTLQRFDLGAMGKNSPQ----SWHLIGQAMQLAYADRKYLGDDAFVNVP--VAGLLNPDYIQERSALIDPEKATDYPAGNPPGAAPEVAGTTHFTAVDRYGNIANMTSTIEGPFGSQLMAG--GFFLNNELTDFTFAPEKDG----APVANRVVGGKRPLSSMAPTIVFDRDGRAVLALGSAGGKRIIMHVTKTLIGVIDFGLPLQQAIDLPNIY--FGSGGLEVEQNMLSAMAEGLREFGQKVRPVD-LGSKVNGAQRIGNSWIGAADPRSEGTSA.. 556
78 0.000e+00UniRef50_A0A2I0A7R3 Gamma-glutamyltranspeptidase 1 n=5 Tax=Embryophyta TaxID=3193 RepID=A0A2I0A7R3_9ASPA  ali  37  30QRREVILSRHGAVATDDLRCSRIGRDVLKEGGHAVDATVASALCLGVVSSASSGIGGGAFMLLRLA-NGKAQAFDSRETAPLHASENMYAGNSLKAKGALSIGVPGEVAGLHEAWRQHGKLPWSRLVRPAARLAR-GFRISPYLHMQMDKTKEGILADEGLRKIFTSNGSLLQIGDLCHNRRLSQTLEAIARYGPQAFYNGSVGIALVKDIKKFGGIITLRDLQSYQVNIKEPLSSDIMGLNILGMPPPSSGGAGMILILHILDQY-----GIPSGVSGSVGLHRLIESLKHMFAVRMNLGDPDFVNISQVLSDMLSPKFAHELKKTIMDNMTFSPDHYGGKWNILSDHGTSHLCIVDSRRNGVSMTSTINSYFGAEYLSPSTGIVLNNEMDDFSIPNDSSSDVPPPAPANFIRPLKRPLSSMSPTIIV-KDGLLKGVVGASGGSMIIAGTIEVFLNHFAKGMDPLASVMAPRSYHQ.............................................................. 500
79 0.000e+00UniRef50_A0A258L436 Gamma-glutamyltransferase n=2 Tax=Hyphomicrobium TaxID=81 RepID=A0A258L436_9RHIZ  ali  29  51.EGSLARAKTFMVTTSSRPASEAGLEMLRAGGSAVDAAIAAQLVLGLVEPQSSGLGGGAFLLHWDKAAKSLVAYDGRETAPAAAKPDRFLKDGAPVRSGLSIGTPGLVRLLKATHEKHGKLPWAQLFDPAIRLAENGFTVTQRLHLLLRLTG--IDAFETARAYFFKDGSPLAAGAVVKNATYAATLRAIAATGPDGFYTGDVAAAIMAAVAGAPGDLTAADLANYSVIKREAVCAPYREYRVCGMGPPSSGGIAIAQILQLLEPFDLGRVS--DGRLPAGGVHLILEAEKLAYADRRYLADPAFVTIP---SGLTDAAYLDERRKLIDPAKAMPPPPPGGADATLETTGTSHISIVDADGNAVAMTTTIEGVFGSGVMA--AGFLLNNELTDFSFRPVDAEGQPI---ANRVEGGKRPRSTMSPTIVFDDKGDVFAVAGSPGGGRIIMFVAKALIALMDWKLDAYQASSLMNFGSMGEGADIETDW---QSIMTGLRLRGHSVN-ADLMNSGLNILAVRNGALEGASDPRREGAALG. 595
80 0.000e+00UniRef50_UPI000BA7E964 gamma-glutamyltranspeptidase 1-like n=1 Tax=Limulus polyphemus TaxID=6850 RepID=UPI000BA7E964  ali  39  13....................................................................................TQHMLQGNTLSTVGGLAVAVPGELKAYWLAHQRYGKLNWSDLVLPSVKISRDGFKIGKHLGRNIMRFKDAIMSEPSLREVFFNNGDVYKEGEMLKRPVLAATLQKIAENGADELYSGETGRNLVKDIQGFGGIVTMEDLRSYEAKVKDAIPIQLKDGETLYSVPPPGCGTLVGFILNILAGFNITNKDVDDVKSSVLTYHRMVEAFKYAFAKRTYLGDEDFVNVTKR-------TYIKQVRQKISDVETFPPENYGGFFYGVEDHGTAQVTVVDAEGNAVSASSTINTQFGCKRRSSSTGIILNNEMDDFSSPNVTNFFGILPSPANFIKPGKRPLSSMSPSVVLDKAGQLKTVIGGAGGSRIITAVSQVLLRSMWLNNSIKEAIDALRIHHQLYPDTVFHEKHFPQIYLDGLTRLGHN-TALDSEHTQVQGIVKENGKLSANIDYRKDASMIGF 468
81 0.000e+00UniRef50_A0A2A5XSR5 Gamma-glutamyltransferase n=3 Tax=Flavobacteriales TaxID=200644 RepID=A0A2A5XSR5_9FLAO  ali  28  24......FYNDYAIVSAKKEATLAGIEILEMGGNAFDAMIAVDLSLSVVYPNAGNLGGGGFLVYRD-FNGNTGSLDFREKAPLKASKNMYLDPNLSREGSLSIGVPGTPAGLNAVYKKFGTLPLDSIFKSALMLAKNGFKLTKKQASLFNSSKNKILQLNDKIELFNHD---FHEGFVFKNPQLYNTLKILLENGFKSFYRGELADKSVKYIKSKGGIITMEDMNKYTPIWRDPFIFNYNDLKFITMGLPSSGGIVLSQILKSLKFLDADEI----TNSEYQYVKSLVELEKLSFADRSYLGDPDFIK-QNFIDSIVSEEYLKKRFSEINPKKSSEIKHGDIKF--HESEETTHYSITDSYGNAVSVTTTLNSNFGSKLISPTLGYFYNNEMDDFSIPGVPNIYGLTGSVNNSIYPEKRMLSSMTPTII-EKNNELFMILGSPGGPTIITSILQTILNVTMFNMSIQDAVNKSRFHHLWLPDKIFYESNFSNKIIDSLKNDGYIFNNKSSLIGRVDAILIKNNKIYTAADPRGDDYAEG. 555
82 0.000e+00UniRef50_A0A225PVZ7 Gamma-glutamyltransferase n=13 Tax=Alphaproteobacteria TaxID=28211 RepID=A0A225PVZ7_9RHOB  ali  27  56...QPVKAQTWMVAAANPHAVQAGAEVLRAGGTAADAMIAVQTVLGLVEPQSSGIGGGAFLVWHDGETGEITTLDGRETAPFAATPTLFQTADGAVIGGRSVGVPGTPALMQAAHEKWGKSDWAGLFDAATRLADEGFEVSPRLSQLVLANVPALTRYEPSANYFLPDGMPPVAGTVLKNPDYANVMRRMASEGAQVIYQGEIAQDIVDTVRGNPGVMSLADLAAYEVKERPAVCAPFRGLEVCGMGPPSSGALTVGQILGMLDASDPGAAD------DPQTWRKIGDASRLAFADRRYMADSDFVPMPT--DGLVDPAYLGERARLLEGDDALPVAPGMPAWDSIEFPSTSHISIVDQYGNALSMTTTIENGFGSRLMTN--GFLLNNELTDFSF--RSHQDGVP--IANAVAPGKRPRSSMSPTIV-REEGKPVLVIGSPGGSRIIGYVAQAIIAHVDWGMDVQQAVAMP--HGVNRFGTFDLEAGTPADMATALAEMGFN-TDVRDLNSGLHAIAIGAEGLQGGADPRREGIALG. 594
83 0.000e+00UniRef50_A0A2A9EK43 Gamma-glutamyltranspeptidase/glutathione hydrolase n=2 Tax=Georgenia soli TaxID=638953 RepID=A0A2A9EK43_9MICO  ali  29  52RKEATATGYGGAVTSLDPYATRAGMEILEKGGNAVDAAIATSAMLGVTRPYDGSIGGGGFFLIYDAENDEVTSIDARETAPLATPRDVFLENGKERVSGLSQGVPGVVAGWELALEEYGTMPLHKLLQPARVVAERGFVVDEEYVDRTTDNLEIFRDFTSSRETFLVDGKVPAVGSIFRNPDLARTYKLIGRDGADAFYEGEVAEAIVDTVQHRPGLMELGDLDDYEAKWRDPTMVDYRDHTVFGMGPPSSGGTTVGEALNILEGYELSELPENDV------LHLLIEAEALAFADRKYLGDPDFVDVP--VEGLLSQDFADERRELIREAATKKPLPAGTPDGAADDG------VVDRWGNIVALTFTIEQIGGSGIAVDGYGFLLNNELTDFAT---------DPNVANSPDGGKRPRSSISPTIMFGPDGEPFVAYGTPGGATIITTVLQVAVNLVDLDMDLPDAIAAPRLGNGNSENT-NFEATLPVATQEALKAYGHKLTPAAEPIGNVNGVQFLDDGLLAAAEPTRGGSAA.. 605
84 0.000e+00UniRef50_A0A1Y4NK62 Gamma-glutamyltransferase n=2 Tax=Firmicutes TaxID=1239 RepID=A0A1Y4NK62_CLOSC  ali  27  19..KPHVSGTCGAVSANNPYAAQAGLEIMKKGGNAFDAAAAVALVLGVVEPYHSGIGGGCFHVFYDSKTGMCHTVDARGTAPANASQDMFLDAELTEFSGRSVAVPAFYRAMDQLLKTYGTMTWEQVSEPAIRLCREGFYCGFAYARVSNEAEHNSREYEGFKELFLNNGKPRQFGELVKNEALADTMEAVARFGVDWFYSGPVADEIVSQVNRYKGVLTKADLEQCRPKEREPVRGSYRGYEIISMPPPSSGGSHLIQMLNILENFDLKEMGFHSAD----SIHVIAETMKMMFADRSVMGDPDYVKI--NLEKILSKDYAKELAAKIDIEKACEYAPSEGIEAKEYRGCTSNFTVMDREGNVISQTQTIRNWWGCGVVIPKRGFIMNNTMADFSKAGVRTTQGLAYGMANAIRPGKTPLSSMTPTIVM-REGKPVMAVGAAGGPRIITSTLQLIINVIDYEMMMDSAVKTPHLCCLTLNQGLELESGFSPDTVRLLKEKGHTVKETGD-FGVLNGILCRDGIFYPGGTSRVDG..... 556
85 0.000e+00UniRef50_A0A160VAL2 Gamma-glutamyltranspeptidase n=8 Tax=root TaxID=1 RepID=A0A160VAL2_9ZZZZ  ali  26  13.NRPVIMGRNGMVSAGHPLAAQAGMAILQKGGNAIDAAIATAAALNVVEPNMSGVGGDGYIMIYNRAQNKVDVCNATGAAPYATDLATYQATGIPQKGILSVSVPGLVDGWLAAHEKYATLRLSELFAAAIDLADNGFPVSHVLSRVIAGDR-LVQEFPTSQAIFAPGGKAPKPGDVIRQRDLAKTFQAIAGGGRDAFYQGEIAEAIVKFSQEQGGLLSMKDLADCRSRWEEPISTSYNGHS-VYEAPPNSSGHILLQELNMVEQFDLKSLGCSTAE----SIHMMVEAKKLAFIDRAYMADPDHTDVPTL--GLISKEYAKKRAELIDPDRASDPTHGDPWVFQGKEEDTTCFVIVDRWGNAVSLLQSIQSSLGSSLVAGNTGILLNNRMT---------YWHLDPGHVDCLQPGKRVRHTMNPVMVFNGDGNLMLVCGTPGADTQVQTNMQVITHLIDFGMTVSEAVEAPRWRNSHSPNLLHMESRFGAEIRQGLESRGHQLNMMTDW--GAQGIQVDTGALHGAADPRRDGYTVGW 572
86 0.000e+00UniRef50_A0A1Q6XYY7 Gamma-glutamyltransferase n=3 Tax=unclassified Acidobacteria (miscellaneous) TaxID=305072 RepID=A0A1Q6XYY7_9BACT  ali  24  13QARSMVISRNGIVAAESPLAAQAGVRILEQGGNAVDAAIATNAMMGVVEPMMNGIGGDLFALVYDAKANKLYGLNASGWAPKGLTIEYLAGQGMPQQGVNSITVPGAVDGWQKLADKFGRKKLAENLAAAIRTAQEGFPVPEWDAAYWAGSVNYLRTDEAAAKTYLPEDRAPRVGEVFRNPDLAWSLEQIARHGRDAFYKGEIATKILESMKRHGGPMAGADLAEFSSEFVEPISTTYRDW-TVYELPPNVQGLAALEMLNIMETFPLGQKDWGFA--STNALHTMIEAKKLAYADLKYIGDSRKQKLP--VATLLSKEWAGQRAKQIDVDHAKDATAG----EIAAGNDTTYLSVVDREGNMVSLIQSNYELFGSGIVAPGTGFALHDRGGLFS---------LDPASPNALAGRKRPLHTIIPA--FAQKGDSRVAFGIMGGWNQSQAHAQFIADLADFKMNIQAALEAPRFSHSFGGCDVMMENRIPQKVRDELAAKGHQIALKGTFVGGGQAVMRDTGVNYGASDPRKDGQAVA. 541
87 0.000e+00UniRef50_A0A2P6MN46 Pseudouridine-metabolizing bifunctional protein n=1 Tax=Planoprotostelium fungivorum TaxID=1890364 RepID=A0A2P6MN46_9MYCE  ali  36  749.....AFGKNGAVAAEQGVCSDVGVTILKEGGNAVDAAIASTLCLGLAQPHSSGIGGGAVIVIRMA-NGTEEVIDSREVAPEGAYPTMYVNRTDSTYGPRAVAVPGELRGLELAFQKYGRVTWKRLFKEAIETARAGVPISHELYRAIQSERSNLLNS-NLKDIFMPNGTTLVEGNRYQNPKLAETLEEIANNGTWSYYHGQIAANIVWDIVKAGGNLTLGDLETFSPRISRPMHGSYRGYDIACAGPPFSGCPIMLQTLNVFEKYAVDQIDRK--RNPTVASQILSESLKFAFANRVGLADPYFYNVTGVVDGMTDKQHAELLKAKIDLDHAYNWTHYDPQDSTP-DAGTMHLSVVDRDKNAVAITSTINTYFGSQFLSTSTGIILNNEMDDFGTPGTFNSFNLPPSKINFPEPKKKPLSSMSPTIIT-KDGQVKMVVGASGGSRIPTGTLQVISSILDSRMKPDYAVWQPRIHTQWQPNIVYVDPNLPPDVYSKMKEVGNDVTVRATSGSCVQVVVVEDDNMMA............. 1273
88 0.000e+00UniRef50_A0A0X8HEB8 Gamma-glutamyltranspeptidase n=41 Tax=root TaxID=1 RepID=A0A0X8HEB8_9GAMM  ali  30  58........ERFAVAAANPLATDAGYQVLRAGGSAVDAAIAVQMVLTLVEPQSSGIGGGAFLMHYDGSD--VTAFDGRETAPRAASESLFLNGDGAAASGLSVGVPGTVRMLELAHDEHGKLPWAELFAPAITLAEEGFAVSHRLHTSLAG-EERLRDDAGGAFYYTEDGEPLAEGHKLKNPALAAILREIAEHGSKAMHTGSIAEDLVHRVQDRPGAISLEDMATYVALQRDPLCTDWKAYRVCGFPPPSSGHLTIMQILGTMEHLPELEAPVEEGQPSVEWWHRFLEASRLAFADRKYIADPDFVDPPGSWSTMLEPDYLALRAESIGPDGARPGRPGKAVQPNQPEYGTSHISIIDEEGNGLAMTTTIEAAFGSRMLADGGGYLLNNELTDFSFRPLDADGTPI---ANRVEAGKRPRSSMSPTLVFDREDELIASLGSPGGAAIIHYTAKALVAMLDWGLNAQEALELP--HAITLGGPAFFEEGFDASVLEALNERGHEASE-RELTSGLQAIMKTEEGFFGGADPRREGVVMG. 608
89 0.000e+00UniRef50_UPI0008FF045B gamma-glutamyltransferase n=1 Tax=Synechococcus sp. CB0101 TaxID=232348 RepID=UPI0008FF045B  ali  31  46...HPVESSGGMVAAQEAQAAAVGAQILRRGGNAVDAAVATSFALAVTLPQAGNLGGGGFLVLWLPRRGEAVALNFRETAPQAAGPDLFLNPDGSVRSLLSTGVPGTVAGLTRVQARYGCLPLAAVMQPAIDLAEQGFPVGAELSASLAAAAPLLKEQPASARQFFPSGQPYQPGERLRQPELAASLRCIAQQGASCFYRGRLAQQLTALMQSGGGLINRADLAAYQAPWATPLQATFQGHRVLTMPPPSGGGATLLQLLKVLEPLNLAATGLNS----AATIHPMVEAMNLAYRDRNRLGDPDQVAMP--LDRLLSDRYAAQQRRRIRADRHRPAAELEAEPSPLEGTNTTHLSVVDRDGGLVATTTTLNTAYGNGITVPGAGFLLNNEMDDFAKPGAPNAYGLRQGSQNAIAPGRRPLSSMTPTLLFRPDGSPLLATGSPGGSRIITTVLQVLLNRLVHGLNLASAVASPRLHSQLWPDQISIEQGFSPDTLRLLEQKGHTVKLVPA-MGSANSVEVRYGGSAGVADPRRLDAAA.. 614
90 0.000e+00UniRef50_A0A067QYY9 Gamma-glutamyltranspeptidase 1 n=1 Tax=Zootermopsis nevadensis TaxID=136037 RepID=A0A067QYY9_ZOONE  ali  34  86..SKEGHYTRAAVSADSTVCPPIGRSVLEKGGSAVDAAVAVLLCQGVSDPLRSGLGGGIFMLIYQRSSRTVLALDASVSVPARASRDMFQDDTTRQRGGWLVAVPGELIGLWEAHKKFGVLPWSELVETAIQLCEQGVAMSENLAKFLHKFQDVVLADPALRKTFTRTGELLQAGDVMKNVRLARTLRVVATQGADSLYNGTLAKALVDDVKSSGGLLRMKDLAKYKPRWSKAVTTTLQGGQKLHMTPPPSGGVVVSHILSILEGYNMSSQDFATVSRQVTTLHRIVEAFKLSFAKRPLLGDPEDADVIKAVQDLLSKKVVEQERQMINDNKSSDITYYGPQLEEVEDSATTHVCVLAHNGDAVSVTSSMSVNFGSGFMSSKTGIILNNVMENVKEQNIISKHETVTPSANFVSPTKHSMSPVAPSVFTDEAGDIRLIIGGTGGIKTITSIAYVAIRNLWLGDSVKTAIDARRIHHQLSPNKLQYEYGLIKQQIEGLKKRQHIMVRVRDWSSFVNAIEKRNGMIIANSDYRKGGTVDG. 630
91 0.000e+00UniRef50_A0A2D6WA33 Gamma-glutamyltransferase n=6 Tax=Verrucomicrobiales TaxID=48461 RepID=A0A2D6WA33_9BACT  ali  29  31........SKFAIATVDPIATNAGIKAFMDGGNAFDAAISAGLTLGVVNGYNS-----------RKSNGEIFVINGRERAPFKAHEKMFVENGLSKEGALSIAVPGALMAYSALCENHGTTPFKTHLENAAKIAEEGFIISKSFSKRIQASEDKLRKYPSSSEIFLNDGTAXTEGSLLKQFDLAKTYRGIAKNGTDWFYKGPFARATAKWMKQNGGXLNENDFEKFFITNPKPIKSTYKNYTIIGMPPPSSGGIHVAQILNILENFNLQKFKPESPE----FYHIVTESMKLAFADRAHLGDPAFTKVPQGX---IAKDYANSLSKKIKXNKVTNVKTXGSPPNANEDKHTTHFCCADHKGNWVAITATINTSFGSKVVIPQTGVIMNNEMDDFSIPGVPNAFGLIGSESNKVEGGKRPLSSMSPTIVL-KNNKPILTSGAAGGPTIISQTTLNVLRVLEYGTHIDKALEMPRIHHQWIPNLLRIEKHAGETTXNSLINMGHEIQIHDQ-FGSSQAITEMNGXMSAIHDFRSGGKSV.. 560
92 0.000e+00UniRef50_Q0BTI0 Gamma-glutamyltranspeptidase n=8 Tax=Granulibacter bethesdensis TaxID=364410 RepID=Q0BTI0_GRABC  ali  26  56...RDVTAAHMMVVTANPFASRAALDVLKAGGNAIDAAVTAQAMLSLVEPQSSGLGGGAFLLYYDAATRQVTSWDGRETAPAAIPPTIFQDADSAGIGGRAVGVPGALRMLEAVHKLHGQLLWKDLFTSTITQAENGFPVSALMSREIREEQNSLMVQEAARTYFLPNGSVPEPGYILKNPALAETMRSVAEKGADALLTGRIATDIVTAIRQSPGTMTMDDLASYQPRQRPALCMPVKMRTVCSMGPPSSGGVAVLQILSMLEGFDLRHLRPDSAEAAD----LIIQAEHLAFADRNFLADPDFVKIP--LRGLLDPAYLRQRARMIHPRHASTVEAGNPSWSMPDEHGTSHISIVDAQGNAVSMTTTVQDVFGSKLLVD--GFILNDELTDFAFVPEEAGKPV----ANRVQAGKRPRSSMAPIIVLDQNGKLDMVTGSPGGGHIISYVSQAMLLSMRWNLSPAQAISAP--HIGTTGLKSDLEAGTEATLLDRLLQYGHHPAIIRLNSGLSMIIKKADGHLTGAADPRRDGIPYG. 600
93 0.000e+00UniRef50_A0A1W9HXF0 Uncharacterized protein n=2 Tax=Proteobacteria TaxID=1224 RepID=A0A1W9HXF0_9PROT  ali  27  25....PAGGQKIMIAAASQYAVNYGKEISKKGGNVVDVACAVGLTMAVTNPYFASLGGGGFALFRVGKN--TEALDFREVAPARTSPDYYENKDSSVLGGNAVGVPGMLMGYYELHKKFGKLKWTDILEGPIQLAQKGFEITNELNVRTEDFKGKF--NPYGLALFFKQSQVYKPGEVFKQPGLAKALQ-IAKSGPKGFYQGQVAQDLVEAVQKSGGILSLDDLKAYKVRWLKPMNTNFMDHTFYLMPPPSSGGVVLTTILKLIEMRNLKAQKPQSLDEA----HLLAEIFHRAFRGRALLGDPDFNTNP--IEQLLSAANILSLNNTINPQKRLQPAEKEIRPQPIESTETTHFSILDANGDAVAMTITLNGSFGSGVVSKKFGITLNNEMDDFTTPKEPNVYGLIQGTANKVEPGKRPLSSMTPTLV-EKDGKIILVVGAQGGPRIISSVAQVIYRNLLNNFNIEESINTPRIHAQFMPAIVYLDKRWSPELLDGLRSRGHQVEE--SWMGRVYGVRLTTGLLEGAADNRVEGTAGGY 553
94 0.000e+00UniRef50_A0A1G9FRX1 Gamma-glutamyltranspeptidase / glutathione hydrolase n=1 Tax=Natronincola ferrireducens TaxID=393762 RepID=A0A1G9FRX1_9CLOT  ali  26  52.....ANGENGAVSSGRVEATEVGLEVLKAGGNAIDAAVATSFAIQFFEIESTGIAGGGFMLIHDAKSGEDVVIDMRETAPAATTPDMFLNTDEANYHPLAIGVPGNVAGLELALNTYGTMSMQEIMDIVCAKAEQGIYVTNKVESAIAECYGYIQNYEASKELLLNDGLPYVEGDIIYNPDLIETYQKIAKHGSEIFYKGELAQKMVDEIQKQGGILTMEDLVNYEATIIEPSTGTYRGYKIVSSPPPSSGGTHIIQGLNILENFDLKAMGHRSVDEFF----LLQEIGKYLYTDRAYMADTLFVDVP--LKGLTSKAYAKSIADKIDLNKANEVTAGMPADY--EAVDTTHLSVIDKDGNMVSYTNTVNNYLGNAMVIPGTGIIMNNELTDFDFSNLDSI--------NAPKPGMRPLSSMSPTFVFTPEGEPLMSLGTPGGYTIFFTVLQNIINVIDHGMDVNTAINIERYHPAYYGEEFYLETSIDEKILEELRARGQIVASKHDYYGSTNAVYRDTKGFHAVADRRRDSHAGAY 596
95 0.000e+00UniRef50_C6D604 Gamma-glutamyltransferase n=19 Tax=Bacillales TaxID=1385 RepID=C6D604_PAESJ  ali  24  2..KKPVTGTKAMVVSPHHLATAAGARVMERGGNAFDAAVAVSACLAVVYPHMTGVGGDAFFLSYHASDGEMRAYNASGRSGGEATIEAFADEGIPTRGPRAITVPGMVDGWYAVQNRYGRLTFAEVLESAVSYASEGFPMSPDQFEHTKQHAAMLGEQTATAEIYMPGGRVIPAGERFVQSKLAATLSTIAEKGRDAFYHGEVAAEIVRFLQTEGGLLTEEDFAAHSGEWIEPIRGSYRGYDI-YQVPPNSQGFTGIMALQILEQFDLAAMGHGSYE----YYHVLTEALKLSFRDRNYLTDPSFSAVP--LDRLLSKEYASELAASIKKDAAVDI------NSQPVGSDTAYAAVVDEDGNAVSFIQSLYFEFGSGVVAGDTGVLLQNRGSFFS---------LDPNHINRLEPRKRTFHTLMPAMACL-NGKPGFLYGTQGGEGQPQTQTLMLTRMIDFGMNPQQAVSEPRFVWGRTTQELKLEGRIPEESAEKLEKAGHLVRRLPDFMGHAHAIAIKDGLLSGGADPRCDGSAIGW 526
96 0.000e+00UniRef50_L8I7J4 Gamma-glutamyltranspeptidase 1 (Fragment) n=1 Tax=Bos mutus TaxID=72004 RepID=L8I7J4_9CETA  ali  38  602...............DSKTCSDIGRAILQQRGSPVDAAIAALVCTGVVNPQSMGLGGGVIFTIYNATTGKVEVINARETVPSNPIPALLDQCEQAQIGAQWIGVPGELRGYAEAHRRHGRLPWAQLFMPTIALLRGGFRVPTILASFLHSQRPSLTES-SLRQLFFNGTEPLRSQDPLPWPMLAATLETVATEGAEALYTGRLGQLLLEDIAKEGSRLTRQDLASFRPEVVDALALPL-GDYTLYSPPPPAGGAILSFVLNVLKGFNFTAESVAGLEGRVNLYHHLVETLKFAGGQRWRLWDPRSHP---EVQDLLGEALAQHIRQQMDDRGDHPLDHYSLAGAWTHRMGTAH-------GGPVRLTETLGGWLGS-------------------ESALTPVWPPVPGE--------RPPSSMVPSILVSTARGSKLVIGGAGGELIISAVAQAIMNKLWLGFDLQAAIKAPILHVDSKG-QVEFEPSFSQEVQKGLQDRGQEQNKRPFFLNVVQAVSQDGACVHAAADPRKGGEPSGY 1101
97 0.000e+00UniRef50_A0A2G5TU82 Uncharacterized protein n=6 Tax=Rhabditida TaxID=6236 RepID=A0A2G5TU82_9PELO  ali  32  91..PSDAIFEKAALTSDNAACSKIGGEILRKGGNSIDASIASMFCLGVVNPQSSGIGGGFLMTYYEEKSGNCYSIDARETAPAAAHRDMFLNDDGSKYGFKAAGTPGEIAGYWHVFKKFGKVTWKELVQPSVKLARDGHPVSPYLATVMKVKERHFRLFPSVKHWINPTNATYASGDILKRRKLAKTLERLGNNPVQLFYHGEMAKTMAKEFQEGGGLITEQDLANYKV--REYVNSNFRGTLTMCGGPPPSSFGVTQLIISVMSKL-FPEGHHDDIYQDPKVLHKYIEAMKFSYAQRTLLGDHDFVKALELSKNLTTPEYTQWVIDRM-EEKAQPSKNYGGAQYVPPDHGTSHVSAMDQYGNGVSVTTTINRWFGAAVESTEFGILWNDEMDDFSTPGMENGFGFAPSETNFIEPGKRPMSSMSPMVIFDHTKKVRMVIGGSGGSKIISALAKSVVRSLIFHDSIKKAIDAPMIHNQFTPDITQLDDEFPQNMKSILEEYLQKFRNTTGFEGIIQGVNVLEDGIYACGDYRRDQEPAGF 642
98 0.000e+00UniRef50_A0A2E5E1D6 Gamma-glutamyltransferase n=4 Tax=Planctomycetes TaxID=203682 RepID=A0A2E5E1D6_9BACT  ali  32  29......FYRSGAVAADHAVASEAGASILRRGGNAVDAAVATSFALSVTDPFSCGVGGGGFMIIRLPATDRAVALDYREMAPAAVGPDFYVDRTASRYGGAASGVPGMVAGLWKVHQQWGTLPWNELLLPAIKAAEDGVVVNAAWVAAAEGVGRVRETYPELASHLCDSGK-LEAGDLVKQPEQARLLHRIASEGPSAFYEGEVAQAIVSTCAEFGGVMTTADLAGYEARESKPLRSDFNRYQLLSMPPPSSGGVAMQAILGIIDRRDVQDLRPDSPQ----WVHLVAEAMRHAFSDRAHMADGTMVSVP--VNQMLDSDRLDQAAAAIEFDRVQPVGEVG--VLPPEDAGTSHFSIYTEDGSAIACTETINLGFGSLVGVPEWGIVLNDEMDDFTTPGKANAFGLRQSDGNLPAPGKRPLSSMSPTIVLDGD-QVRVIAGASGGPRIINGTLQAILNVILFDMSPVEALAAPRFHHQWMPDRLDFEEYWSEATIEAVELVGHAIGQ-RASVGKVQLIEIDPDGLIAASDPRKGGVPAG. 570
99 0.000e+00UniRef50_A0A0D2P3V1 Uncharacterized protein n=3 Tax=malvids TaxID=91836 RepID=A0A0D2P3V1_GOSRA  ali  40  31RRREEVVAHRGAVATDDGRCSKIGVDVLRIGGHAVDAAVAASLCLGVVSPASSGIGGGAFMLLREA-NGKAQAFDMRETAPLKASMNMYAGNALKATGALSVAVPGELAGLHKAWKQHGRLPWERLVKPAEILARKGFKISPYLRTQMESSKSAILADKGLREVFTSNGELLQVGDICYNKKLAETLRKISIYGTKPFYNGSIGLNLVRDIQRAGGIMTLDDLKRYEVKMREPISANILGLKVLSMPPPSSGGVSMVLALNILTQYAVPSGLLGS-----LGIHRLIESLKHAFAVRMNLGDPEFVDVSKFVTDMISLEFAKKLKSTIYDNMTFGPNHYGGRWSQVHDHGTSHISIADSYQNAVSMTTTVNAYFGSKILSPSTGIVLNNEMDDFSMPINSSRNTPPPAPPNFIRPGKKPLSSMTPTIVL.............................................................................................................. 454
100 0.000e+00UniRef50_A0A2E8KZF3 Gamma-glutamyltransferase n=5 Tax=Bacteria TaxID=2 RepID=A0A2E8KZF3_9BACT  ali  26  36RNIEEAVGKNGVVSSVHPLASEVGINILKAGGNAVDAAIATGLALGVVDQANCGLGGGAFIVIRL-TDGTVHTLDGREMAPSRAHRDMYIKNGLSRRGPLAVGVPGVPAAYLKALELAGTMSLKEVIKPATAIARDGFILDEAYIERYKGAVKNLKKDPGSAEVYFNDGSKLGVEQIFKQPLLADTYDKFGENGLDYFYKGDFAEQVGQFMQKNGGFITKEDMANYRVVERNPIHGTYKDYEVFGMGPPSSGGIHVVQILNMIEA--SGALDEKS-EWDEESIFLVAKFMDKAFKDRAHLGDADFHPVP--IDRLISKDYAQALVNEVKAVTSIEPRDERYSLAYGEGH-TTNFAVIDKWGNAVAINHTVNLTYGAQVTVPGTGVALNSEMDDFSAPGVPNAFGLIGAEANSVAAGKRPLSSMSPTIVV-KDGKPVVILGGAGGPRIITAVLHTILGVLDXDLSVGAALSLPRFHHQYRPEVLFVESHMPDEHKAAMTGRGYKVMDW-GGLGTVRAIAWSEKAYVGAADPRREGVAKAY 577
101 0.000e+00UniRef50_A0A222ZWE3 Gamma-glutamyltransferase n=29 Tax=Bacteria TaxID=2 RepID=A0A222ZWE3_ALCFA  ali  29  49........QKSMVVTANPLATQAGLRILDQGGSAVDAAIAAQLVLGLVEPQSSGIGGGGFLLMFQPKTG-LMSYDGRETVPAASSLDRFELDGQAVNSGRSVGVPGLLRALELMHKDGGVLPWANLFDPAIELAEVGFEVSPRLNTLIADN-PELADKAATRAYFLDEGRPWPVGHRLQNKEYAQVLRLLARQGAQAFYQGELAQDMVAAVAADPGDLAESDLKQYRALRREPLCMDWQQLALCGMAPPSSGAISVMQMLGILQHTPIADAEPQSVE----AIHYFSEAGRLAFADRAWVADPAFVSVPQ--QALLAPAYLKSRAALIQPDRAQPGKPLAASDNTPELPSTTHLSVADAQGQVVSMTTSIESAFGSKIMVR--GFLLNNQLTDFALSPKDEMGRL---SVNRVEPGKRPRSSMAPMMVL-QQGHPVIALGSPGGSAIIPYVAQALTGMLMWDLDAQQAVSLPHYGSRNW--ATELEAGTAVTTAQALRAMGHEVREQPFP-SGTHVIRWTQEGLEAGVDPRREGLALG. 580
102 0.000e+00UniRef50_A0A1E4TFL7 Uncharacterized protein (Fragment) n=1 Tax=Tortispora caseinolytica NRRL Y-17796 TaxID=767744 RepID=A0A1E4TFL7_9ASCO  ali  35  1...........AVAADVPICSKMGVDMLKRGGNAVDAAITTTLCIGVVNMFSSGIGGGGFMLIR-PHNDSPLAINFREMAPEAAHKHMYDDHPLSKIGGKAVGIPGELAGLWAAHERYGSLSWKELFDPVVDLARKGFPMPRVVHVALKTVHPFIFGDPSANWSFLQHDRPYKTGELIKREALANTLERVSVEGITAFYNSSLTHSMVNEAAKSGGVITYDDFSKYQVSIEEPISTYFHGKEVI-TLNAPTSGPALLFGLNLIEGIDGPFAGH---EHSALSQHYIIESMKWMSSARTQLGDPVYMDNVEHISAMQTKKYAADVRRNVSADRTYNWRYYNPSYEPNEEHGTAHLSVIDKHGMAVSLTTTVNLYFGCMVHDAESGVILNSEMDDFSVPKTGNAFDLQPSIYNYIEPFKRPLSSTVPVIVTD-NNYAELVIGAAGGSHIITTVFQAISRIYLFKQGLEQAVKNPRLHDQLIPETTYYESGMDSWTMRGLKGMGHNLTCMDPR-SVMNGIVKDTGEITAVSDWRK....... 527
103 0.000e+00UniRef50_C0HAI9 gamma-glutamyltransferase 5 n=93 Tax=Neopterygii TaxID=41665 RepID=C0HAI9_SALSA  ali  40  42......TFKNAAVSADSQLCSEIGRDILLQGGSAVDGAIAALLCTSLVNPQSMGLGGGSIFTVRD-TFGKVKTFSSRETVPQLFKADLLKGCPTSVTGSQWIGVPGELRGYEVVHRQYGKLPWAKLFEPTIRLAREGFPLPPYLGRLLNFIIENLVKATSLCEVFCKNKTVLGMGDILKFPKLAETMETIAEQGADAFYTGQIGLDLIQDVKAAGGTLTMEDLKSFQVRVEDAWTVPLGDYQ-MHIPPPPAGGAMLAFILNIIKGFNFTPRSMEG-DQKVLTYHYYIEAAKFAKGQRRRVRDPVFNP-KKDASYMVDSDFADQIRVLISNNRTYNNSYYN-ITPSPDRFGTTHVSVLAEDGSAVSVTSTINQIFGAAIYSPRTGIILNNELADFCFRAE------------RVSAGEQPPSSMAPAILSSSSGKKTLVIGGSGGSMITTAMALSIMNHLWLGMSLKEAIAAPVVFVDGNNN-VNFEPTFDKSVIEALKVIGHRVTDYPYFFNVVNAVAKEDRCITAVSDGRKQGKAAGY 561
104 0.000e+00UniRef50_G4L0X3 Gamma-glutamyltranspeptidase n=3 Tax=Bacteria TaxID=2 RepID=G4L0X3_OSCVS  ali  27  78REGRDATGDNAVVSAGTPWAASAGLDILKKGGNAVDAAVAVAFALSVTEPQASGLGGGGFMTIRDKA-GEVKFINFREVAPQLAVENYWSSDGTSETGGRAIGVPGEVAGMVWVLEHYGTMQLKDVMQPAIDLATNGFYIGPTTGSCLDDNLAKLKAYSEFASIYLKDGTNYTTGDLFKNAQQARALQLVADHGKDGFYTGELQDAMITAANKYGGVFTPDDFTNFCAGELTPVEGTYRGYKIYSSPLPSSGGLCVIQLLNILENFDIKTMGHNTVE----TIHLMSEAMKMMYADRAYLADTE----DAMVKSMMSKAYAKSLAAAISMTEVHKPTSHDPMQY--EHMDTTHFAIADKDGNMVSCTQTINGYFGSAVAPAGYGFMLNNEMGDFST---------DPTSPNVIGPGKCPLSSMSPTVICKEDGTPFLTLGSPGGSLIIIGVAQVIMNVIDFGMDIQDAINEPRMGD-NTENKIRYESRIDPTVIKGLQDLGHEVTEWDRGLGSIQAVLYDDGKLHGGADPRRDNKALG. 617
105 0.000e+00UniRef50_A0A2E6Q885 Gamma-glutamyltransferase n=2 Tax=Rhodospirillaceae bacterium TaxID=1898112 RepID=A0A2E6Q885_9PROT  ali  29  38.EKTAVYGKRFMIAAANPHAVKAGYKILKQGGSAIDAAIATQMVLGLVEGQSSGIGGDASLLYWNANKKQLSGIDGRVVAPATADEELFYDRKEAGFGGLAVGTPTLLRVLEGAHKRFGKLPWARLFQPAIALAEAGFPVSHRLHVQISKN-ERILEDPTAKAYFFDDGNPRPIGYRLMNKPYAALLRRIAEQGAAAFYDSDIPEKIAHAVKHNPGRLTAEDIRNYKPEDVTPACVSYRGYKVCGMPPPNTGGLAIAMTLRMLERFDLKSLGFDS----VKAHHLYVEAYRLAHADRTYIGDPRFYKTP----GLLDGTYLRERSARIDPSEKSRVRSGSPPDDSPEPPSTTHMSIVDSYGNAISLTTSLGLGFGTGLMVE--GFLLNSQLRGFGFKPTS--YGRP--NINRPESGKRPRTSKSPTIVFNHDGSLRLVIGSPGGGRIINYVARALIAVLDWGMDVQKAISLPHILPRRR--RVELERDTSAEFEDALESLGHDTK-IRRLTSGLHGIEITPNGLVGGADPRREGVALG. 578
106 0.000e+00UniRef50_H3ET16 Uncharacterized protein n=1 Tax=Pristionchus pacificus TaxID=54126 RepID=H3ET16_PRIPA  ali  35  83.......FRKAAVVSDHGICSEIGRSILTKGGNAVDAAIATLICVGATNPQSSGIGGGFFMQVYQKDSGICTTINARETAPQNIDVKEYERPDASSYGWKAIGVPGEVKGFWRAFTDYGKVAWRDLLAPTIKLCREGIPVSEYLAMILVNETKSVNKSNELREMFTNTSKFYREGETMKREKLARTLERLAEDPAALFYAGDMADTIVKEIRENGGYMDKEDLEDFQPLVRPAITSAITDSITQCGPPPPSSWIVTQLIVRIMAELYPEPRRLEDLD-SVLFYHRLIEAEKFAYARRTRLGDPKYYNMEDTVKELTNPA-AAKRAARIRDEGPQANAAYEVKGYVKEDHGTSHVSVIDEQGNAVAVTSSINLWLGAKVAS-SLGIIWNNQMDDFGVPGVVNGFGFLPSKENYIAPGKAPLSSMSPTIIYDRDGQVRVVIGTTGGSKIIQGVASVVVRSLLFNQTIKEAIDAPQIWNQMQPDHVQYEKDFPEHIVSGLRAMGHKLQEEVNMRSTTHALFVDEATIYANSDKRSHMHPDGY 688
107 0.000e+00UniRef50_A0A2R4XPB9 Gamma-glutamyltransferase n=1 Tax=Bordetella sp. HZ20 TaxID=2163011 RepID=A0A2R4XPB9_9BORD  ali  29  50...EPRQARYGMIASDHFLASQVGSDILAQGGNATDAAVATAFALAVVLPYAGNLGGGGFALIFDRDNQNTLALDFRESAPASAHPDLFLDPRMSIESTASIGVPGTVAGLLAMLERTGSLPRAEVIEPAIRLAEQGFEVTPTLAGLLASHSRHLYKSPANREVFFSRKEPLQIGDLLIQHDLANTLRSIRDLGAPGFYTGPVAQSISDTVNADTGQMSLNDLAHYRVHWREPVIGEYRDLTIASMAAPSSGGIHLIQMLNILSRFPMANYGYGS----AASIHLMTEARRAYADRAAYLGDPDFVEIP--VQWLTSMAYAQALADEISLTEATPSSAISAGEPAPQGTETTHLSAVDRWGNMVSLTTTLNLNFGSGWMAPGTGVLLNNEMDDFSSPGVANAFGLIGSDANRIEPGKRPLSSMTPVIVF-RDGQPAFATGTPGGARIITMVLQVILNVADHKMNIAAAGAVPRMHHQWLPDRIDLEPGFSPDTIRILQQSGHQVEPSRAA-GRVQSVVQNDDVWLGASDPRSDGAAIG. 632
108 0.000e+00UniRef50_A0A224YXL4 Gamma-glutamyltranspeptidase / glutathione hydrolase / leukotriene-C4 hydrolase n=2 Tax=Rhipicephalus zambeziensis TaxID=60191 Re  ali  38  235.......FSHWAVATDAAPCAGVTRNIMKKGGNLADAAVATMLCMGVVLPHSMGIGGGFMATIYLRRSKKAMTLIARERAPGAATWDMFVGNELARRGGLSVAVPGELRGYRTLLREHATLKWREHFDDAIRLARYGFPVGRHLAAALQQHKDDLSD--SLKKVFWNTNDTLAEGDLLVQPDLADTLEVIANKGPDYFYKGGIGEQMAKEIQDDGGVITKHDLKSYEAQWKRPIVAHLSNGNTLYTVATPGSGAVLTGILRVLERYN----------STVDQWHRFIEACKHAYGGRSHLADSDFADVKELEHNMTTPEWAAAVGNLINESTTFDPAYYGLNNSSPEDGGTAHATFWGDNGDVIVITSTINNYFGSKLRT-SSGVILNNQMDDFATPGMSNSYDIYPSSPNSIEPGKRPLSSMVPSVFVDCKGDAVLALGGTGGPEITTAVALVSLRSLWGGYDIKEAIDLPRLHHQLIPNRAVVEPDFPQEIIAELESKGHVFEVNQGNDSTVNGIKSEANCLHASYDLRRGGGIDG. 762
109 0.000e+00UniRef50_UPI0001CBA0C6 gamma-glutamyltranspeptidase 1-like n=1 Tax=Saccoglossus kowalevskii TaxID=10224 RepID=UPI0001CBA0C6  ali  36  83.........HGAVSSGARQCTELGVETLKNGGHAVDAAITTILCLGLVNAQSSGIAGGGFMLVKEGESD-VAVLDFREVAPLDAH--MYRDADLAFTGALAVAVPSEIRGLELAWRRYGRLEWFDLFEPVIRLARNGFEVTGSTAKAVVKELDRMMYSERLRNIYMPNGTRVKEGDTLKRPDLAAVLETIATEGADAMFNGRLSKEMIDTVLEAGGNLTAQDFLNYQPIWRTPLKTTYHA-ATVYTLGAPSGGPVVLSILGILEGYDLTSGAMKDP----LTYHRLIEAFKFAFAQKTRLGDPDFVDVRNLTQIMTSKESAAELRAMINDSSTYPSEYYGP-YLPKPGYGTSHACVIDNEGNMVSITSSVNERFGSGLMTPS-GILLNNHMNDFSWSDGSN---ITESTSNFIEPGKRPQSSIAPLLLLDA-GISELILGGNGGTAIGTGIAQVYLDIISYGLSLEESVNKRRVDRTSTDFKIEVEERIADNVVEGLLDRGHIVEMVDDIGSQVMAARRQNYALEAASDPRKLGSSA.. 606
110 0.000e+00UniRef50_A0A1B9AH01 Gamma-glutamyltransferase n=4 Tax=Bacillus TaxID=55087 RepID=A0A1B9AH01_9BACI  ali  26  16.ERETAKGKFGMVATAHPLATEIGKNVLEDGGNAIDAAVAIQFALNVGEPSNTGIGGSGFFMVYHKESGKIKIFDGHSQAPAAAHPEMFLDEHGEITHATAVGIPGILKAMDAALMEYGTKPLSELVEPAAKACEEGVPMNWVHIDMLDKFQYRLG--EEAKKLYFA--ESIKEGHILKKPELARTFRLIGKEGVEAFYEGEIAKAIVNTLQELGGFITLDDLKNYRHTIDQPVRGTYRGYEIAAASPPTAGGPILLYILKLLEKYDLKSYGLHSWEK----YYLFAETMRLAFSDKAYMGDPRFTDIP--LKGLGDERYLAERLKYIDFERNQDIDFGNPWKFEAEQSETTHFTVADAFGNIVACTSTVEHPFGTGILVPGYGFFLNNELTDF---------DPRPGGINEPAPGKRPVSCKCPTILF-KDGEPVLTLGSPGGPTIIASVFQTIVNIVDFGMDLKDAIEEPRIFC--SPGQISWEEGIDMIAKGKLESMNFEFGEVPHVIGNVQAIQFETGEMVGAADSSREGSASG. 555
111 0.000e+00UniRef50_A0A1H0YRS2 Gamma-glutamyltransferase 1 Threonine peptidase. MEROPS family T03 n=3 Tax=Halobacteria TaxID=183963 RepID=A0A1H0YRS2_9EURY  ali  29  61...SVAKGGGGMVSSVHRQATNAGVEVLKDGGNAVDAAVAVQFALNVVQPHSSGIGGGGFMLVYSAEEDEIIAIDNRERAPLGAQPDMFLNEQGEEVPGKAVGVPGTLKAADVAVKRFGTKELGELIEPAVELAADGVTVDEFLADSIAANVEEGSFTSTAKEVFAPGGDPLQEGDELAQPDLADTLRTIRDEGIGPFYKGEIAEDIAETVQKTGGNMTVDDLGRYNVEITRPVHVTYEGDTVRTMRSPTSGGYVIGQILSLLEPFDLAQYDRRSFDV----YHRMIEAFQLAFADRNYLGDEEFVDIP--WQGFLDEEYLDERRKIIDPKKATDPFAYQPGGTEEPSGQTTHFTTADADGNLVSWTSTIEQLFGSGIMVPGRGFMLNNELTDFDS---------EPGGPNEVQPEKRPLSSTSPTIVT-RDGDPFLTVGSPGGWSIIHTVSQILLNVAEFGMDIDEAVAEPRVYS-ATGTWVQAEGGVPDGVVDELNAAGHDVSVVET-IGNAQSIRIDDGEYVGVADKRRNGCA... 631
112 0.000e+00UniRef50_Q0VKT3 Gamma-glutamyltransferase n=134 Tax=root TaxID=1 RepID=Q0VKT3_ALCBS  ali  30  24...........AVASAHPLATQAGLNILEQGGNAFDAAVAVAATLAVVEPYSAGMGGGGFWLLHREQDGLQTFVDARETAPDAATAAMYQNKEGAVNGPSAAGIPGQAAAFVHLADNYGKLPLTSTLAPAIALAEHGFHVEEHYRKLAGYRKDVLNRFPEAAAIFLHNGKVPPNNHLIKQADLARVLRALAEKGNAGFYQGEVAKQLVDGVQQAGGIWTLDDLANYKVVERTPTVSQFRGGRVISAPPPSSGGIVMGEALNILSQLN----DGNTAEITP---HLAIEAMRRAYQDRAYLGDPDFVDIP--VDKLLSIGYAKQRASSITLDKATASSSLGEPVGVEEGFHTTHFSVLDKDGNRVAATLSINLPFGSGFVAPGTGVLLNNEMDDFSKPGSPNAYGLVGSQANAIAPGKRPLSSMTPTFVEFDDR--IAILGTPGGSRIISMVMLAVLN----NKPVEDWVNAVRYHHQYLPDEVQAEPAFDSQAAKDLVRRGHKVVSTGRNYGNMQAILWDSGEVTAASDPRGIGSA... 547
113 0.000e+00UniRef50_A0A2E2TI85 Gamma-glutamyltransferase n=1 Tax=Legionellales bacterium TaxID=2026754 RepID=A0A2E2TI85_9GAMM  ali  26  28........SQYAVASANPYATKAGIQILTSGGNAFDAAITVASVLAVTEPYNSGIGGGGFWLFFDAKHQKYQFLDARETAPAKATQTMFDNNQSAINGSLAAGIPGEVAGLIYLHQHYAQLSLAKDLQPAITLAQAGFVVTPYYQKRAAFRLKSLRAFSQTSKIFLENNDIPAIGYLIKQPKLAKTLQLIASTEGDDFYRGKTAKDMVEAVQSTGGIWTLSDLDNYHVIIRKPIFIDYKNNQIITAPLPSAGGIALKTMLNLMNQTDFFSLSH------IMQVHYMIEFMRNIYYDRKYLGDPAFNQIP--LKDLLSSQHATQILQRISPNKATASDTISSLDLSKEGMHTTHYSIIDAKGNIVSSTLSLNYPFGSGFVAGDTGVLLNDQMNDFAIINKTNAYQLLGGEHNLIAPNKRPLSSMTPTIIQSPDKTV--VLGTPGGSKIVTMLMLAVVSALE-GKTATEIVTQPRYHMQFYPDIVTYEADFNNVVLDKLIAMGYLMQKTKAPYGNMQVVIYNKKTLTAASDPRGEGI.... 550
114 0.000e+00UniRef50_A0A2E8QRU3 Gamma-glutamyltransferase n=17 Tax=Bacteria TaxID=2 RepID=A0A2E8QRU3_9BACT  ali  26  51..RSTVYAPNDAVATSQPLATTTALEILAAGGNAIDAAVAAAAVLNVTEPHMTGIGGDMFAILWDANSGRLVGLDASGKSGSNVDVEALLAEEEPSVGPRSVTVPGALSGWNALIEKYGTMTLAELLAPAIRIANEGFPVTPIIAQDWAGTVNGLRRDMGAAATFLIDDEAPAAGDWFRNPDLAKSFQRISEDGVQAFYGGDLGREVVEGLGTLGGYLTLEDLQSHEPKWVEPLSVDYKGYR-LWELPPAGQGIAALQMLKMLEGYDFSTMEHNSAE----YLHTLIEAKKLAHADLSYIADPAHMDVRP--AALLDANYLADRATLIDPFTAADRPD---PGQLATDSETIYLTVADRHGNMISFINSIFGYFGSRVVVPGTGIVLQNRGAGFT---------LEEGHPNQIAPNKSPLHTIIPAFVT-KDGDPWLSYGVMGGSMQPQGHVQVLLNMVEFGMDPQEAIDAARFRH-FSGTRVAIEN-LDPEVGSALEALGHQLRPQGVAFGGGQAILRLARGWAAASDPRKDGMAAG. 569
115 0.000e+00UniRef50_A0A1E4B6J1 Gamma-glutamyltransferase n=1 Tax=Gemmatimonadetes bacterium SCN 70-22 TaxID=1660163 RepID=A0A1E4B6J1_9BACT  ali  27  1......MGMQGALTSDHALATAAGADVLRRGGNAVDAAIAMAGVLAVVRPHMNGVGGDNFLLIRMAKTGKVYALNGSGRAGSRATPAFFAQKGMPGSGILSVSVPGAVQAWDDALRRFGTTTLRQALQPAIRYAEQGFPVSTRLSLDIAAEVKKVAADSAMAHTFLVNGEAPAPGTLLVQRELGRTLRAIATGGARAFYQGATARRIADFMEHEGGLLTATDLANHRATWQEPISTTYLGKQVL-AFPPNTQGATFLEMLNLAELSDLSAMGRTSAD----YVHTMVEGAKLAYADRRYIADPAFADVP--VARLISKEYARELGQRIRRDTIAASSAGDGTRDG--NGDTVYLTVIDKDGNAVSMIQSLFASFGSGRMVPETGIVLHNRGALFS---------LEPSHPNIIAPGKRPFHTLSPAMALNEDGSLFATFGTPGGDGQPQTLIQILNNVLRFGMTPQQAVEAPRWRI-FGGGRLGVEPGLRDEVRAELGRRGQRVTVQPPSFGGAQMIVIDPKARMVGSDYRREAYGLAW 522
116 0.000e+00UniRef50_A0A2T9YGK4 Uncharacterized protein n=1 Tax=Smittium simulii TaxID=133385 RepID=A0A2T9YGK4_9FUNG  ali  39  119.DSQQAFGSTGAVATEETRCSNIGLEILKEGGSAVDAAIASGICIGLVN---------------RAADGSSELIDFREEAPALATKDMYVNKTLSTLGGLASGVPGELRGYELAHKRHGRLSWKRLLEPTIKLARDGYVVGKMLGYNLNRYEKNINSTEGFKQVYLANGKVLKEGDMAKRVNFAKTLQKIADEGVDAFYKGSLTESMVSSIKKAGGIITAEDFSNYKAKLRKTSVFEYNGRKIIAGTPP-TSGSIVGFIYNVIEGYNFKDKS-----NMPTNIHRFVETLKFAYSQRTRIADPDYENVTETLSNQQSKEFAAAIRKNITDDVTHP............................................................................................................................................................................................................ 447
117 0.000e+00UniRef50_A0A257JUQ6 Gamma-glutamyltransferase n=13 Tax=Alphaproteobacteria TaxID=28211 RepID=A0A257JUQ6_9PROT  ali  28  38.KPAGVWTHSGMIAAANPLAVEAGLEILRAGGSAVDAAIAVQTALGLVEPQSSGIGGGSFMLHYDAETGDVVAYDGREVAPAAATDRLFLDDAGAVKSGRSQGVPGAVAMLHLAWKEHGKLPWNRSFQPAIKLASDGFKISPRL-NTVATQLKRITE-PGADVVYLMDGTALPAGTLLKNAAYADTLTQIAEQGPKAFYEGPIAADIVARSGQAPGTLSLEDLKAYKPNKLQPICRAYRERKMCGMGPPSSGGIGVMATLGILENFDMGSTGPND----VLGWHRFIEAQRLAYVDRTYVADDRYVAVP--IAGLLDATYLKSRAALISDTSTMTVEPGEPPGSVKRGRGTTHFVIVDQRGNVVSMTTTVESLFGSQRMVR--GFFLNNQLTDFSFRNVDAKGEPI---ANAPAGGKKPRSSMAPTIVFDKDGHFELAVGSPGGNAIIAYVAKAMVGMLDWNLSPQDAVALPNIVARSSP--VALDRRASPELIKDLEALGQTFRDGGGAGSGLHAVRLTSEGLVGGADPRREGVA... 580
118 0.000e+00UniRef50_B5BM47 Uncharacterized protein n=37 Tax=Chromadorea TaxID=119089 RepID=B5BM47_CAEEL  ali  33  91.EPSNAIFEKAALTSDNAACSKIGGEILRKGGNSIDASIASMFCLGVVNPQSSGIGGGFLMTYFDQKSGDCYSIDARETAPAAASRDMFLNDDGSKYGFKAAGTPGEIAGYWHIFKKFGKVTWKELVQPSVKLAREGHPVSPYLATVMKVKERHFRLFPSVKHWINPTNDTYQSGDLLKRPKLAKTLERLGNNPVQLFYHGEMAKTLAKEFQEGGGLITEQDLANYKV--REYVNSNFRGTLTMCGGPPPSSFGVTQLIVSAMSKL-FPEGHKDDIYNDPKVLHKYIEAMKFAYAQRTLLGDHDFVKALELSKNLTTPEYTQWVIDRMTDKAQSSKNYGGIAQYVPPDHGTSHVSAMDQYGNGVSATTTINRWFGAAVESSEYGILWNDEMDDFSTPGMENGFGFAPSETNFIEPGKRPMSSMSPMVIFDHTKKVRMVIGGSGGSKIISALAKSIVRSLIFHDSIKKAIDAPMIHNQFTPDITQLDDEFPINMKNILEEYLQKFRNTTGFEGIIQGVNVLNDGIYACGDYRRDQEPSGF 643
119 0.000e+00UniRef50_A0A0D2GCU3 Gamma-glutamyltransferase n=3 Tax=Deltaproteobacteria TaxID=28221 RepID=A0A0D2GCU3_9DELT  ali  28  13......MGDRFMITADHPLAVQAAASVLEAGGNAMDAAICANLVLTVVRPHMSGMGGDLFALVYKSDTGAFEALNASGRAPARATLEFFKEKGMPEYGILTSTVPGAVMGWHSALERHGTMGLDKLLARAIDYAEKGFGVYTDLRKAMIDRRSKLEESQAAMDTFIPQGKVPEVGSILYQPTLAKSYRLLADMGPDAFYNGPLGRALVEYSDQLGGLFSEEDLAAHRVNWVDPLKTGYRGYEICTQ-PPNSQGLALLLQANMLDTFDISGLKPDSAEL----IHLMVEAKKLAFADRAYVCDPEFNEIP--LDKLLDKELARDQAGKINPDQAAPQPEL--RRFTTGGDDTVYLAVVDEDGNAVSLIQSIYEAFGSCVMVPDSAMVLHNRGRGFS---------LDPDHPNCLAPGKRPYHTLHPAMIL-KDGKPAYVLGSPGADGQTQTVIQMTTAMLDFGADPQQAMEAPRW--RAEPDTLLMEGRFPAETVKALEQKGHKVKVLDDWMGSSQAIRINENGLMGGADPRR....... 526
120 0.000e+00UniRef50_A0A1Q9NTK9 Putative gamma-glutamyltransferase YwrD n=115 Tax=cellular organisms TaxID=131567 RepID=A0A1Q9NTK9_9ARCH  ali  23  13..RSAVYAYNGIVATSQPLASQIGLYILQKGGNAADAAVATAAALNVVEPTSTGLGGDCFTLFYNNRNKNIFGINGSGRAPKELSINYLNNDTIPIFSPHTVTVPGAAAGWIDTIEKFGSLTIEEVLQPAINLAENGYPVSPVVALSWKSGEKQLRHGPNAKEL-MINNRAPNPGELMKIPTLAKTMRAITEQGKKGFYEGVVAESIIDLLNSLGGVMTLDDLKNHKSIFVDPISVNYHGIDI-YEIPPNGQGITALLALKILEEFNLEEKNPYSAE----YLHIMIEAMRLAFADRWYVTDPEFEHIP--ISQLLSNEYARERKKLILPDKAT---LHQVHGSPTKSSDTIYLSVIDKDGNACSFINSLYMGFGTGLIPKNTGVSLQNRGANFS---------LNPNHPNALKPNKRPYHTIIPAMAL-KDNELYASFGVMGGFMQPQGQVQVLTKMVDHGYDPQQALDAPRFCDGTSGGVIALEEGIPQNVINKLSLMGHDVHPVSGWFGRGQIIRRNDGVIWAGSDPRADGCAVGY 542
121 0.000e+00UniRef50_A0A158QAQ6 Uncharacterized protein n=1 Tax=Enterobius vermicularis TaxID=51028 RepID=A0A158QAQ6_ENTVE  ali  40  50.......YTKAAVAADNVFCSEIGRDILLKGGNAVDAAIGALFCIGVMDAHSAGIGGGHFMTVYNHTTRKCSIIDARETAPSKASEKMYVGRNMSEKGWLSVAVPGELHGIWTAYRNFGGIGWDKLLQPTIQLLMEGHPTSHALAKALKDEEKRILAEPTM-EMFINKKKVYEAGEQIVRGKFANFLKKLAEDPIKLFYNSSLTKEIIEAV--YGGILTLEDFALYESKLYEGISATFENGYRICGPPPPSGSAVAQAILKILDEYDMAKTDPE------LVLHRFIEASKFAYAARSDLGDLTFNATALKIKQIISAEYAAKIRRLITD-KAHPSSYYGGDFEPVEDHGTTHISVLDSQGNAVSVTSTINLIFGSGVASPSTGIIWNDEMDDFSSPGRPNYFGLLPSKANFIKPKKRPMSSASPLIIYSKDPEEVFVIGAAGGSRIISGVAGVAMRVLWLNEDVKRAVDAPRILNQLTPNVTYYEEGLLQKYRIGLEKRGHTM-VLRSNLSVVTSVERKGDNLYANSDYRKESSPAG. 621
122 0.000e+00UniRef50_A0A2P4I3Z8 Proteasome endopeptidase complex n=1 Tax=Quercus suber TaxID=58331 RepID=A0A2P4I3Z8_QUESU  ali  30  504..........GAVSSENAICSNIGLDVLRKGGNAADSLIATNLCVGVVSPWHSGIAGGGFMLIRSSK-GSYEFVDFRETAPAASFQDMYSNNNASLVTGLASGVPGELKGLQHLYENYAKFPWSDLVMPAVKVARDGYPVGADMVRYMASAENFLVTDPAYAIDFAPNGTLLGLGDTITRKRYAATLETIAERGIDAFYTGPIAAATINVIQSNGGIMTLADLKNYSVAIRQPGEITYRDFKIHSTT-APSSGSVVLAVMKVIEGY----KTIGQAATINESTHLFDEALRFAYGQRAFLADPSFNSIDQYQFETFSAETAAEVRSKINPLHTQDVSAYDPSGESLQTHGTSAIVASDASGMSIALTTTVNTLFGSHIMVPETGVQLNNEMNDFSIPGVSNAFGYVASPANYVAPGKRPLSSICPTIVEHTNGELYFVVSSAGGSRIITAVLQNLWHVLDQNMTAPVALAAPRLHDQLEPNTVSFEYAYNNETTAFMASLGHNVTWVAPGGSTAQSLRRSNGTFEAAGEPRSGGLAV.. 1060
123 0.000e+00UniRef50_A0A2E3HYL8 Gamma-glutamyltransferase n=14 Tax=Bacteria TaxID=2 RepID=A0A2E3HYL8_9BACT  ali  24  14..RSAVISQSGAVATSQPLAAHVGLQILQSGGNAIDAAVATAAMLNVVEPMSTGIGGDAFMLIYRPEDGEILGLNASGRAPYAAEQAFFIDQGLSHISMYAVTVPGAVDGWAMLLEKCGTMTMADVLKPAIFYAENGFPVSPQISASWQASVPLLSYCSDTLQTYLIDARAPKPGEIFKNVNLARTLRLIGEGGRDAFYRGQIAEKIVKFSTENGGLFAMKDFINHTSDWVEPISVNYRGYDIC-EIPPNGQGIAALMALNVVSEFDISAMGHNSTE----SLHCLIESMKLSFSDYEYITDPTFENVP--VDGLLSTEYAKAQKNRIDPDQAMPPSAGNPRM----GDDTIYLSVVDKDRNVVSFINSLFHGFGSGLVAGDTGILLQNRGAGFS---------LDSSHANCIDSHKRTMHTIIPGMI-AQDGVPLVTFGVMGGQMQPQGHLQLVSNLIDFNMDVQSALDAPRFRVMDDGN-ISLERGIPDGISNRLREKKHRIVPPPTFFGGGQAIFVHPETLIAGSDPRRDGCAVGY 541
124 0.000e+00UniRef50_A0A2P2E9Q0 Gamma-glutamyltranspeptidase n=102 Tax=Proteobacteria TaxID=1224 RepID=A0A2P2E9Q0_9PROT  ali  28  41.KPAGVWQHGGMIAAANPLAVEAGLEVLRAGGSAVDAAIAVQTALGLVEPQSSGIGGGAFMLHYDAQTGDVTAYDGREVAPAGATDRLFLDEAGAVKSGRSQGVPGAIAMLHLAWQEHGKLPWGRSFQPAIKLASDGFKISPRLNTVATQLKRFTEPSPDVVAYLMDSGNPLPAGTLLKNQPYADTLNAIATQGPKAFYEGPIARDIVARSGQAPGTLSLADLKAYKPAKLEPICRSYRERKVCGMGPPSSGGIGVMATLGILENFDMAATGPQS----ALGWHRFIEAQRLAYVDRTYVADDRYVAVP--IAGLLDATYLKSRAALISDTSTMKVEPGEPPGAVKRGRGTSHFVIVDNRGNVVSMTTTVESLFGSQRMVR--GFFLNNQLTDFSFANVDAKGEPI---ANAPAAGKKPRSSMAPTIVFDKDGHFELAVGSPGGNAIIAYVTKAMIGMLDWNLSPQEAVALPNIIARTSPVALDR-SRASPELIQGLEALGQKFRDGGGAGSGLHVIRLTPQGLVGGADPRREGVA... 583
125 0.000e+00UniRef50_A0A1D1VM15 Uncharacterized protein n=2 Tax=Parachela TaxID=210572 RepID=A0A1D1VM15_RAMVA  ali  39  145.......YSRQSVASDAANCSIVGNDILNKGGSAAEAAIAAALCAGLYHPHSCGIGGGFFMVVYDRKRGNATAIDAREMAPGASTELMYVQNKSSTKGWQAMGVPGEIAGYRQAYDLFGKLSWRDIFEHSINLARNGLVVNEVLAGALRGAEEDIKNDAGLTDTFINTGQIYKEGEIIRYPELANTLETIAEEGVDSFYRGDLARKMVKDIQDGGGIITLDDMANYRVTVSNATQLPLPGTNKVFGVPPPAGSLVLQYIVNIMDGYGYGNWDTMTDEQKIQFYQRFAEAMKYAYARRTELGDLKFEPVADIKETLLSPWFGHLTRMLINENQTSNTKAYGVEVANLQKTGTSHISVIDKDGNAASITTTINTHFGSRRVSQSTGIILNNEMDDFTTPNQPNYYGLPPSYANRIEPGKRPQSSCAPVIVTDGNGEARIVMGASGGSRIISATANALLRVMYLGQDVKEAIDAPRLHHQLLPIQLEYEYGFVRKHLEGLQQKGHNVQ-FSSTFAVVQGLVRDDGMIEANCDYRKKGAPAG. 695
126 0.000e+00UniRef50_D1C3G5 Gamma-glutamyltransferase n=3 Tax=Chloroflexi TaxID=200795 RepID=D1C3G5_SPHTD  ali  27  7..RPTTLAVEGMVATPHYLASVAGLRALQSGGNAVDAAVAANAVLTVVYPHMCALGGDAFFLIWEPGEGRLHALNGSGRSPAAASIDALTAAGMPQRGALAVTVPGTVHAWETVLDRFGTFGLSDLLQPAIAYAERGFPVSPGLHAAIAQARPLLEQQDAAARQFLPGGKVPAVGDVLRQPDLAASLRLIAGRGADAFYKGAIAQSIVDSLREHGGLMTLDDMAVHRSDWVEPLRTTYRGVELV-ELPPNTQGVTALQMANIVEGFDVAGLGYGSAEL----IHRCVEAKKLAFVDRRYITDPERVPIP--IERLIAKEYAAELRQRIDPDRAWTPEA-----DSPGGGDTVYLCVVDRNGMAVSLIQSIFQGFGSGLVADGTGIVLNNRGASFT---------LDPDAANRLEPSKRPMHTLIPAMLL-RDGQPWVVLGTMGGHGQAQTHLQLLLNLVDFGMEPQAAIEAPRWVSRGTPDVLRIEPGFGAATIERLRAMGHETEPFSSLMGHAQMIQRERGILLGAADPRADGYALGW 535
127 0.000e+00UniRef50_A0A2E0AVP0 Gamma-glutamyltransferase n=1 Tax=Blastopirellula sp. TaxID=2024826 RepID=A0A2E0AVP0_9PLAN  ali  30  31.......AGQGMVVSETSLASGIGQRMLARGGNAVDAAIATAFALAVTWPEAGNIGGGGFMMIRSP-DGEAVCIDYRETAPAAAREDTFQ----PGDGYLTVGVPGTVRGLGLAHQRYAKLPWRGLVLPAAHLARDGFPVDRYLASSVNHVLSVVSRFAELKRVYGPGGGNWQAGDVMRLPDLAKTLMRIAEHGPDAFYQGPLARSLVEEMERGQGIIREADLDAYRAVVRAPVRGTFRGYEVLGAPPPSSGGTCLIESLNIIEALEVNPAERFSAE----TIHLIAEASRRAFLDRAYLGDPGFVKIP---AKLLTKKYARKLAGEIERQQASSSAALAPEIKADESPDTTHFSVVDGEGMAVSNTYTLEASWGSRIVVQGAGYLLNNEMGDFNFPGVTTRYGRIGTLPNVVAPKKRMLSSQCPVIV-CKEGKVALVTGSPGGRTIINTVLGVVLNVTCFGMDAAAAVRAPRMHHQWFPDRIQLE-RLDRQVVKDLKQMGHQV-VNRSSQGSAHTIWWDPESYVGIADFRRGGRPMGY 563
128 0.000e+00UniRef50_A0A2D8BCT8 Gamma-glutamyltransferase n=4 Tax=Bacteria TaxID=2 RepID=A0A2D8BCT8_9GAMM  ali  27  37.TRSVVYAPEAMAATSHPLATQVALDVMKRGGSAADAAIAANAALGLMEPTGNGIGGDLFAIVWDPKTQKLHGYNGSGRSPRGLTLKWFQDNGHPSHGPLPVTVPGAVDGWFALHGRFGKLPMAEVLAPTVRYAREGHPVHDTIAYYWNRSVPVLSKWPGFSEQFTIDGRAPRTGELWKNPNLANTLETIGREGRDAFYKGEIARTIDAYFREHDGFLRYEDLAAHEGEWVEPVSANYRGVD-VWELPPNGQGIAALQILEILEGYDFSQIPFGSPEH----VHLFVEAKKLAFADRAWYADPDYFPARDLVRELVSPEYAAKRRALINPDRAARSVDAG----ILQHGDTIYLTTADKDGMMVSLIQSNYRGMGSGMAPPGLGFIFQDRG---------EQFVLKAGHPNTFAPGKRPFHTIIPAFIT-RDGKPWVSFGLMGGAMQPQGHAQIVMNLVDFGMNLQEAGDAPRIQHDNDGGVLNLETGFPYETIRALMRKGHRIEFADGPYGGYQAIARDPGVYAGASESREDGQAAGY 581
129 0.000e+00UniRef50_V5PNC1 Gamma-glutamyltranspeptidase n=16 Tax=Bacteria TaxID=2 RepID=V5PNC1_9BURK  ali  27  47..........GMVTSSNHLATQAGLKVLQRGGNAVDAAIAVASTISVVYPQMNTIGGDNFWLIYNAKTKTLRALNASGRSGEHATLQFYKDKGLSPRGYLSVTVPGAVSGWDAAY-RYARLPWRDLLSDAVHYAKEGFVVTPSLAKWEAINVDNLQQYEGFRKIFLPGGKPYQLGETLKQPELAGTLEQIARQGAEVFYKGEIAHRIVSDLQANGGMLTLDDFARHRADWVEPITVKYRGFD-AYNFPPNTQGFASLEILNILNRFDVKSLG----EGTADYYHLMVEATKQAFADRRYLSDPDFVEIP--LHALLSTRHAEAQAARIDMARANDVKPMDPK------GDTVWFGVVDRDGNAVSLIQSIYYDFGSGIVPKGTGILMQNRGSFFS---------LDPKHVNHLEPRKRTFHTLNPAMLL-KDGKPYLVYGTMGGEGQPQTQAAIVTRIVDFGMSPQDAINAPRWYGRTWGNDLKIEGRVSAVVTDELRRRDQPVKVVEPFMGHAGAILIDPGVRQGASDPRGDGLAAG. 579
130 0.000e+00UniRef50_J9VNW0 Gamma-glutamyltransferase n=30 Tax=Tremellomycetes TaxID=155616 RepID=J9VNW0_CRYNH  ali  35  151.......ATTAAVASEDVTCSNLGLSILQKNGSAVDAAITTTLCIGLLNAFSSGIGGGGFMVVRVPETHEVVALDFRETSPALCEKDTYAGRMAAQVGGLAIGVPGELRGLEAAHKLYGALPWKDVVMPVAELA-KGWRVSRELARRLRLFGDFMLSSPTWSAVYAPRGPLLVEGDFIQRLNYGKTLEKIAEEGASAFYQGEIAESSVKTIAKAGGVMTLDDLKSFKAFSYPAIHSTFMSKDIYTTSAPSSGGIMLGL-LNVLEPLNITS---NNGLKNPLNLHRFIEALKFAFGARSWVTDPAFAKDKKRLEEVYTKEWADEIRKKITDNETHSADYYGLQYDTPIDHGTTHLSTVDKWGGAASVTSTINLIWGSHVMDPKTGIIFNDEQDDFAVPGAPDAFGLWPSPWNYPAPGKKPLSSTSASIILNPSPSLYAVIGGSGGSRIFPSVAQVLLNLFS-GLDISESIEAYRVHNQIVPDLTTIEEGVDEEVVEGLKERGHKIGEFDVNIGIVQAIVVEDGHIFASSDSRKNGIAAGY 711
131 0.000e+00UniRef50_A0A1Y2BKW2 Gamma-glutamyltranspeptidase n=3 Tax=Naematelia encephala TaxID=71784 RepID=A0A1Y2BKW2_9TREE  ali  32  9..........GAVTSEHTRASEIGTDILRQGGNAVDALIATTIAVNTLCPYHSDIGGGGFALLRLP-DGRHESLDFRHVAPKAVTMEFYKTA-STQRGGTAVAVPGQMRGLEELHKQHGKLSWKKLLEPSIKLAREGFEMHRDMFWYIKIEGSWMANEPE-CSIFVQDGEILPVGGTVYRKGYANTLETIAEEGAGAFYEGPIAEALVKAVRNKGGLMTVQDLKDYKPQWNTPLSAKYRGN-TLWAPPAPASGAIWLSAMGTLAHFEPTTSG------SVLDLHRLTEVLRLAYGQRTQLGDPAFVPLDERQRQWISAESVAERAKMVDDSKTFPPDYYKPPGEIKEDHGTSNITVADSSGLVISVTTTVGLDFGSRVIVPGYGFCLNDSMDDFSVEGKPNATGYAPSPANYVVGGKKPLSSSCPYIIENDKGEVVLAGGAAGGSTIISANTQVARNVLDYGMSAAEALRANRLHNQILPNVSLLERGFSEEQARGLQEKGHVIEWLPAIRNTTCAIKFFPGDWEPAGEPRKHGS.... 548
132 0.000e+00UniRef50_A7S179 Predicted protein n=1 Tax=Nematostella vectensis TaxID=45351 RepID=A7S179_NEMVE  ali  40  30..PAPREFPHAAVAADHELCSKLGTQALKDGGHAVDAAIVTALCVGVVNPHSAGIGGGGFMVIYDRESSKCTAYIFSSLSPA----EM---NTMRPSEGLMVGVPGELRGFEKAWKKYGKLKWERLFQPAADLCKKGYKVHPSLATAIAKNALNITNSNSLGEIFTRNGKMLVEGDIVKRPVYGKTLEEIGKGGADIFYNGKMSKTVVKDINGEGGIFTLDDLKEYIAGDAKPVIA-YLGHKIITPPPPAGGGAVMSEALQILSGYNFKPSDLK--DHPGLTYHRMIEAFKFAHASLTYLGDPRYMDADKVVKKMVDQTHSNNLRKFI-DNRTHPVKYYGPINYRTDTSGTTHLSVVDADGNGVSLTSSINKYFGSKIRSKKLGIIYNDQLAD-SMNHWVNEYGLVPD--NFL-PHRKPLSLACPAIIVDKEDNLQMVIGAAGGRYIPTTLAQVIMNYYWFGLNLKNAVARPRLHSQLFPEMVLVEENFSHKLIKKIKRFGHRT--PTQIMGVVQVIVREKGKLLALADYRKGGIADGY 559
133 0.000e+00UniRef50_I4AMS2 Gamma-glutamyltranspeptidase n=1 Tax=Bernardetia litoralis (strain ATCC 23117 / DSM 6794 / NBRC 15988 / NCIMB 1366 / Sio-4) TaxID=880  ali  27  59.....VLGKNGMVVTAHPLASQIGLEILKKGGNAFDAAIAVKFALAVAYPRAGNIAGGGFAILRF-KNGESTALDFRETAPLSSTTTMYLDEDLSQEGHLSVGVPASVAGMVELFEKQGSLSWEELIKPSIKLAQNGIILTENEANKLNDYQEEFRKWNDEKNVFINNTSKWTKGDTIIQKQLAETLTRIKNEKRAGFYKGKTAELLLKEINKGKGIITQKDLDDYKPVWRKPISQTISAYTILSMPPPSSGGIALAQ---LMQGFNQNRSPLNLKHNSATTLHILTELERRVYADRTYLGDPGFYDVPQ--KMLLDSSYNMERNSTISLFKKTPSDSIEGKVNSIESMETTHFSITDKEGNAISLTTTLNGNYGSKVMVSGAGFFLNNEMDDFSIKGFPNQFGLVGAEANKIEANKRMLSSMTPTIIEKKTGKLFMVLGTPGGSTIITTVFQVILNVTVFEMDIQDAINAKRVHHQWLPDEVYYEN-LDDAVITK------LKKLGHKLKKVGQAILVPNGDFVGAADYRGDDTALGY 618
134 0.000e+00UniRef50_E4V1V8 Gamma-glutamyltranspeptidase 2 n=1 Tax=Arthroderma gypseum (strain ATCC MYA-4604 / CBS 118893) TaxID=535722 RepID=E4V1V8_ARTGP  ali  30  42......TGKNGAVVSAGDICSRVGTSIILRGGNAVDAAVATDFCLGVTHPWIAGLGGGGYAIVRDA-SGNAECVDFREAAPAASDRDMFLDANASISGGLASGIPGELRGLDYLHRQYGKMSWKEVIAPAIKVARGGFSVNQLLFDAMSKAINFFVRNADWAEVFAPKGTMLGVGDVMKMERYADLLELVATNGTESFYAGPTATKIADTVKKNGGIMTTQDFQAYQIKRSAPIEITY-GNYKIKACRATSGGTIVLMTMNAFHQFP----DREDPNNVNLTLHRLVEAMRFGYAARATLGDPDFNPQDSSEARLIQQHTADEVRAKISDMHTLPVEAYNPELEIISNHGTSHLSAADASGMAISLTSTPNLSWGSKLMIPGLGLIMNNGMDDFSVPNRSNHFGYIPTKSNFIAPLKRALSSMSPVIVDHPNSSFYLATGGAGGSHIISGVEQMLWRLLDLGSSAKEAIDAPRFHDQLIPNVLNLDQNWDNGTFDFLKELGHDTQWGNVGV-DLHVLRLKNGTFEAAAESRSGGFAV.. 579
135 0.000e+00UniRef50_Q9M0G0-2 Isoform 2 of Glutathione hydrolase 3 n=2 Tax=Pentapetalae TaxID=1437201 RepID=Q9M0G0-2  ali  39  73..SDVVESENGVVAADDARCSEIGASVLRSGGHAVDAAVAITLCVGVVNPMSSGIGGGSFLIVSSQKDSKAEAFDMRETAPLAASKDMYKNDASAKSGALSMGVPGEIAGLYEAWKRYGRLPWKPLFEPAIKLARDGFVVYPYLGKAISTKVAMILKDPGMRSVFSRNGQVLKTGETCYNPELAQSLETISEQGPGAFYNGTVGEKLVKDVKKAGGIITMDDLRSYKVRVTDAMSVDVMGYTVHGMPPPSGGTVGFSMVMNILDSY----SNLYTASGRELGLHRLIEAMKHMFAARMDLGDPEFVNVTNSMNQMLSKAHAEEIQKRIFDNTTFPPEYYMNRWSQLRDQGTSHFCVVDADRNSVSMTSTVNYRFGAGVLSPSTGIVLNNEMDDFSTPTEITPDMLPPAPTNFIEPNKRPLSSMTPLVIT.............................................................................................................. 496
136 0.000e+00UniRef50_A0A2D9HXS4 Gamma-glutamyltransferase n=1 Tax=Rhodospirillales bacterium TaxID=2026786 RepID=A0A2D9HXS4_9PROT  ali  29  73...KAVTAQEYMMVAAHPVAAQIGAAILDEGGSAVDAIIASQIALNLVEPQSSGIGGGGFLLVWDAKTGGLTSYDGRETAPANGSGDYVLQQDGAVTGGASVGVPGILRMLELAHQDHGTLPWAPLFTPTIQLAEKGFPISPRLNGLLQD-APYLKDMEPAGSYFYDTGKPHPIGTILRNPDLARSLRAIATGGADAFYTGPLAEDIVTAVQRNPGALSLTDLANYTAKRRDNLCLTYRIYQVCGMAPPSSGGSTVLQILGLMEQSDIRKTDPLSADG----IQIFGEAMRLAFADRNFLADTDFVSVP--LKEMLSPAYLVRRARTMDFSHAVPREAGNPTDDSPELPSTSHLVAVDRTGSVATMTTSIETGFGSRVMVG--GFLLNNQLTDFAWSDVEN--GLP--IANRYEPNKRPRSSMAPTLVFGPDGQPRLALGSPGGSRIIGYVAKTVMAVLDWDMSLQRAIETTHFLNRNGAMEIEEDPNLD-GIAATLTARGYDVQR-RAMASGLHGVEFIGGQYIGGVDPRREGLAVG. 619
137 0.000e+00UniRef50_A0A2H6A3Y4 Gamma-glutamyltranspeptidase n=10 Tax=Bacteria TaxID=2 RepID=A0A2H6A3Y4_9BACT  ali  27  25..RPTVMSLNGMVASGHPLASEAGIRILREGGNAIDAAIAAWLVQGQVEPGMTGIGGDMFILIYLAKTNEVKFINGTGPAPMAATAEFYRSRGMPRDGALSVIVPGALGGALLALEKYGSLPRDRVMAPAIELAERGFPISDELARQLRSARERLAKFPSTTKVWFRNGEPLGAGDILVNRDLARTLRQIASGGADAFYRGPIAQRSVAFIRQHGGIHTEADWANYRAHEDQPISVTYRGIE-VYECPPNSQGHVMLQALKILEGFNLKYMGHNSAP----YLHLVTEALKLAFADRAYVSDPRFVP-PIPMRELLSEEYAAVRRALIDPRRAGEPPPGDPSRPQPNPGDTTYLAVVDRDRNMVSITSSLLSGFGSGMVVEGAGFFLNNRMAYFS---------LDPGNVNVLAPGKRTRHTINPALAL-KDGKPYLVFGTPGADTQPQTQLQFFLNVVEFGMGIQQALEQPRYYPQEIGGTLLTPAALPVHVREELASLGHKLDVRNRGVGRVKAIMVHPGALLGGVSPVGDSYVIGW 583
138 0.000e+00UniRef50_A0A1I3JBX1 Gamma-glutamyltranspeptidase / glutathione hydrolase n=2 Tax=Ruminococcaceae bacterium D5 TaxID=1520815 RepID=A0A1I3JBX1_9FIRM :_  ali  28  49...SAATGKNAAVSSANPAASAIGAQILQRGGNAVDAAVAVSFALGLLEPNASGVGGCGYA-VYVPAVGEPAFYDYRSAAPAAFDPGAFT------------ALPAEVAGWLSLHEQYGRLPLDELLEPAIDLSENGFEVLPFLASLFTDNYNLLLKDESCAALLLNDDFPYMEGEVMKNPGYAKTLRKIAAEGRDGFYQGEIAEAIVSASSARGGTMTLEDLASYEVRVGKPLEGNYRGFTILTSAPSSSGGIALIESLNLLERCDLPASGVNTP----LTLHRMGEAFKIANADRSYVGDPAFTDIPT--EMLISKEYADERAALLSDERVLSDLEVLPDNQ---STSTTHLSIIDAEGNAVSMTNTLGTYFGCAVAVDGWGFLLDNQLHDFSIEEW---------EANAPEPGKRPRSSMTPT-VLLRDGKPVAALGSPGGEAIVSTVAQIICDLVDFGMPVDEAINLPRIY-QNCTGPLVVEGGHAESTLSGLEALGHTLEELDYFFGGVHAVVRNDGTLTGAADPRRDGGVCAY 570
139 0.000e+00UniRef50_A0A2H5W382 Gamma-glutamyltransferase YwrD n=61 Tax=Bacteria TaxID=2 RepID=A0A2H5W382_9BACT  ali  25  38QARSMVISQHGIVASEHPLASQVGALILARGGHAVDAAIAANAVMGVVAPMSNGIGGDLFALVYDARTGRLHGLNASGWAPSGLTIEFLKRQGMPQRGVHTVTVPGAVDGWAKLHARFGRVKWADLFTAAIQYAEDGVPITELVAELWAANERLLRQNQAAARTYLPQGRAPRVGEIFRNPDLAWSYRQIAAHGPEAFYQGEIARRILSALQREGGTMTAADLAEFSSEWVAPISTTYRGW-TVYELPPNGQGIAALIMLNLMEQFPLAEFGHNS----ARALHIMIEAKKLAYADLRYVADPRWARVP--VSGLLSKAYARERARRIDLAKAQ--CEVEPGIPPDAGDETIYLSVVDREGNMVSLIQSNYESFGSGLVAEGTGFALQNRGALFSF---------DPAHPNALAPRKRPLHTIIPAFMER--GNMRIAFGIMGGWNQAQAHAQFVSNIVDHGLNIQAALEAARFTKRTFGGDVQIEARVPERVRAELQALGHQLQVRGAYMGGGQAVARDTGVNFGASDPRKDGAAV.. 564
140 0.000e+00UniRef50_F4GQ66 Gamma-glutamyltranspeptidase n=3 Tax=Proteobacteria TaxID=1224 RepID=F4GQ66_PUSST  ali  28  37.......AAHYMVSSANPLATQAGVDILAEGGSAADAIIAVQLVLNLVEPQSSGIGGGGFLIGYDAATQKVQAYDGRETAPETARGNRFMQGGKAVNSGLSVGTPGLLRMLGQVHGEHGKLEWARLFEPAIQLAEQGFEVSPRLHAMLDENAE-LRRQEASAAYFYDEGRAWPVGHVLKNPALAQVLRDIAKNGPDAFYQGKVARHMVDAVAGHPGDLNLRDLAGYRSIEREPLCAPYKVYVLCGVPPPSSGPLAIIQMMTILSHTPIADLPPVSPE----AVHYFSEAGRLAFADRAYVADPDFADIP--VKALLDPQYLRLRADLIMPKRTGKAPPGDPEDTSPELPSTTHIVVVDREGSVMSMTSSIESAFGSKIFVD--GFLLNNQLTDFSLSDVDAQNKLV---VNRLEPGKRPRSSMSPMLVL-KDGKPYMAIGSPGGASIINFVAKVLVGVLDWNLSLQEAIDLPNFGSRN--HYTDLEKDVLRDVAEDLRAMGHEVREVDFP-SGLQGIRLTPDGLEGGADPRREGVAAG. 571
141 0.000e+00UniRef50_A0A0Q9WLW2 Uncharacterized protein, isoform C n=13 Tax=Drosophila TaxID=2081351 RepID=A0A0Q9WLW2_DROMO  ali  37  186......VYQHAAVCSDTDACSQIGSNILERNGTAVDATIATMLCNGLLTSQSMGIGGGLIMNIYHRESQQGYQIDAQAVAPYASHQKMFKDANASIFGPLSIAVPGEVMGYHLAHKRFGKLPWRTLVEPSLKICETGYRMSNHQASKVKMMWSYIKDNLQYQSVFLNTGEHHQEGALLKPPKLCNTYKLLAENGPMDFYNGTVAQMLAEDLKELGSIITQDDLDTYTADLRLSVTMPL-GNDTLYAVPPVSSGSVVAHILGILEGFNFTRADLADDESYALTIHRITEALKFGFAHRPELGDPRFNDIRELVSQLTNPQYAAQQRAKINDNQVLSPQDYGALLSSEEDPGTSSFAVLAPNGDAVAVTSSINNYFGSSLIGPRTGIILNDCMNDFSV--KENIFNLPQSQANTIDLHKRPMSSQSPMLLADRDGNIRLAIGAAGGTKIVGGIVEVAARFLWFGEDLKTAEDAPRFYNQLFPNVLEYEDGFSENVLSLLRKRGHILKPLSQASSVVCAIGRNATAIYANADGRKQGGVGGF 723
142 0.000e+00UniRef50_A0A2R7WF77 Uncharacterized protein n=1 Tax=Oncopeltus fasciatus TaxID=7536 RepID=A0A2R7WF77_ONCFA  ali  40  1....................................................MGLGGGFIMTLYIK--GKAYSLIARETAPAAANPRMFKDPKLSRTGGLAIGIPGELRGYYEAWKKFGNLPWAKLVEPTVQLCKDGYTLSQPQYDAF-TFRPNIIEDPIFKEMFYNSGKFHPVGSIIKPTKICNTLKTIMLEGGNAIHNGSLTNLIVEDINALGGLVTKEDLNNYKADWVDPVSITLAKGDRVHSAPLPGSGPLLLYTLAILDGYKLTA--PSDIPSQILTAHRTLEAFKFAFARRTELGDPNFINVTELMRNLTSPRYAEETRLRINDSMAFDPKHYGAVFYNQEDHGTAHISVLSGDGDAVSVTSSINLYFGAGATSPSTGIVLNSVMDDFSIPGVLNYFNLPPSPNNFLQPRKRPLSSSCPTVVVGADGEVKLVLGASGGTKITTAVSWVIMRNLWFNEDVKQALDASRIHHQLTPMEVSYEFGNLQQVIKGLQKLGHKTTRYRERGSVVCAISKKEGKVFGNADFRKGGEVAG. 499
143 0.000e+00UniRef50_A0A058Z396 Gamma-glutamyltransferase n=1 Tax=Fonticula alba TaxID=691883 RepID=A0A058Z396_9EUKA  ali  34  108........SEAAVATEHPTCSHTARRVLEEGGSVVDAAIAASFCIGVVHNFASGIGGGGFMLVHDVEHSSIHLYDFREMAPALAHRDMYVGDDKAKYGGLAVAVPGEVRGMHLAWTKHGRLPWARLVYPSFELAFHGFEVNDLLARRLLQVEQLVLTDPLWAESYLVDGRLARTGDTIRRRLLADTLNAILVD-PEAFYTGPIAESTIEAIRSTGGILTSEDLVGYAPLIRMPISLDINKKRFITSGSP-TSGPALLHMLNILAGY---TQFPAHKTYDPVLEHRLVEAMKFGFAERTYLGDPSYLDQDLVTARLIDPAYAKETREKIDDGKTFPPDYYGGNYGVSEAPGTTHITVVDRSGNAASITSTVNIAWGSRIITPS-GILLNNQMDDFSTPNTTNHYGLRDSPANYIAPGKRPLSSSVPLVVLDRDNRFRFVLGGSGGSRILSGALNVVLNHIVRGLNLMDAIMMPRLHHQLYPNEVEAEYNYPKSIMSHMHKMGHEYRAKNDTVSVIQAISRVTGTLTAVSDPRKEGLPDGY 686
144 0.000e+00UniRef50_A0A2M7GQ20 Gamma-glutamyltransferase n=1 Tax=Rhodobacterales bacterium CG15_BIG_FIL_POST_REV_8_21_14_020_59_13 TaxID=1974086 RepID=A0A2M7GQ2  ali  28  39...........MVAAANPHAVQAGLEALRDGGSAIDAAIAIQTTLSLVEPQSSGIGGGAFMVYYDVATGETTVYDGRERAPAATTPQHWLDENGAWTSGRAVGVPGVIAMLAQAHEDHGNRDWAENFSFAENLAEDGFEISPRLYSLILRAAQDVETTPAMRNYFFDTGTVLPAGHVLTNPDYAGSLRLIADDWRN-FYEGPLAQDIVDAVAVGPGEMTLEDLAGYRASVRAPLCREYRGWNICSAPPPSSGGVTVNQIMGMLEPFDMAATGPDTAEG----WRRFIEASRLAYADRRFIADPEYSAVP--VEALLANDYIATRSALIERDTALNVPAGEPDV-----PGTSHFVVVDAEGNVVSMTSSVEFLFGSNRMAG--GFFLNNQLTDFTF----NPLNADGSPANAPAAGKRPRSSMSPVIVFDTDGDFVLATGSPGGTSIIAYVSKTLVGMLDWGLTPQTAIELPNVVAR--GNVVRVEDSFPADIAGALRAMGFTLDANRTENSGLHIIQREDGTLIGGADPRREGMV... 559
145 0.000e+00UniRef50_A0A098ETG0 Gamma-glutamyltransferase n=9 Tax=Bacillales TaxID=1385 RepID=A0A098ETG0_9BACI  ali  27  1...........MVATAHPLATEIGAKILEEGGNAIDAAVAIQFALNVGEPMMTGIGGSGFMMVYHKDSGDIKIFDGHSEAPAGAHPDMFLDENGEVTHATAVGIPGILKAMDAALKEYGSKPLADLIEPAAQACEEGIPLNWVILNSLDDFGYRLGD--EARNFFFAEGDKFEEGQLLKKPHLAKTFRILQKEGVDAFYEGEIAEAIVNTLQGLGGFMTMDDLKNYRHTVDEPIRGTYKGYEIASASPPTAGGQSLLYILKLLENFDLASYGPKSWEK----YYLFVEIMRLAFSDKAYIADPKFNDIP--LKGLGDERYLAERLKYINFERNPDIDFGNPWKYQEERSETTHFTVTDRWGNIAACTSTVEHPFGSGIMVPGYGFLLNNELTDF---------DAVPGGVNEPEPGKRPVSCKCPT-VLFKDGKPVLTLGSPGGPTIIASVFQTIVNIVDFGMDLKDAIEEPRIFS-TPGMLLSWEQGIDPLAKGKLESMNFEFGDDPHIIGNVQAIQFETGEMYGAADSSREGTAIG. 532
146 0.000e+00UniRef50_A0A2E9ZAH7 Gamma-glutamyltransferase n=1 Tax=Coxiellaceae bacterium TaxID=2026727 RepID=A0A2E9ZAH7_9COXI  ali  26  34..SHVTHGLHGVVSAQEQRASQVGIQILQVGGNAVDAAVASAFALMVTLPRAGSLGGGGFAMLALQADQQPRFIDFREIAPGRASPAMMLDSDLIRRSWLSVGVPGNVAGLCYLENHFGKLSLARVMRPAITMAQEGFVVKPYLANTLHHYRPMLIQNKATQKMLSHDGREYQFGDIMRRPDLARSLQLIAEQGSDVFYKGQLAEALVASSDQGGGILCLEDLAHYQVIERRPIQGVVGHALIYAAPPPSSGGIALIQTLKILQLLNIGANG--TLQNTALSFHTMAEVFNRVFLDRNYIADPNFVNIPTG--ELLSPAYLHKLAKNLNAHQHVQSKYLEKKPGFTEGKNTTHLSVVDHNGSMVALTYSINDSYGSGITVPGTGILLNNTMLDFTKPPVKGEVSAVLGIRNVIEPYKRPLSSMTPIIVFNRSKVPWLASGSPGGPKIITTVSQLLINLMLYNMPLSEAVQAPRIHTQLFPDVLLVESGISPDTIHLLSKMGHDVQLSRS-MGSLQSVMHTPDGLVGFSDTRRAGA.... 572
147 0.000e+00UniRef50_F0V6A9 Gamma glutamyltranspeptidase (Fragment) n=7 Tax=root TaxID=1 RepID=F0V6A9_9HELI  ali  28  1......................................VAVGYALAVVHPAAGNIGGGGFAVIHLA-NGENITLDFREKAPLKATRDMYLDNNASTLGYLAAGVPGTVKGMSAMLDKYGTKPLGELMQPAIDLAENGFVITDRQAETMLEVKDDLAKFASTRKYFLKDGSLYQGGDTLVQKDLAKTLRLIQKEGESAFYKGKIADLIVTDMQNNGGIISKEDLAQYNVVWRKPVTGTYRGYEIISMSPPSSGGTHIIQILNTMENTDIGKLGFGSSKTIA----LMTEAMRQAYADRSFMADPDFFSVPT--DKLLAKEYAKKIYANILKAKAVPSKNIKPGGAIKVGQHTTHYSVADKWGNAVSVTYTINASYGAIAAVEGAGFILNNEMDDFSIPGVANLYGLVGGEANAIVPGKRPLSSMSPTIIL-KDGKLFMVVGSPGGARIITTVLQVISNVIDHKMDIAKAVESP................................................................... 436
148 0.000e+00UniRef50_A0A2V9K057 Gamma-glutamyltransferase n=2 Tax=Acidobacteria bacterium TaxID=1978231 RepID=A0A2V9K057_9BACT  ali  24  15..RSPVLGRNGMIASSQPLATAAGLRILQQGGNAVDAALAAAAVLNVVEPMMTGIGGDAFALVYWSKTRQLHGFNGSGRAPYRMTLDYLKKKGMPESGPDTVTVPGAVDAWIALLEKFGTLRLEQILAPAIEYAESGFPVSEIIANQWSTTVPLLQRDPWAARTYLYSGRAPQHGDVVRNPNLAATLRKIAREGRDGFYRGAVAAKIVEAVRAAGGVLELRDLEDHASEWVKPISVPYKGYEFC-ELPPNGQGLTALLMLNIVEGMDLRSWGHNS----AAYLHHLVEAKKLAFADRNYIADPAFARVP--LDRLLAKSYAAERRKRIDPERAG--ADYPAGDF--EPGDTVYLTVVDREHNAVSFINSLSFMFGSGIVAGDTGICLQNRAANFT---------LDERSPNRPEPHKRPLHTIIPAMVM-KDGQPFFSFGVMGGDNQPQAHVQVLLNLLEFGMNAQEVGEAPRFRHTR--GRLGLESGIGPEVRRALDLMGHQVVTMTDEYGGYQGIVIDPGVLMGGSDPRKD...... 528
149 0.000e+00UniRef50_UPI00084A5333 gamma-glutamyltranspeptidase 1-like n=1 Tax=Hyalella azteca TaxID=294128 RepID=UPI00084A5333  ali  44  114........................RDILAAGGTVGDAAIAALLCVGVVKPQSMGLGGGFMLTHYNPTTGQALTLDARERAPLAAHQDMYHDAQLSFVGALAVAVPGEVRGYRALYEAGGALEWAELFVPALRLCEEGHPVSWHLAKALQQKREYILAEPSMS-IFVDNGDVLLEGDMLYRPDLAATLRVLQQE-PDALYTGSLARGFVEDLAQLGGIITTQDMEEYQVTWSEAMTVALNSNATLITGPPPGSGVLLGFMLNVLDGYGLDPNDVQDVSSSVLTHQRITETFKYAYALRTQLGDPQYVDVQDLLSNLTSEAYAEYIRLQVLDNSTQDPEYYGGQTYIPRDHGTAHISILGPNGDAIAVTSTINSYFGA-VMMATTGIIYNNEMDDFSSPNITNDFGLPPSPANFIVPGKRPMSSMCPAIVTDGAGMVRMVAGAAGGTKITTSTALTIIHHLWLGSSIEEAVEGRRIHHQLYPMVLNYEEGFDAAVVEGLAGIGHVTEEMP............................... 603
150 0.000e+00UniRef50_A0A2E3SU03 Gamma-glutamyltransferase n=4 Tax=Alphaproteobacteria TaxID=28211 RepID=A0A2E3SU03_9RICK  ali  26  35.......STRYMISSSHPLATQAGEKILKRNGNAIDAAITTQMVLNVVEPQSSGIGGGGFLLYYDKKNKHIEVYDGREVAPKKAQQDLFLNHSEAILGGKSVGVPGLLAMLNLAHKDHSTFSLKELFQPAIDLAKNGFPVSSRLSEQITNDK-LLRKTETSKRFFYKDNSAKKTEEIIYNKNFSETLEYISVEGVEGFYHGKKIIQKIHKSKINPGEMELSDLKNYKAKKRNVICKQYRVWKVCGMPPPSSGGIAILQALGILENFDM----HNYKGQTDKIIHLLSETLRLIFEDRNYIGDPDFVKVP--MENLLNPFYLKERSQLIKLDKTFPMSFEDSEMASNEKDSTSHISIIDQEGNAVAFTSSIESAFGSRLMVE--GFLLNNQLTDFSFIPNKNGIKV----ANKVEPNKRPMSSMSPTLVF-KNNSLFLILGSPGGQNIISYVLKTLIYIIDFDMKIVKAIDAPNFAIRNQEMFIE-ENRLDDLTIRRLEDLGHDI-VYKKMKSGLNVIKIKNGKIYGEADSRRQGLALG. 572
151 0.000e+00UniRef50_A0A2M8HIE8 Gamma-glutamyltransferase n=1 Tax=Leptospira sp. TaxID=178 RepID=A0A2M8HIE8_9LEPT  ali  26  74..SSYASGNTFAIATDHALASEAGKIVFQKGGNVFDAYVAASFAISVLRPQSTGLAGGGFALVKSAKSGSIEAYDFRERAPQLASENMYLDENQSLFGYKAVGVPGNVKGLLSIHKRYGYLSLEQVLEPALRLANEGFSVYEDLHIAIDKSKEEM--NDAARSIFLRNGNALKTGSVLVQKDLGNTIQKIILNGEKEFYELETANSIVRSMQLNKGLISLKDLKDYKVIERKPLKITYKQYEIISFPPPSS-GVFLFEILKFLEHQNIQSLFTDDP---TAYYRLLIEAMKQGYEDRSHGGDPDFSFVP--VEALLSRDYLADRTIEVLRKSRADVKSSGEIPKTLESYNTTHISVMDSMGNAVSSTHSVNYIFGSRIVIPGTGLIMNDTMDDFATSGSSNAYGLVGGSKNLIEANKTPLSSMSPTFI-QENGQMLIAIGAPGGSFIPTAILQTILNRLEFAMSPYEAVASPRVHHQNQPNFVFAEQNLSNK-LKALEEFGYKFKFTENR-AKVFMVERENGHLHAVSDPRGQGTPSAY 608
152 0.000e+00UniRef50_UPI0009DD8DA9 gamma-glutamyltransferase n=1 Tax=Asaia platycodi TaxID=610243 RepID=UPI0009DD8DA9  ali  29  326...KPVEGTRGMVVSAQHLASEAGRQILAA--------------LAVVYPAAGNIGGGGFMTLRLP-DGKTTFIDFRERAPGAATPTMYVDPKASIEGWRAVGVPGTVAGLEEIHHRWGKLSRAKVMAPAIVLAEKGFVLGRGDADLLHTSTEAFQKDAHARDIFLRDGTPLQAGDRLVQKALAKTLRSIAQSGASEFYKGAIAHQVVAASEKSGGILTLADFAAYHPREFAPIHCSYRGYDIDTAPPPSGGGVALCEMLDILSGYDMKALGLRS----VAGVQRQVEAMRHAYSDRRDLGDPDFVKNP--VAHLIDPAYAAEIRKGIPLDHALNSDALVAGAALPEKHETTQFSVADRSGFAISATYTLNGWFGAGVIGGDTGFFLNDEMDDFSKPGSANMFGIVGSEANAIAAGKTPLSSMAPTII-SHEGKPFMVIGSPGGSRIPTIVLSVVLGVIDGGLDIQQAVDLPRIHEQWKPVAIELEPRLSPDVMEALQLEGYTLSPHRPW-GVAEGILFVTGKLYGGWDRRHEG..... 875
153 0.000e+00UniRef50_D2UE31 Putative gamma-glutamyltranspeptidase protein n=195 Tax=Bacteria TaxID=2 RepID=D2UE31_XANAP  ali  31  40...........AIASGHRLATEAGLQILREGGNAFDAAVAVSSTLSVVEPISSGLGGGGFFLLHDARTGQDTMLDAREVAPESATPDTFLDAKGAVNGPWSAGIPGLPAALVELATRHGRLPLRQSLAPAIRIARDGFPVYARMAEGYQARRKVMERYPGTREVYLRHGRPIAEGDLFKQPELAVTLQLLADKGFDGFYRGVTARKLLAGVKQAGGRWTADELAGYTVKQRTPIRFDYKGWTITTAPPPSSGGIALASMLQILEAYDLKAMDP------VHRIHLTVEAMRRAYRDRTFLGDPDFTVVPQRI--LLSKDYAVGLRSTINPDKATPSDLLSGQPTPLEDDETTHFSIIDREGNRVGATQTVNLLYGSGLIPKGTGVLLNDEMDDFALPGTPNVFGVMGYAANAPKPGKRPLSSMTPTFMENADK--AIVLGTPGGSRIITMVLLGILGY-DDGLDPQQVAALKRYHHQWLPDVIEAETGFDAATVQGLKAMGHPLKLPGDSWGNLQTVEWDKDELGAASDPRKVGSA... 575
154 0.000e+00UniRef50_G7E2N5 Uncharacterized protein n=2 Tax=Basidiomycota TaxID=5204 RepID=G7E2N5_MIXOS  ali  36  91RNPAYVRGRHGAVAAESGICSDVGVDVLKENGTATDAAIAATLCIGVVDMFSSGIGGGGFLVIRPPDDRSAISIDFRETAPEAAHPRMFADNALSKFGGLAIGTPGELRGLQAAYQAYGGVSWRRLFEPSIEIADKGWPATDALINRLKLFGAWMLDAPEWAEIFAPAGDFLRPGELIRRPALARTLRTVADKGADAFYKGAIAHSIVETTRAAGGILTKADLANYKAVVEQAARGTYRN-RTIYTTQLPSSGPILISLLNTLEPLDLLEQG-----RTVKNIHIFLEALKFSFAHRTHFGDPAFHAQPAYLAKLMTKQFGRETLANIT-GGTHSVSYYNPLFDVKTDHGTMHLSVVDAHGSAVSLTSTVNLPFGSRVMDRETGVILNDEMDDFATPGVPDYFGLEPSPFNYPEAGKRPLSSTSAVLMDDADGKFLLALGGSGGSRIYSAVAQVILN-LDWGQDLSAAIQEPRVHDQLLPTYVSVEGSYSPGILAGLAQRGHRVELFDINIGAVQAVQKLGGWFYAASDSRKWGRAAAY 639
155 0.000e+00UniRef50_A0A1F2TTN8 Gamma-glutamyltransferase n=3 Tax=Bacteria TaxID=2 RepID=A0A1F2TTN8_9BACT  ali  30  25.....VPSKEGLVVCTSAPACDAGASVLARGGNAVDAAVATAFALAVTHPSAGNIGGGGFMMIRTA-TGEITGIDYREKAPLRSSRTMYLDPSLTNTGYLAPGVPGTVRGLELAHKRYGKLRWREVVEPAVQLAEQGFTMSAGLARGLNGQAGRMGKFPASVAAYGPGGGTWAEGDRLVLPDLAKTLRAIGSEGADVFYKGWIADRIADDMKANGGLITREDLAAYQAKIRTPVRGTFHDYDIYAMAPPSSGGVALIEMLNILEPYGLKAKGPLSP----AAMHLEIEAMRRAYLDRAHLGDPDFVTVP--VAKLTSRDHAKTVAATIDPAKASSSVELGVTAPPAEPDETTHFSVMDRGGMVVANTYTLEGGYGSHVVVKGAGFLLNNEMGDFNKPGETNLRGDIGTPANLIDPGKRMLSSMTPTIVVKK-GKVALVTGSPGGRTIINTVLTVVLGVTEFGLTGREAVDLPRMHHQWLPDHVTIEKGATSDILAKLKALGHD-ARGGGGQGDAETIWIPDGTPYGVNDKRSDSKAA.. 563
156 0.000e+00UniRef50_M8CFN1 Gamma-glutamyltranspeptidase 1 n=1 Tax=Aegilops tauschii TaxID=37682 RepID=M8CFN1_AEGTA  ali  39  85...............DDGRCSEVGAAALRAGGHAVDAAVAAALCLGVVHPMSSGLGGGAFIVVRDAASGDAVAFDARETAPAAATPIMYAADPTSKFGALAMGVPGELAGLHAAWSRYGRLPWKSLFAPAIALARDGYTIVSYVANALKDEEVDVLADPGLRAVFAPGGRLLRDGELCRNPALADVLEALAEDGIAAFYGGAVGERLVEDVRRAGGILTVEDLKGYKVGVSKAMEADAMGFTFLGMPPPSSGTVGLALVLNVLGGYKSTEF-----LRGFLGVHRLIEAVKHMLAVRMDLGDPGFVNVAGNVSEMMSPEFADKIRRRIADNTTFPPAYYLAKWSQLRDNGTSHLCVVDGDRNAVAMTTTVNYYFGAHVLSPSTGIVLNNEMDDFSVPSSPTPDQLPPAPANFIAPGKRPLSSMTPAIIL-KDRQLAGVVGASGGTNIITAVTQVFLNHFVVGMSPLAAVQSPRVYHKLVPNVVRYEDEFSTEAMEFLRRRGHVLESTSPG-AVCQLIVQD................... 593
157 0.000e+00UniRef50_A0A0L0C967 Uncharacterized protein n=2 Tax=Lucilia cuprina TaxID=7375 RepID=A0A0L0C967_LUCCU  ali  34  872.....HVYENAAVCSDKNVCSNIGSVILQHKGNAIDSAIATLLCNGLVTMQSMGLGGGVIMTYYKRQEKKAISIIGRERAPLNINIENLKSKNASTFSVFSIAVPGEVAAYYEAHHQYGSLPWSYLIQPTLELCYQGYQLTRHQRDALFLNEEMIRKDKLLAQMFVKTNLFYKEGYHISIPEVCATYKLLLEEGPLTFYNGSLSSLIVKDLNEMGSWITLDDLKSFKAVTQESITLDLEPYY-VYLPQAPASGHVVGYIMQILQKFKSRLYSVK--DFGSLDVHRIVEALKFGFVKRWHY---DTEMDQETLANLFHPDSIENVTRLIDDLKTFNPKHYGSNLTPTPDYGTAQISILAPNGDAVSATSSINYYFGSGRMGLRSGILFNNAISDFTIENFENYFNLPNIENNQLKAQKQPMSSMVPLIVTHKEGDVRLVVGAAGGSRIISTLVQILIRVLWKHQNIKHAIDEPRFHHQLVPNILEYEYGVFQQVIEDLEAKGHQTERIRRKCTAVCGVEVDEGVVMANADYRKEGGVDGF 1411
158 0.000e+00UniRef50_A0A1W5CW67 Gamma-glutamyltransferase n=1 Tax=Umbilicaria pustulata TaxID=136370 RepID=A0A1W5CW67_9LECA  ali  34  46..........GAVASENSICSRIGIELLKAGGNAADAHVGTAFCVGVIGPHHSGIGGGGFMLVRSP-NGTYESVDFRETAPTAAFENMYKDNNGSLFGGLASGVPGDIRGLEYLHTRYGILPWKTVLQPAIDLARHGFSIQEELLSAMASGIDFLTNDHAWALDFAPNGTRLGLGDIMTRKRYAITLETIAGKGADVFYTGPMAEAMVSALRSANGTMTLADLQNYTVTSSPPLQIDYRGYH-VYSCGAPASGAIVLSTLKTVEGYE----DVGRGDTLNLSTHRLDEAIRFGYGQRASLGDPAFVDITTYEAEIINSTTAAINRGKISDKHTLNVSDYDPGFESPETHGTSHIVTADASGLAITYTTTINLFFGSTLIVPETGIIMNNEMNDFSIPKTRNEWGYIPSPSNYIRPHARPLTSITPTIVEHPNHTLYLILGASGGSRIITATIQNLWHVLDRNMSLPDALAQPRLHDQLIPNEVEVEDGGPDN............................................... 529
159 0.000e+00UniRef50_F9ZI64 Gamma-glutamyltransferase n=12 Tax=Proteobacteria TaxID=1224 RepID=F9ZI64_9PROT  ali  28  40...KSANYSKAMVVTANPHASRAAVKILRQGGSAVDAAIAAQLVLGLVEPQSSGIGGGAFMLHWQARSGELIVWDGRETAPASVSETHYINTDGAVIGGHSVGVPGVLAMLEASHKEHGKLPWADLFTPAIILAEQGFAISERLHILLSRM-PKVAVNPQIREYFFNTGQPKTVGSQLQNPAYAQTLRRLAALGVTDFYQGELAKQIVQAVNNRPGRLSLSDMKAYQPKKRDALCGQFRIYRICGVPPPSSGGTTILAILGLLEAYEIRYGEHADWH------HGFIEASKLAFADRAYVGDPAFVSVPTL--GMIDQDYLHQRAKLIRNHSVSNVNAGLPPGASPEFPSTTHLSIVDTEGNVVSMTSSIETAFGSRIMVG--GFLLNNQLTDFSFMPRAADGVLL---ANRVQSGKRPRSSMSPTIVF-KDDRALLVIGSPGGTRIINYVAGSLYRILVKQLPVAEAIADGHIIAMGYG--VELESGADESTLIRLRERGHNI-VLRDQTSGLHVIRIDEKVLEGGADPRREGEISGF 582
160 0.000e+00UniRef50_W4XEQ0 Uncharacterized protein n=3 Tax=Strongylocentrotus purpuratus TaxID=7668 RepID=W4XEQ0_STRPU  ali  38  1......................................................IGGGFFMTIYERESGMTRVIDARERAPFAANETMFVEPELSLAGALSIATPGELHGYKQAHDLYGVLPWNQLFQPAILIAEEGYLIDNTMAADIVYNEDYIRADEGLSSLFVDDGNLKAEGDLVMNPLLAATLRRLANEGVDIFYTGDIAQTLVEETQNIGGILTLADMSSYDALVKEPLQVNVFGDLTAFTAPPPSSGVVAQMIMNIMDEYSYAAEDVSTMEGETLLYHRFIEATKFAFAKRAQLGDTEYEPVQDLIGNMTSDDVASLIRQTINDVRVTNVTQYDTPFANTFDEGTSHLSVIAPNGGAVAMTSTVNNGFGSKFMSPTTGVVLNNQMDSFSTPGLRNSDGIAPSSPNFIKPGKRPMSSMSPTILLAENGDVRLALGASGSSRMITSISLVSLRTQRFDEDLRDVINQRRLHHQLSPNYIQYEEGFSEEILSRLENKGHE-TCLQTRYAVVQAILRREGSLYAFSDPRKGGIAAGF 489
161 0.000e+00UniRef50_Q4BU94 Gamma-glutamyltranspeptidase (Fragment) n=2 Tax=Bacteria TaxID=2 RepID=Q4BU94_CROWT  ali  28  36...HPVISKNGMVASQEDLATQSGLEVLKEGGNAIDAAVTIGFTLAVTLPRAGNLGGGGFMLIHLADQQKTVALDYREKAPLAANSDMFLDENGEVFSHQAVGVPGTVAGLAMALEKYGTISLERALQPAIKLAEDGMIVDEDLYNSLVFAKRNLQKSPASLAIFYKDGSPYQIGENFKQPDLANSLKLIANQGIKAFHQGEIADKIVRDMEANNGLITKEDLAKYKPIIREPIEGKYRGYKVYSMPPPSSGGVHLVQMLNILEKFPIQSLGHNT----SSTLHLMVETMKFAYADRKFMGDTDFVDVP--IKRLISKKYADQIGEKIDLEKVIPSQNIKPVFQSNESTETTHYSIMDRYGNAVANTYTLNFSYGSGLTVPGTGILLNNQMDDFTAKGVSNAYQLIGGQNNSISPEKRMLGSMTPTIVL-KEGKLW....................................................................................................... 472
162 0.000e+00UniRef50_B9L2C9 Gamma-glutamyltransferase n=6 Tax=Bacteria TaxID=2 RepID=B9L2C9_THERP  ali  29  9.DRQEALGTRGMVAAKHEIAAEVGASVLEDGGNAIDAAVATAFAVGVVEPFMSGIGGGGLMLVHSAATGDTIALDFGMCAPLAAHPDLYVEGDANVHGPLAIAVPGTVAGLAAAAERWGTRPLAELLQPAIRLAREGFPVSWHTSLEMAQDAELLARYPSTRAIFTRNGLPLPVGTMLRQPDLARSLEAIARRGAETFYRGELGKTLIEGLRSLGAILTEEDLARYRVRIAAPLWGRYRACRVATA-PAPSGGPTLLESLHIMDCFDLRASGHNT----DRTLHILIEAFRQAFVDRTYLADPDFVPVP--VDALTDPSYARERAQEIGEDARTRIEPGQPSRLGIEQGSTTHICVVDRWGNAVTLTQTLLSAWGSRIVAPGTGILMNNGMFWF---------DPEPGRANSIAPGKRPLANMTPTLVFTG-GQFLLALGAMGGRRIINAIAQIISNVVDHRMGIQAAISAPRVDCSVQPTAVS--SRIPEAVIARLRERGHTLQVVREDFADVVGILRDDGMLHGGANP......... 556
163 0.000e+00UniRef50_A0A1I7RTS7 Uncharacterized protein n=2 Tax=Tylenchida TaxID=6300 RepID=A0A1I7RTS7_BURXY  ali  35  93.....ASFTKAAIVSDNAICSEIGRSILLRGGNAVDVAIAVGICIGGLHPHSSGLGGGFLMTYYDKEAGKCRTLDARETAPLATNQNSFHDNPKAFLGPKSIATPGELHGFWSAFKRFGRIPWSDLLMPTVKLLNNGYPATKLMELNLQAKEADILAEPSMKPHFTNTGKLYKEGDIIKNPTLAETLRRLATDPVRTFYKGEMGDLVAFEIKKLGGHVTKKDLEQYKSKIDEPITTTPFGDETICGPKPSSSSAVTQLILSIMARFYPIGSKKETVFNDVEYYHRFIEAQKFAYAQRTKLGDPDYVEANGALQNMTSKEFIDQIVEKIS-EKTLKVNEYGSSEEQLDDKGTSQISVIDADGNAVSLTSSVNNIFGSLVRSERLGIVWNDQMDDFSLPGSKNFFGFTPAKANYIEPGKRPLSSMSPIIIYNSKTKGG--------SKIISAVAQVILQKLAFNQTVKEAVDFPRIHNQFTPIRTAYEKGVPQILLDELARLGHNFTEMVTPFSTVQAIFRTNGRLQTTSDFRRP...... 631
164 0.000e+00UniRef50_UPI000B77490A gamma-glutamyltranspeptidase 1 isoform X1 n=3 Tax=Aedes aegypti TaxID=7159 RepID=UPI000B77490A  ali  42  73........TGAAVTSNGVECAEIGTNILRLNGSAVDAAIAVLFCEGVTCPQSAGIGGGFFATIYDRSTGTVQTLDARETAPAAATKNMFVNNGAAVEGGLAVAVPGEIKGYWVMHQKYGKLDWKTLIQPTINLCREGHLVSGYLDRIIKPRQAKILSIPSLREILINTNQTWREGDRIKRLALADSLEIIANEGADALYNGTLLPKLMRDLKLFGSILTEEDFYNYEPRWLPAATTKLKNGNQIYSMPLPGSGHVLNYMLNIIDGYD--QLDKNDP----LTWHRIVEAFKHGYGLRTKLGDPPFVPVEELLRKLTNENYAAFIRDGIFDNMTFNYEHYGAEFANEVDSGTAHISVLAPNGDAVAATSTINY....................................................................................................................................................................... 437
165 0.000e+00UniRef50_A0A0K3CRJ7 BY PROTMAP:  ali  35  152RNPSYVSGWNGAVASEEERCSRMGVDVLRENGTAVDAAITTALCIGVVNSFSSGIGGGGFMVIRPPSSTRHISVDFRETAPLASHPDMFTANRASKVGGLAVGVPGELRGFQAAYEACGGVSWERIFRPVAQLARE-FRVGKELHRRLNARWEWIKDEEDWRAMFMRGNEFLQEGDIVRREAYARTLEKLGKGGADVFYEGEIADRIVETVRKDGGILSKDDMRSYKAIVRRAEEGTYRG-RKYYTGSYPSGGPIIRMLFNVLDGY----ADFVDAGRTGLAEHRFIEAMKFAFAARTNVGDPPFIDNAAKLAEIPTRKYADAVRGNITDSRTHKLSYYHPRFDIKEDHGTTHLSVIDQWGGAVALTTTVNLIFGSRLMDEETGIILNDEMDDFATPGLPDAFGLRPSPFNYPVGGKRPLSSTAPLIMDHANDDVYLSLGGSGGSRIFGAVAQTLLN-LDWGHDLSSAVEAPRVHHQLLPAYVSIESTFRPDLVKELKARGHDVTLFDINLGIVQAVMRDDGRFFAASDSRKNGVPAAF 729
166 0.000e+00UniRef50_M1V6A5 Gamma-glutamyltransferase n=1 Tax=Cyanidioschyzon merolae (strain 10D) TaxID=280699 RepID=M1V6A5_CYAM1  ali  37  141........RYGAVAADNPVCSKLGLQVLSEGGNAVDAAVTSALCQGVLSPFASGIGGGCFALVRL-QNGSTDFIDARETAPMNLTHQLLRGPESTRHGGLSIAVPGELRGLELMHALYGKLSWRDVVLPVIPLARN-ATVGTMLAYRLAQNAPTILKSPTLCEVFCPSGRVLAENETLVQTALAELLTQIALHGADYLYNHS-ASTLAKEIQEAGGLMTAEDISGYQPKRRQPLQSFYRGFEILGSSLPSSGGPAIAMALNILEGYNMPSRGH-----SNESLQLVTEALKYAFASRSQLGDPDFVPEAAVSDYMVNKAAAARLRETLDTLQTHPADYYHSTIGGVDDHGTTHLSVLDAQGNAVALTSTINTEFGSMIRSRSTGIVFNNEIDDFSVAGHPNAFDISPSEPNFPVPGKRPLSSMSPTIVV-RNGRTVLVVGGSGGPRIISSTLQVLINVLDFADGLVEAISMPRVHHQLLPNVLWMESGIWTQMCQYMRRVGHEIEIAPEMVGCVQAVVRQDGIMYAASDPRKRGQAAA. 720
167 0.000e+00UniRef50_A0A1X2J1B2 Gamma-glutamyltransferase n=9 Tax=Mucorales TaxID=4827 RepID=A0A1X2J1B2_9FUNG  ali  37  55...HLVSGTHGAVAVETQECSDVGVEILRQGGNAVDSAIASALCIGVMSNFATVLGG--FMLIRSP-NGEYEFIDYRETAPQGSDKDMYRDDPLAQRGGLAIGVPGEIRGFELAHKRHGVLPWAKLFSPAIKIAREGFTANDYLYEKLMRAESWLLEDDEFSKIYAPTGTLAKPGDIIKRPTLANTLEIIAQEGPDAFYTGHIAESIIETVQAAGGIMTLDDLRGYEPIIRPTISTYYHGKKI-TTCTAPTSGPILLSILNILEQYPLHALG-----RIGVNVHRLVESMKFGFAFRTEFGDPEFTHLEDRYQEITTKQWADKARANISDTETHSPLYYQPKYDHIDAHGTMHLTVVDENDGVVTLTSTVNLLFGSRVMDPVTGIILNDEMDDFSIPGIPNDFGLYPAVYNYVEPGKRPLSSITPTIVES-DGNFDLALGGSGGSQIITATLNV..................................................................................... 503
168 0.000e+00UniRef50_I1BUA1 Gamma-glutamyltransferase n=5 Tax=Mucorales TaxID=4827 RepID=I1BUA1_RHIO9  ali  40  52.KPHLIVGSQGAAAVELKECSEAGVEILRNGGNAVDSAIASALCIGVVNSFATG----GFMLIRSP-NGTFEFIDFRETAPNGSHKDMFIDPMAAQRGGMAVAVPGEIRGFELAHKRHGKVPWQDLFHSAIRIAEEGFEVTELLYSKLLKSKLWIEASPAFAAVYAPTGVIAQPGDIIKRPSLGQTLRKIAKEGADVFYEGVIAEAIVNATQAAGGILTLDDMRNYQALIRPTVSTSYHGKKVV-TCSAPTSGPILLHVLNLIEPYDFHKTGP-----TALNIHRLIESLKFGYAFRTELGDPDFVHNEGRLEEIISKEWADHVRRNISDDKTHSPLYYGPKYQTKDPHGTMHLSIVDKEDGAVSLTSTVNLMFGAKFMDPVTGIIMNDEMDDFSIPGIPNNFGLYPSIYNNAAPGKRPLSTITPTIIESEDNAIELAVGGSGGSQILTATLNV..................................................................................... 494
169 0.000e+00UniRef50_A0A1H0F9I3 Gamma-glutamyltranspeptidase / glutathione hydrolase n=2 Tax=Proteobacteria TaxID=1224 RepID=A0A1H0F9I3_9GAMM  ali  28  62.......................GYQVLKAGGNAIDAAIAVQMVLGLVEPQSSGLGGGAFLLYFDGSD--VRAYDGRETAPKAVDAELFLEDGEPLESGRSVGVPGTVRLLEKAHMAHGRLPWEALFRPAITLAEDGFEVSQRLHSSLANDQA-LRDNPLARAFYYDEGQPVEVGETLKNPALAAVLKRIAEEGSRAFYQGDIAQDIVNSVRQHPGELALDDLETYEAIAREPICTPWQQWEVCGFPPPSSGHLTIMQILGMLDQQPLLEAPLDDGVTSSGWLHQFLEASRLAFADRNYIADPDYVEAPGDWTTMLAPSYLAKRSALIGKQSLSDVEHGEPGAPTQPEYGTSHISIVDAEGHSVAMTTSIEQAFGSRIMVDGGGFLLNNQLTDFAFEPEQNGDPV----ANRVEPGKRPRSSMSPTLIFDQEGELVGSLGSPGGAAIIHYTARTLMALRDWGMNAQTALNLP--HAVTLGDEVWLEEGFPDAALDDLRERGHNVSE-RELTSGLQAIMREDGSLFGGADPRREGVVMG. 595
170 0.000e+00UniRef50_A0A2D9C852 Gamma-glutamyltransferase n=2 Tax=Bacteria TaxID=2 RepID=A0A2D9C852_9BACT  ali  34  37......IYAQGAVAADHAIASEAGARMLAMGGNAVDAAVAASFTLSVVRPYSCGIGGGGFMVIHLPDDPKHTAVNYREQA--YVDADYYERTGKSTIGGAAVAIPGSVAGLLHALETYGTLDRKTVLTPAIEAAYEGFVVDEHYMIMSGSLMEKFQAHPEFKQHFLRQGQV-QLGDRITNSLQAKALERIARDGVDGFYRGPVGDAIVRAITEAGGEMTSEQLAGYTLDEREPLVREVEGRSMIAMPPPSSGGVTMLQALMILEA---SNYDFANPIMDADRAHLLVEALKHAFADRSYLADPDFVDVP--IDDLLDESIIQERAQLITDG-VHPPSYYGTPNLVPNDAGTSHVSVVDPYGGAVAMTETINLSFGSLVGVDAYGFVLNNEMDDFTTRGQPNAFGLMQSDRNLPEPGKRPLSSMSPTIVLDDNGEVFAVAGASGGPRIITGTMQALLNTMA-GMDATPAVATPRLHHQWLPDVLYSEPGLMPLLSRR-AARGNEVKLRRD-VGNVQLIRRDPDGWQAASDPRKGGIPAG. 574
171 0.000e+00UniRef50_A0A1G7W776 Gamma-glutamyltranspeptidase / glutathione hydrolase n=1 Tax=Duganella sp. OV458 TaxID=1855290 RepID=A0A1G7W776_9BURK  ali  28  23.KTPVATGTGGAVATISEPASKAAIAILNQGGNAIDAAVAAAATLGVTDPFSCGIGGGGFMVIYLAKDKRVITIDHRETAPASFTPGVFLKDGKELDSGRSVGVPGTVRGWHEALDRYGSMSLRQVLAPAIGVASQGFKVNDNFSHLVRENESKFARFPATAALYLKDGKAIAAGSTLRNPDLAKAYRELAAGGVKIFYTGKMARAVVDAVNRNGGAITLADLSNYEARLRQPVHSTYRGYDLYGMPLPSSGGIAVAQALNILEGYDLKAMPRARAE------HLYLEASRLAFADRAYLADPEYVEAP--VAGLLSKEYAARRRELINPDQASVHAPAGDPYPIAEGAHTTHLTVSDKDGNIVSYTYTIESWGGSGIVVPGYGFLLNNEMTDFDFSGPA---------PNVPEAGKRPRSSMSPTIAF-KDGKPAFSIGSPGGATIITTVLQTIFNHIDLGMSMPDALNAPRL-SERNGMATDVEPGFPSAQARALEKTGQHWSKQPEEIGAANALVFNDGTVTAVSEGQRHGV.... 562
172 0.000e+00UniRef50_A0A2E7W327 Gamma-glutamyltransferase n=3 Tax=Alphaproteobacteria TaxID=28211 RepID=A0A2E7W327_9PROT  ali  26  45.......ASNFMVSAANPIAVNEGYKILESGGNAIDAAITTQLVLNLVEPQSSGIGGGAFILYWDNEQKQLYAYDGRETAPNAATSELFTYPDGAMIGGKSVGVPGLISVMDLSHKNHGELPWHKLFSPAVNIAKNGFAISPRLFTLLKQSPSFSKAKVPAQYYYTANGLPKPIGYILKNPKLAVTYQKIAKDGVQGFYTGKIATAIINEIKQNPSNMTMDDLLNYRAKLREPVCASYRVYKICGMPAPTSGSTAVIQIMKLLERFDLPNMAPWS----SSIIHVFIEATRLAYADRSYMADPDFVSVPQLP--LISSTYLSERSKLIDLSKRMKSVAGSPRGFSFELPSTSHIVTIDGKGNAVSMTSSIESAFGSHLMVE--GFLLNNQLTDFSIAPNAN----DTNIANRVQPGKRPRSSMAPIMVFDKNDNLVVALGSAGGISIIPFVAKTLISILDWKMNAQAAISLPNIV--IFRDTVILEKNTPIKHKNSLESLGHKI-VTARFPSGTHAVNIKNGLLWGGADPRREGIVMG. 582
173 0.000e+00UniRef50_A0A2E4WK73 Gamma-glutamyltransferase n=1 Tax=Candidatus Marinimicrobia bacterium TaxID=2026760 RepID=A0A2E4WK73_9BACT  ali  27  67ENIEEAIGSNGVVSSVHPLASDIGINILKVGGNAIDAAIATGLALGVVDQSNCGLGGGAFIVMRLA-DGTVHTIDGREMAPEKADRNMYIQNGISKTGPLAVAVPGVPAAYVKALELAGTLTIKELAQPAINLAKTGFILDQAYLDRYKGAINELRKDSASAAIYFHNNSELAVGDVFKQPLLAETYEKFAERGVAYFYKGDFADRLESFMVQNGGLITKKDMENYQAIERPPIIGNYKDYQIYGMGPPSSGGVHVVQILNMIEASGVLQNKNKWDEESMYFVSQF---MNRAFQDRAHLGDGDFYPVP--VNRLISKSYAEILVDEIT-SKAVLAPPIEGFSLNYGQGHTTNFAVVDKWGNAVSINHTVNLTYGAKITVPGTGVILNCEMDDFSVPGVPNAFGLIGAEANAIEPGKRPLSSMSPTIIV-KDDKPILVLGGAGGPRIITAVLHTIIGVLDFNLTIGKALSLPRFHHQYRPDALFIESHISNSHRSAMVKKGYTV-INRNGLGTVRAVSWNEKTYVGAADPRRNGEAKAY 608
174 0.000e+00UniRef50_A0A2E8X4V2 Gamma-glutamyltransferase n=11 Tax=Terrabacteria group TaxID=1783272 RepID=A0A2E8X4V2_9CHLR  ali  24  16..RSAVVAKNGAVATSQPLAAQVGLQILQKGGNAVDAAVATAAALNVLEPMSTGIGGDMFALIWMADTKKVTAINGSGHSAAGANPEDVISKGYSSIPGLAVSVPGTVDGWHKCLKRHGTMTLKEVLEPAISYAENGYAVTDVIAYQWGESEAKXKQRPSGSEMLLNN-KAPRQGDFIKLENLGKSLKTIAEDGPEGFYKGDIAXKISNYVQSQGGWLTEEDLAKHSSDWDEPICTNYRD-VTVWECPPNGSGXAALMAMNIAEGFDIASMGPQSADR----YHYLIESLKLGYADAQYVADPRVTDVP--IKGLLSKSYASGRREKISPDRATDVSYGKPVPNA----DTVYLTVADKDGNACSFINSLYSGFGTGLVVPETGIALQNRGSLFS---------LDSSHPNFLRGNKRPYQTIIPAMAT-KNDEMWLSFGVMGGFQQPQGHLQVISNMVDFNMNSQQALDALRFSVDIETGAVRVEEDIDPKVVSELTRRGHEIKVVSGYFGGAQTVSRDPGVLTAGSEPRKDGAAVGY 545
175 0.000e+00UniRef50_A0A0L8FZH4 Uncharacterized protein n=1 Tax=Octopus bimaculoides TaxID=37653 RepID=A0A0L8FZH4_OCTBM  ali  35  97.........HGGCSTATPHCSAICIDTLKKGGNAVDASIAATFCLGVVNPHHSGIGGGGFMLVHNHKTMENTAFDFRETAPRAANPSLYENPKLSIKGPYSVAVPGEIKGMEAAHKAFGQLSWSDLVMPAVKLARHGFVASESFVKNMEMVQD---GNAEFLASFFPNGKIPSVGEIIYRKDLANALETIANEGADAFYNGSLSEEIVKATKK---FISLEDLREYSVIKRDTVSTTYGDHAVLSIAPP-SGGVVLLSILNILNGYHFGPADQYS----AKTYFKLIEAFKHAYAQRGSLGDPEFEKIMNSTNYFLSHEAAKTIREKINMNYTSDYSRYLPSSVFREDKGTAHVSVIDNDELMVSVTTTINTWFGSHLLTKS-GILLNNEMDDFSTSKHLNFFDIPPSQVNDIKPGKRPQSSVAPAIVLSAPCDLRLTIGGTNGSKIPSGIAEVLINILSFKMDLQTATTVPRLHNQLFTNMTEYETNFNATIVKALSRMGQNMVKQKKPINIVQFVAKNYSDITAISDHRKG...... 618
176 0.000e+00UniRef50_B0XE47 Gamma-glutamyltranspeptidase precursor n=57 Tax=Culicoidea TaxID=41827 RepID=B0XE47_CULQU  ali  38  49.........QGAVASNAYECAPVGAGILREGGSAADAAIAMMICEEVACPESAGTGGGFLATIYDREKGTVEVLDAREVAANGAREDMFVGNGAAVHGGLAIATPGALKGYWVMHQRYGKLPWKRLIEPSIDLCYRGHIVNPYMADAMQEIREEILNTTSLREIFVDTGDIFKEGDIIKRPDFARTLEMIAVEGADALYNGSLLPILLKDLKAFGSIITEEDFLSYEPRWLPPVSTVLRNGNAVYSAALPGGGTILMHMLNVLDGYD--DLNPSDP----LTWHRVIETFKHAYGVRTRLGDPPFVPIEEMIRNLTSKDYADYIRAKIDDNRTTSYEFYGADFANPEDLGTAHVSALAPNGDAVAATGTINDYFGAQLRSPSTGIIPNGEMDDFSTPGVINIYGVPASPANFIAPKKRPLSSMSPAIVIDGAGDVRLIAGGAGGTRITTATLQLILRHAFFGEDLRAAMGGPRVHHQLAPMWIEYEAAVDPTIVEQLKARGHAVKKVRR-VATETAVAREDGRVSAAFDPRRPGSA... 576
177 0.000e+00UniRef50_A0A2S5BCG3 Putative Gamma-glutamyltransferase n=1 Tax=Rhodotorula taiwanensis TaxID=741276 RepID=A0A2S5BCG3_9BASI  ali  38  199RNPSYVTGWNGAVASEEQRCSEIGIDILRENGTAVDAAIGTALCVGVVNSFSSGIGGGGFMVIRPPSHSRHISIDFRETAPSLAYPDMFTKNRASKVGGLSIGVPGELRGFEAAYQACGGVTWERIFRPAAELARE-FKVGKELHRRLNARWEWIKDDDAFSEVFMRGGKFLQEGDTVRREAYAWTLEKLGREGASAFYDGEIADAIVRAARATGGILTHDDMKAYRAVVRPAEVATYRG-RRYYTGSYPSGGPILQHLLNVLDGYKTYAED----GKTGLGVHRFVEALKFAFAARTNVGDPPFIKNGAKLAEIPTRKYADAVRANITDDRTHKLAYYNPQFDIDEDHGTTHLSVIDQWGGAVSLTTTVNLIFGSRVMDTKTGIILNDEMDDFSTPGLPDAFGLRPSPFNYPEGGKRPLSSTSPLIMDHADHEVYLALGGSGGSRIFGAVAQTLLN-LDWGYDLANAVEQPRVHHQLLPAYVSIESTFRPDLVEALKLRGHNTTLFDINLGIVQACMRDDGRFFATSDSRKNGIPAAF 782
178 0.000e+00UniRef50_A0A2V2S9F4 Gamma-glutamyltransferase n=2 Tax=Bacteria TaxID=2 RepID=A0A2V2S9F4_9BACT  ali  32  34..SQSVRSRTGMVVSGSEVASRVGADVLREGGNAVDAAVATAFALAVTLPSAGNIGGGGFLLYRS-TNGQAGAYDFREMAPAAASQTMFMDPGLHHDSYLSVGVPGTVAGLYLAWSEQGSISWARLVEPAIKLARDGFKVTDGLAHSLE--QELLKETTNQAAIFTKAGRLYTAADTLKQPVLAATLGRIAKEGPAGFYEGATARAIDQEMRANGGLITLQDLKNYKARVTNIVRGTYRGYEILSMPPPSSGGVGLIEMLNILEGYDLAAMGWGS----ATNIHRIVEAMKRAYADRAYLGDPPFTNMPP--SRLVSKEYAASLRQTIRDDSSSPSA--LDFSWPNESHNTTHLSIVDEARNAVALTYTLEDSYGVKVAVPGAGFLLNNELGDFAAPDLTTTNGLIGTPPNLAAPFKRPLSSMTPTIVL-KDGRLFMVTGSPGGRTIIGTVLHTILNVVDFGMNAQEAVDAGRFYHEWFPDEIAYERALSPDTLRILRQMGHHHFRKIRGPGVAEVIVFNHNVSEAGVD-RRDGGVA.. 578
179 0.000e+00UniRef50_A0A1X2HR61 Gamma-glutamyltransferase n=1 Tax=Syncephalastrum racemosum TaxID=13706 RepID=A0A1X2HR61_SYNRA  ali  38  21...HLVTGSRAAVAVEVDVCSGTGVDVLKQGGNAVDAAIASALCIGVIDNFATGTGG--FMLIRSP-NGTFEFIDFRETAPAAAHRDMYNDPDLAKYGGLAVGVPGEIRGFQLAHERHGKLPWATLFEPAIRIARDGFLTTPLLEERIKASLPWILESPEWVEVYAPNGTLAKAGDLIRRPTLANTLETIAIEGPDTFYTGRIAEHLVNTTRAAGGILTMDDMRSYEALIRPTVSTYYHG-RKVTTCSAPTSGPMLISVLNILEQFNLRVEGLVGVN-----LHRLIESLKYGFAFRTEMGDPEFTKNQERLDQLITKTWADRVRRNISDSTTHDPLYYQPKFDHVDSHGTMHLSVVDEDDGAVALTSTVNLLFGAHIMDAATGVILNDEMDDFSIPGKPNAFGLYPSAYNYVAPKKRPLSSITPTIV-ERNGVFEMALGASGGSMIPTATLTV..................................................................................... 462
180 0.000e+00UniRef50_A0A2D5UCX8 Gamma-glutamyltransferase n=1 Tax=Nitrospinae bacterium TaxID=2026769 RepID=A0A2D5UCX8_9BACT  ali  25  25..RSPVLAREGVVATSQPLAATAGLQVLRVGGNAVDAAIATAAALNVVEPQSTGIGGDMFLIYWDNNEKRLVGLNGSGRAPQGATLERYRSEGLPGEGIFAVTVPGAFDGWCSALDRFGKKSLTELLAPAIHYAESGFPLTPIIANAWRLQEKKLSSFEGSKRTYLPGGRAPRVGEIFRNPNLAATFRLLGDGGREAFYHGPVAEAIVRASGELGGLFEMEDFDGARCTWVEPVRTGYRGYELC-QIPPNGQGLAALICLNILEGYPLSEFSFGSAEH----FHYLIEAMKLSFADRNYIADMEHAEVP--LEGLLSKTYGEERRRLISGDSAADPAPGAPHG----SSDTIYLTVADRDGNMCSFINSLFHHFGSGVTAGDTGVMLQSRGFGFS---------LEEGHLNCIAPGKRPLHTIIPGFVM-RDGEPWMSYGVMGGDMQPQGLVQMLSNMVDFGMNVQEAIEAPRFRV-LGGLEVAVEHGVPDEVLDDLTRRGHDVARSGGYFGGAQGIVRLPGVYMAGSDHRRDGCATGY 548
181 0.000e+00UniRef50_A0A0K2TDZ4 Gammaglutamyltranspeptidase 1like [Megachile rotundata] n=3 Tax=Lepeophtheirus salmonis TaxID=72036 RepID=A0A0K2TDZ4_LEPSM  ali  38  126....NAIYSNGAISIDGPRCAKIGYDVIKRNGSVVDAAIAALFCNGIVCPHSMGIGGGFGMIYYRKSDGKAFSLNAREWAPEWSNYTMFNNPNASTFGPLSMAVPGEIMGYWEMKKTLGSVTWESIIQPSIDMARNGIQVSKHLAKTLKEMRDYIFMSQGLKEIFVDTNDILQEGDVYKREKFADTLEKISENPMD-FYKGQMAEAISREIKMEGGIITTQDMNSYKVEWMDPVGFEFQDGLKVHSISPPFGGANLIYILNILDHYPKDELSIFYSEEPALWYHRLTEAFKWAYGVRSRLGDPNASSVEQLIKEITSPEYGQEAFKLINDSFTNNASFYGGDFVSREDHGTSQLSIIGPNGDAISVTSTINTHFGSKVVGQETGIIYNNEMDDFSSPNITNYFGLKPSPNNFIRPKKRPVSSMSPSIFVDHNGSVVLSIGAAGGSRITTATAYTSLLNLWLDKSIDISIDMRRIHHQLLPMELHYEKGFDGEILDELKSRRHVVVEDNPDYSVVQAVARTSDKYHAFSDTRKDGEVYG. 670
182 0.000e+00UniRef50_A0A2D7WCC3 Gamma-glutamyltransferase n=3 Tax=Cellvibrionales TaxID=1706369 RepID=A0A2D7WCC3_9GAMM  ali  29  70...KSARYQTAMAVTANPHASDAAKWVLQKGGSAVDAAIAAQLVLGLVEPQSSGIGGGAFMLHWQAQRGVLESWDGRETAPATANDTYFLQADGAVIGGRSVGVPGVLAMLESAHRAHGKLPWATLFEPAIRLAEQGFAVSERLHILLERM-PKVAVNPYIQRYFFDGGQPKPVGHVLKNPAYAATLGRIQKHGSEDFYRGKLAQAIVDAVRNDPGELTLQDMANYRAIKRDALCASFREYSVCGAPPPSSGATTVLAILGMLDAYE-QRMGL-----RADWQHGFIEASRLAFADRNYVGDPDFVEVPS--QAMVDSDYLRQRATLIDNAAVLDVKPGNPAAAPPELPSTTHFSIVDRWGNVVSMTSSIETAFGSRVMVG--GFLLNNQLTDFSFSPLSNNGALV---ANRVAAGKRPRSSMAPTIVF-KNQQPVLALGSPGGARIIDYVAASLYRILALNMPVGEAIAEGHIIAMGRG--VEMESGADPATVARMRGRGHPVT-LRDQTSGLHVIHITEQGLLGGADPRREGSIAGF 611
183 0.000e+00UniRef50_A7RJD1 Predicted protein (Fragment) n=1 Tax=Nematostella vectensis TaxID=45351 RepID=A7RJD1_NEMVE  ali  44  45.........HAAVSSDVKECSDIGLDLMKRGGSAVDASIGALLCVGLMNPESCGIGGGGFMLI-VPPRKKGEVIDFRETAPGKASEGMHKGNELAATGGLAVAVPGELRGYEIAHKKYGKLKWAELFAPTIKLARDGFQVSAH------------------------TGMYLQVGDMIRNKELADTLEIIAREGPDAFYTGDIAQSIVKTVRSNDGVITLDDLKNYKALEKDGLNSTYEGYQI-TTIPLPGSGPVLFSALNILEQFQFSKVD----KGKNETYQYIVEALKFAYAQRTHLGDPADAHMQNVTNAMLSKKLAAKLRKKIFANQTFPPSYYGPFFDAAESHGTAHLSVVGPDGELVSVTSTINGYFGSYLMTD-TGIILNNEMDDFSSPGITNQFGIKPAKANYIRPGKRPLSSMVPVVVRHKQ-DPRLALGGSGGTRITTAVLQTLINILSFGNSLSEAVERPRVHHQFSPDVVEAE..................................................... 496
184 0.000e+00UniRef50_B8L936 Gamma-glutamyltransferase n=593 Tax=root TaxID=1 RepID=B8L936_9GAMM  ali  27  35.TRSEVIAPHAMAATSQPLATQIALDVMKGGGSAVDAAIAANAALGLMEPTGNGIGGDLFAIVWDPKTQKLYGYNGSGRSPKSLTLAEFQRKDIPATGPLPVSVPGAVDGWFALHDRFGRKPMADNLAPAIRYARAGHPVAEVIAYYWDRSVPKLSQYPGFKEQFTINGQAPRKGEMWKNPNLASTLQKIADGGRDAFYKGDIARTIGDYFKANGGYLSYQDMADHHGEWVEPVSSNYRGYD-VWELPPNSQGIAALQILNVLEGYDFSKIPFGSPEH----VHLFVEAKKLAFADRAFYADMAFQPAP--VQKLISKEYAAQRRALISMDKALEVQPGTPK--QLEEGDTIYMTVADADGMMVSLIQSNYRGMGSGMAPPGLGFILQDRG---------EMFVLQKNHPNGYAPGKRPFQTIIPAFIT-KGGKPYASFGVMGGAMQPQGHAQIVMNLVDFGMNLQEAGDAPRIQHEGSGGEVNLETGFPYETVRALMRKGHRIVFADGPYGGYQAIMRDPGVYYGASESRKDGQAAGY 572
185 0.000e+00UniRef50_A0A0J7KXJ8 Gamma-glutamyltranspeptidase 1 n=1 Tax=Lasius niger TaxID=67767 RepID=A0A0J7KXJ8_LASNI  ali  40  1.................................................MQSLGFGGGFMMTIYQRSTRRAFVLNARDRAPLAANSTMYNDKNASFRGALAVSVPGELAGYWEAHQRFGKLPWADLFKPSIELCEKGYTLTLAQYDGLVYNKISIYNDPTLRRIFCRTNEFRKVGSVIKPRAFCETLRIIAEKNATEFYNGTIGRFLVDDLREQGGIITMKDLNEYRVLWDQPIQTNLSGGIKLFTTGLPGSGAVLSFILNVLDDYGFTPASMVDFNATILTYHRMIETFKYAYALRTDLGDGAFVDMTEITRNLTSGSFARAIRKRISDEKTQDPRHYGSSYAGAEDHGTAHVSVLGQNGDAVSVTSTINYYFGSGIVSRRTGIVLNNAMDDFGIPSKMSYFGIPPSPNNYIAPKKQPLSSMVPSVLVDRYGDVKMVVGAAGGTRITTAVSQVTAKILWMKQTVKEAVDSARIHHQLYPPKITYEYGVPKQVIDGLKRLGHATKRYKERGSVVCVIMYENSTIFANADYRKGGDVYG. 506
186 0.000e+00UniRef50_UPI0004279021 gamma-glutamyltransferase n=1 Tax=Psychromonas sp. SP041 TaxID=1365007 RepID=UPI0004279021  ali  28  50EERTAVIANDYMAVTNNPLATDAAYDVLKNGGNAIDAAIAAQMVLTLVEPQSSGIGGGGFMLYYDADTKNIVHFDGRETAPSAATGDMFYVDGVAVLGGKSTGVPGTLKMLKKAHDEYGTKVWSDLFTPAISLAEEGFEVSERLEASIEDNASDFYVDPDANSYFCLTDEPLPAGYLLKNQPLADTFKDVAND-VELFYTGTYATNIVTKLSQNPGILTTDDIANYEAVKNEPVCSVYRGYTVCGTPPPSSGGITVAQILGILENHDMSQWDLNGGQPTANGIHWFSEAARLAYADRGYIADTDFVALPGSWESMIDPTYLTERFSLIDAQSSMTAEAGKPAGASPNLPSTTHMSIVDKEGNVVSMTSSIETGFGSHQMVD--GYLLNNQLTDFSTEYQSADGTLI---ANRVEGGKRPRSSMAPTIVLDADGQFFMATGSPGGSTIITYVAKTLVGVLDWGLDAQQATSLVNFGSTNGSTFIEEERLTDEATISELEAMNHTVDVTSRVSGIAT-IVSDNDVFVGGADPRREGVAKG. 623
187 0.000e+00UniRef50_A0A1Q5TFL8 Gamma-glutamyltranspeptidase 3 n=1 Tax=Penicillium subrubescens TaxID=1316194 RepID=A0A1Q5TFL8_9EURO  ali  33  32....TAQGMNGAVSCENSICSQAGASMLRRGGNAADAIVATVLCVGVTGLYNSGISGGGFALVRLP-NNTYEMVDFREKAPGYASETMFVDKNASQVGGKASGVPGQLRGLEYIRKRYGKLDWKTLIAPAIEVADTGFLFGHDMEWMVNWTLNLFTQDPAWKPDFAPNGTLLKRGDIMTRKRYAGALRNISDNGAEDFYTGSTARTMLRAIRHYGGNMTERDLMNYTVVQREPKQVQYRNY-TLTSTVAPSSGTVLLNILGVLDNYD---DFFTNTSTTNRSTHRMVEAIKFGYAYRNSFGDPGFVNVTNLETTMLSQARIQRIYRNIDDNSVHNVSFYDPDKWTPESFGTSHMVTSDKDGLVFSLTTTTNLPFGSHVMVPETGIVLNSQMDDFSTPNTTNGFGYPPTPNNFIKPGKRPLSSISPIIAVRDDGSFAFATGAAGGSHIPTTTLQTLIHALDENLSPSDALARPRLHDQLFPNYVEIPDTYNNATVDYLVSLGHEIKRVDEW-SYAQAISQSPGLFVAAAEPR........ 568
188 0.000e+00UniRef50_A0A2M8NYY3 Gamma-glutamyltransferase n=4 Tax=cellular organisms TaxID=131567 RepID=A0A2M8NYY3_9CHLR  ali  25  12..RSMVVARRGMVSSSSPLASQAGVSVLRQGGNAADAAIAAAAVLNVVEPASTGIGGDCFALYYDARTRTISALNGSGRAPAALTLEVVRRAEMPPHSPHAVTVPGAVRGWEDLLKRHGRMTLRDVLSDAIHYAREGFPVAPVFGTAWQGYGAWLAARPHTQD-YLPNGAPPQIGQIVRLSGMAHTLEQIAEGGADAFYQGEPAHAIVAALSAQGGVMTLADLAAHRSTWETPIHTDYRS-VTIYECPPNGQGLAALIALNILEGFDLGGLAWDSPER----LHLMIEAMRLAFADRHYIADPAFSAAP--VSALLSKAYAAQRRALIGAQAMQPPSFGAP----LSSSDTVYLCAVDGEGNACSFINSLYMGFGSGIVAGEAGFFLQNRGAGFS---------LDPEHPNALQPNKRPYHTIIPAMAL-RNGELWAAFGVMGGFMQPQGHVQVLSAMLDDDLNPQEALDRPRFCDGTAESIVALEEGIPVATMSALAELGHPVRPVSGRFGSGDIIRRDPGVLFGGCDPRKDGMVAAY 540
189 0.000e+00UniRef50_UPI000D3ED285 gamma-glutamyltransferase n=1 Tax=Polynucleobacter rarus TaxID=556055 RepID=UPI000D3ED285  ali  26  49.DKKIVSSKSMMVVTANAYASEAAYGILKNGGNAVDAAIAASIMLTLTEPNATGIGGGGFLVHYDANNQQIKTYDGRETAPALANPERFLLASGAITSGKSVGTPGILKMLEQVHQAHGKLSWKKVLEPTIRQALKGFVVSDRLHILIDKD-PYLKKNPEARKYFYDEGQALQVGTLLKNPVLAKVLSEIAEHGSRAFYEGWIAKDIVQAVQDRPGDLSEQDLLAYQSKERGVLCNSYRSFNICGMPPPSSGTLAILQMLGILESFPMSDYPVNTWQ----AVHLFSEAGRLAFADRDYITDPDFV-VPP-IHGMLDANYLNKRRETISLKKALPVAEYYPDSYS-EPAGTSHISVIDSLGNAVSLTNTIESQFGSRIMVD--GFLLNNQLTDFSLVPAVDGKKVV----NRVEANKRPRSSMAPLLVFNQKGDLIMNLGSAGGSGIINYVAKTLVAYIDWQMNIQEAISLPNFGSRNRETELEQSGNWSP-MIKDLKDRGHLIRYFDSP-SGLQGITRGSNVLFGGADPRREGVVLG. 609
190 0.000e+00UniRef50_A0A2H0Q3K1 Gamma-glutamyltransferase n=3 Tax=Bdellovibrionales TaxID=213481 RepID=A0A2H0Q3K1_9PROT  ali  28  31REGHEASGQKWAIATQGDAASQAGARMFALGGNAVDAAAAISFTISVERPQSTGIGGGGFLLLHGPSLEAPIAFDFREKAPLKSNSKMYLDKGKSLDGIFAVGVPGLVAGVIEVHRRYGLLDLAEVLKPSIELARKGFSIYPELARAIKARSDVLSTYKDSKKIFLHDGSPKIEGEVLVQEDLAKTLEVIAKKGHDGFYKGEVAQKIIQEHQRHGGLMTQKDLDIYNVKMRKPVYGSYNEFDIYSMSPPSSGGIHVIQILNTVEKDHLKTFGPQD----YRSVHLISSAMQQAFADRTHLGDADFVKVPT--EQLTSKHYAGKVRVKIPNDKALKQSEVQAGFDFTEHDETTHFSVMDNEGLVVSSTQTINGWFGSGVVAQGTGIVLNNEMDDFSTKGAMNLFGAVGSNQNLVEPQKRPLSSMSPTIVL-KYGKPFMALGTPSGTRILTCVAQTLLNRLEFDLPLWESVSALRYHQQWAPDQLRFEEEIPSRLKEKLESMGHKI-VQKDLGCKIQAIEKDGQSIHAVADPRGEGRALA. 571
191 0.000e+00UniRef50_UPI000C77B13D glutathione hydrolase 2-like isoform X1 n=3 Tax=Eurytemora affinis TaxID=88015 RepID=UPI000C77B13D  ali  34  124.EPSESIFEYGAVSVDSIPCAKIGKDVMLRGGNSIDSAVATMYCNSVINSQSMGLGGGFIMTIYLA-NGTSLALIARETAPAAATKDMFEGNNLSHYGPLASGVPGFILGTWELKQRLGSITWESLLQPSVDLCFNGIEVNFHAYHMMHQERERIYADPGLSAVFVNTGKIWNEGDVYTYKSLGETIQSIAKEGPGVFYNGHIGENMVKDVQAAGGILTVKDLQSYRVQWEETVSYKLKNGFTLISSPPPGSGVITNSILAIMDLYKPSPMD----KHRPLLWHRFIEACKFSFAKRTEMGDPIRDEVKQIVKDLSSHHHTMKIKEKINDFQTQDPEFYGAKTTFEEDHGTCHHCFLSPQGDAISVTASVNLIWGCKFMSPSTGIIMNNQMDDFASPNITSAYNVPPAPNNFIYPGKRPMSSMSTTIVVDDQGRVVAVAGASGGTKIISATAQVLMNVLYLGKDVKEAVDARRLHHQLFPMNLNYEDGTTTWIIDALKGYGHNMTYSKYRVGGVQAIVVDPGSITANADFRKRGAVDGF 674
192 0.000e+00UniRef50_UPI00083F63EB gamma-glutamyltransferase n=1 Tax=Gammaproteobacteria bacterium 2W06 TaxID=1838287 RepID=UPI00083F63EB  ali  31  34..........GMVVAAHPLATDAGVEILEAGGTAIDAAIAVQAVLTLVEPQSSGIGGGAFMLHYDGATTDVQAYDGRETAPAAIESDHFLTEAGAPMGGQSVGVPGTLRMLELAHAEHGELPWGSLFQPAIRLAEAGFEVTPRLAGMLRIDLP-LAEFEPMAGYFFRDGAPVSAGMTLTNPALAETLTAIADRGADVFYEGAIADAIVTTVQAHGGKLTRQDMADYRAVERPPVCRSVAGHSVCGMPLPSSGGMTVLQILRLLE---IAGAENNDSTRLAWT-HLLLEASRLGFADRNYLGDTDFVEVP--VETLLSERYLTGRAGLISPTQSMGKARPGLSDPDPINHSTSHFSVLDAAGNAVSMTSSVEMPFGSRLMVG--GFVLNNQLTDFRFDPAAADGRP---HPNRVQPGKRPLSSMSPMIALDRDDQPRLIIGSPGGTRIIGYVAQRVADVLMRGREIKPAIETGNLVNRN--GATQVEAGTAQALAPDLEALGHEVEV-ETMTSGLHGIERPDGVIRGAADPRREGTV... 561
193 0.000e+00UniRef50_A0A182PV45 Uncharacterized protein n=1 Tax=Anopheles epiroticus TaxID=199890 RepID=A0A182PV45_9DIPT  ali  40  323...........ALASNVPECANVGMAMLDQGGSAVDAAIATLFCEGVSQPHAMGIGGGFVMTIYSKQSGLVECLNAREVAPAAATSKMFVDREESVEGGLAIAVPGEVKGYWEVHQRYGKLPWKVLVQPAIEICQQGLLVTEQLEQNWAIQKKSILKYRAIADVFINTNDTWKRGDLIRQAALGESLRVIAVEGADALYKGTLLPKLLQDLRDVGSIITEDDFYNYRPDWVKPAEVNLRNNYTVYSTPLPASGEILNFILSILDGYE------DLDEHDPLTWHRIVESFKHGYGKRSKAGDPRFLDQSDLFNKLTSKESIANVRKLILKNMTNDSVYYGATSGRPEDHGTAHISVLAGNGDAVAVTSSINYLFGSLILSPSTGIILNDQMDDFSTPGKVNTYGLLPSPSNYIVAGKRPLSSMSPTIILDHQGDVRMVVGAAGGSRITTATAQLILRHLFFGQSLCEAMDAPRLHHHW----VKVE..................................................... 794
194 0.000e+00UniRef50_A0A2D7LZL1 Gamma-glutamyltransferase n=4 Tax=Bacteria TaxID=2 RepID=A0A2D7LZL1_9BACT  ali  27  13.........KGMVAAAEGEAARVGRDLLNAGGNAIDAAVGVGFALAVTYPAAGNLGGGGFLVARENSKRTSVALDFRERAPFAATETMYSDADASLTGHLAAGVPGSVDGLLQALQAWGSLPREQVIAPAIRLARDGFVMTDRTHRMLNSTRERMQLYRASSELFYPEGSAFPAGTIFRQPELANTLELIAKKGRAGFYEGEVADHLLTEMKRGGGIIRPRDLEEYRSIERDPVKFKTKTGYAITMPPPSSGGICLAQIQRLMRDFSIKTSEVGSPRH----LHLMAECMRRSFADRNYLGDPDFID--CQMDLLLSESHLEKMARSIDPLKATSSKSISDESLPKESEQTTHYSVVDRHGNGVAVTTTLNGSFGSKVLVPGAGFLLNNEMDDFSRPGVPNLFGLVQGKPNGISPGKRPLSSMSPTVCLSEGGEVLSVLGTPGGPTIITNVFQVLYALDHLELSPELAVTMPKMHHQCLPDRLDLEKGTPDSTQAVLKDMNHRI-ATRGSIGDFQLISRMRDSWVGISDPRGAGA.... 550
195 0.000e+00UniRef50_A0A1V5G2G8 Gamma-glutamyltranspeptidase n=7 Tax=Proteobacteria TaxID=1224 RepID=A0A1V5G2G8_9PROT  ali  30  31...........AIATSNAQATDAGMEVLAAGGNAFDAAVAVSAMLGLVEPESSGIGGGGFFLLHLASENRVVFVDARERAPLASSADMFLDKDGSIDGPLAAAIPGLPAGLVHVSRKYGRLPLARSLAPAIRLAREGWTFSRKNAEMMAWRVQALSNDPGSAGVFLPGGQVPKVGQKMFNPDYARTLELLAAHGEKGFYAGRYASQLVAGVRAGGGIWSETDLANYQVVEREPLRIQHRGFEIITAPPPSSGGIALAEVLNILDGYRYTDLQPF------QRTHLTIESMRRAYRDRAYLGDPDFVEVP--VAMLMSADYAAGLRASIHPHRATPSDLLPGVGESIERDDTTHFSLLDTDGNLVAVTQTVNLPYGNAFVVPGTGFLLNNEMDDFSITGVPNAFGLVGQDANAIAPGKRPLSSMSPSFVISDER--VGILGTPGGSRIISMVLLGILHLMDGG-GAQSTADLPRIHHQYLPDVVSIEEGLSVEAQADLRERGYQLETGRDTWGNMQVVVWNTGAVEAGADGR........ 550
196 0.000e+00UniRef50_C3XV37 Uncharacterized protein n=1 Tax=Branchiostoma floridae TaxID=7739 RepID=C3XV37_BRAFL  ali  48  1....................................................MGIGGGFFMTVYNKETNTADIINARETAPAGASENMYASA-SSTTGGLAVAVPGEIRGYWEAHQRYGKLPWRDLFLPAIQLAEEGFCIGKAMAIAIERTKDLIQSDSHMCDVFCDNNNVLGENQIMKWPKLAETLRAVADGGADAFYTGDIARNLAKDIQDANGIITEQDLRDYEAEMTSPLNITLDGGMTVLSPPPPSSGAVLSLILNILDGYRLNSSSVDGTDNQILTYHRIVEAFKFAYAKRTELGDPNFLQIDELVRNMTSSDFADSLRLRIDDGMTHNYTYYGPSFALSPDGGTAHLSVLGPNGDAVSVTSTINLYFGAKLLSPSTGVLLNDEMDDFSSPNLTNTFGLPPSPANFIRPGKRPLSSMSPAIVLDSNNDVRLVVGAAGGTKITTATA--------YKQ-----ITRPKISTNI---QIYIETTFFQAVLDGLRQKGH--VTYEAGSAIVQAVAQVGSAITAACDSIKGGFPSGF 473
197 0.000e+00UniRef50_Q3BS26 Gamma-glutamyltranspeptidase n=437 Tax=root TaxID=1 RepID=Q3BS26_XANC5  ali  31  47..........AAIASGHALATDAGLQILREGGNAFDAAVAVSSTLAVVEPISSGLGGGGFFLLHDAKTGKDVMLDARETAPASATEAQFLDKKGSVNGPWSAGIPGLPAALVELAAKHGRLPLKQSLAPSIRIATEGFPVYARMAKGYASRREVMERYPGTREVYLRGGKPIAEGDTFKQPELAQTLQLLGDKGFDGFYKGETAKKLLAGVKQAGGQWSAAELAGYRVKERAPIQFDYRGWKITTAPPPSSGGIALAAMLQILEGWDLNTLD------EVHRTHLVVESMRRAYRDRTFLGDPDFVDVPQRV--LTSKDYAQGLRATINPDKATPSDLLSGNPTPLEDDETTHFSIIDGEGNRVGATQTVNLLYGSGLIPKGTGVLLNNEMDDFAKPGTPNAFGVMGYAANAPKPGKRMLSSMTPTFMESADK--AIVLGTPGGSRIITMVLLGILGY-DAGLDAQAVSALPRYHHQWLPDVIDAETNFSAQTAKGLQAMGHALKLSSHVWGNLQTVEWDKNVLSGGSDPR........ 577
198 0.000e+00UniRef50_A0A2A6BRC6 Uncharacterized protein n=9 Tax=Chromadorea TaxID=119089 RepID=A0A2A6BRC6_PRIPA  ali  35  138.......FRRASIATDHGLCSEVGRDVMMQGGNAVEATIASLLCIGVVNPQSSGLGGGFLMTLFNKTTGRCITIDARETAPAAATQDMYVEHPDASYGYRSIAVPSELHGFYTAFTRFGKVAWRRLVEPAMNLASRGFPVSNNLADVLKRKEKHIMIDEHMTKEFVNTGRVYEEGDMMRREALAKTLELIGNDPIGLFYRHGMAQSITAEFHRNGAHVTAHDLADYRTQIEEPLVVDLPGGLSMCGPPPPSSFVVLQAIVRTMARF-YNGTGPKNLDD-PLVYHRLIETMKFAYAQRAKLGDTRYVSAAELVSKMITPNFITSIVNKIKD-HALPMEDYDVPMSMPEDHGTSHVSAIDEEGNAVSCTSTVNQLLGSMKISPTLGIIWNDEMDDFSTPGQANLFGFAPSETNFIAPGKRPMSSMSPVIIYSKDGEVKMVSGAAGGSFIISSVAQAIIHTLFFNQTVKESLDAPRFHHQYLPHKTDYEYTVPAEIIDALRTRQQNMTVVDKIASVVQSLQVDDGYIHGNSDWRR....... 672
199 0.000e+00UniRef50_UPI000A2A61FC gamma-glutamyltranspeptidase 1-like n=1 Tax=Exaiptasia pallida TaxID=1720309 RepID=UPI000A2A61FC  ali  39  63..PEPKKFEKAAVAADHKLCSEVGAKILKKGGHAVDAAVATGLCVGVLNPHSAGIGGGGFMIIYDRKSKTASAIDFREMAPKRLTEEMLEQNTMKPSEGLLVGVPGELRGFEKAWKKFGKLSWKELFEPAAKICKDGFKVHPALATAIAKNFVNISSSEGLREIFTKNGKMLKEGDLLKRPVYAKTLKMIGSASADIFYNGDFTEEIVKEINAEGGIFSVDDLKEYKSVDEKPLEANINGSKLLSVPPPAGGGAVMSQALEILSGFNFSKADME--NNPGLTYHRMIEAFKFAHASLTYLGDPKFVENSEVIKKMLDPKYSEELRRKI-DAKSHGIKYYGPNFVTPITSGTTHLSIIDKDGNGVSLTSSINKYFGSKIRSKKYGIIFNDQLAD-AMNHWVNEYGLIPD---SFKPHRKPLSLATPAMILDKNDDLQMVIGAAGGRYIPTTLAQVFMNYYWFGDSLKDAIAKPRLHSQLFPEMVLVEENFDGKIINEIKKYGHRYVTNDTIMGVVQVIVRKNGELLALADYRKGGIAAGF 620
200 0.000e+00UniRef50_A0A2W5CFC1 Gamma-glutamyltransferase (Fragment) n=1 Tax=Haemophilus parainfluenzae TaxID=729 RepID=A0A2W5CFC1_HAEPA  ali  30  2.....................................................................RVEAIDFREVAPQSASKETYLNDQKSIDTPFASGVPGTVKGLETAWQRGGHLPWASLLAPAIELADKGFIITRGLGDRIRESEGRLSLNKATWAIYAPKGRLLQAGDRFVQKDLARTLRLIATGGSNVFYQGEIADKIARSMAPYH-WMSKQDLANYRVVIRKPLIGTFKGYTVTVMPPPSSGGVHILQILNVLEHFPLEQWGQNS----AKTIHYMSEAMKWAYADRSYLGDPDYVKVP--VKGLTAKAYAATIAQKIG-EKSTPVSAIAPGVPQPESNETTHISIVDKEGNAVAMTYTLNDNFGNGFIVPGTGILMNNEMDDFSKPGEANLYGLIGAEANEVKGGKRPLSSMSPTFVF-KDKDLYLVTGTPGGARILTTVLQIIVDDLLFHLNPAEAIAAPRFHDQWLPDEIRVEKGLSPDTIHLLQEKGHTVRV-KAVMGKVGTIRVTHDILEGAADPRNDGAVVGY 476
201 0.000e+00UniRef50_A0A210Q1U8 Gamma-glutamyltranspeptidase 1 n=1 Tax=Mizuhopecten yessoensis TaxID=6573 RepID=A0A210Q1U8_MIZYE  ali  34  105......VGGNAGVAADVPLCSDMGRDILRDGGNAVDAMVTTMLCVGVVDAQSSGLGGGGFMLIHDHKSHVSSVIDFREMAPAMASPGMYPGKGQSLMGGLAVGVPGELKGMQTAHNKHGKLSWQNVVQPAANLARNGFKVTPSMAKVFTEGKVKESEFTGLGEIYLDENRFVKQGTLISRPQLANTLDIIAEHGADAFYDGQLSQSIIDAVSNAPGIMTREDLKNYDVVIREAVKTTYNGHTILST-PAPASGSVLLFIMNVLEGFKLTKADKNS----VQAFHRIVETLKFAFEKQQQLGDPDKDSVKNTTEMLASKAEAKKIRSLIS-NVTMD----ETGQFNKLDKGTSHISIIDAQELMVSVTTTVNMWFGSRVMT-STGILLNDQMADFFIPTPGSSQ--PSNQLNAIGPGKRPLSNMAPTMLLNEDRALRMVVGAANGSRIISGVVETLLNVVSFGENLTKAILEPRIHYDAISRDTEYEPGFKDSIVKGLTDLGHTMVATVEGINIVQAVSKVNNTLQAVSDPRKWGRAA.. 632
202 0.000e+00UniRef50_UPI000641015A gamma-glutamyltranspeptidase 1-like n=1 Tax=Hydra vulgaris TaxID=6087 RepID=UPI000641015A  ali  39  41......YYENGAVATDALKCSEIGRDVLIEGGHAVDAAIASLLCTGIVNLHSTGISGGGFMSVYNRKLKQSFVYNYREAAPGSLRADAFDKNTLKNVGGLAVGVPGELRGLHKAHQKFGKLNWKRLVTPSIELAEKGFSMGNHMYKNMIDTKKYLELDPGYREILINNGLWKKEGEIIVLKKLAETLRKVRDD-PDALYTGELSQGFINDVVAHNGNMTLSDLESYEVKEETPIEMKL-GNYTLYTTPLPGGGTVLLSILKILKGFNWTKEDFTTFDKKVLNYHRMVEAFKFSYATRPFLGDPDKNPSNKLIADILDDNHAEQKRLKINDSVTRENKFYSKFFTNTQDSGTTHVSVIDKEGNAVSATDTINYAFGAKFCSVTSGICFNNELADF-FIKSNVIENYPTTAANFPGPGKRPLSSTCPTIIVNNEGNVVMIVGGSGGTKITLSTAWVIMKVLWLGYSLEDAINDVRVYHTFSPSYIQSETTIPINLMEGLKKKGHKFKD-STRHSVIQGIYVKDGKIYAKSDPRKQGEAAGY 583
203 0.000e+00UniRef50_A0A2E7I7F9 Gamma-glutamyltransferase n=6 Tax=Alphaproteobacteria TaxID=28211 RepID=A0A2E7I7F9_9RHIZ  ali  26  24.......SSKGIIATSNPHASRAAKDIIDRGGNAIDASVAVQLVLTLTEPQATGIGGGAFMLYWDESKSKLYSVDGREKAPSKVNENLFLDSDGAVVGSQSVGVPGIIKLLEETHKKFGKLPWEELFEYAINLAENGFPVSPALNSILGYLKPLKKIEPAASYYFVENKKPVPVGHILKNIEYSKTLKRLSKYGSYDFYEGETSKLIIDALNNNNSKMSFEDLRNYQIVWREPLCRKYRSYNVCAMGPPSSGGLTMLMMLKIFENFDIRSMDPNSVE----MIHLFSEVNRIAYADRAYMGDSDFIDVP--VEGLLNESYLSEREKLITLNRSKTINHGNPPGAEESKPSTSHFVIVDKEGNAVSMTSTVEGPFGSHLMAG--GFILNNELTDFSMMPELNGKKI----ANRVEPNKRPMSSMTPTIIF-KDNNLFALTGSPGGTSIINYVTKSVLGLIDWNLDPSQIVNLP--HYMNRGSYTELEKNTSENLKAGLELLGHPVKIQNKR-SGLHIALKKYDGYVGGADPRKEGLVI.. 561
204 0.000e+00UniRef50_A0A0W0F5I5 Uncharacterized protein n=2 Tax=Moniliophthora roreri TaxID=221103 RepID=A0A0W0F5I5_9AGAR  ali  36  84.....VQSRHGAVATENRLCSDIGVQILKDGGNALDAAIASALCVGVVNPFSSGIGGGGFMTVRIPPSREVWTVDFREKAPGGANTTMYKGANSSRFGGLSVAVPGELRGLEEAHRRWGSLPWKQLVLPSVELAS-GFRVGVELGRRIPWFADLMLTNPDWTDIFAPGGVFLKENEVIRRTNLSRTLLAIANEGADAFYKGPIADSLIRKIQATGGIMTHKDFEDYTVDVYPSLQGSYLGKKI-YVPGAPTSGPVLLHMLNVLEHYDFSK-------RSGVNTHRLVEALKYGFAARTRISDPLYRNDTSVIEEIPTKAFAASVVRNLTDDRTHPPEYYNPEYDVKMDHGTQHVSVVDHDGMATSLTSTINLVFGSQVLDPETGVILNDEMDDFSVPGTPNGFGLWPSPYNYPEPYKKPLSSTVPAIIENPDGSFHLAIGGSGGSIIFGAVFQVLVNLNHWGMNIGEAIESGRLHDQLYPETTIVDSTYPEAMMQELRLRGHNLTVLDRVAGVINAVMRDEGTFYGTS........... 606
205 0.000e+00UniRef50_Q0A5N3 Gamma-glutamyltransferase 1 n=6 Tax=Ectothiorhodospiraceae TaxID=72276 RepID=Q0A5N3_ALKEH  ali  32  44EEKRSAQTEGAMAVTANPHATRAAHELLAAGGSAVDAAIAAQLVLTLVEPQSSGIGGGAFLLHHDAGTGETLAYDGRETAPAAADAGLFLQDGEPVSGGLAVGVPGVVRLFEQAHARHGARPWAELFQPAIELAREGFEVSPRLNDILQREWA-ILDNEAARAYFTDEGEPLPVGQRLRNPALADTLSRIAEAGAEAFYTGPIAEAIVDAVQHNPGRLTLEDMAGYRAEVREPVCAPYAGHRVCSA-PPPAGGFVVLQILGLLER----AEAVHPPEDEADRAHLLAEASRLAYADRARFADPDHEPVP--VADLLDADYLDERAALIDPVRSMGEAEAGLALEPPARPSTSHLSIVDAQGNAVSMTSSVEMPFGSGLFVR--GFILNNQLTDFAFEPEDGNGDPV---ANRVAPGKRPMSAMSPTLAF-EDDALRLAVGSPGGPWIIGYTARHLALVLGEGAPLAEAVAAPNWNNRNGPTKLEVEG--SEALAGALRERGHEVSV-RGMTSGVHAIFVDDGVRHGAADPRREGTALG. 585
206 0.000e+00UniRef50_A0A1F9FID3 Gamma-glutamyltransferase n=1 Tax=Deltaproteobacteria bacterium RBG_16_71_12 TaxID=1797848 RepID=A0A1F9FID3_9DELT  ali  32  1.............................................................MVHLAREGKTRALDFRERAPAAATRDMYLGPDGSLDGHKSVAVPGTVAGLRELHKAHGRLPWRLVVKPAVDLARNGFVVGDEWVASFEWRKDVVTRFAASRAAFMKDGAPYQLGDLLRQRDLARTLQDIARD-PSSFYQGRVAQAIVEELRQGGGLITAEDLRSYRPVWREPLCGAWRDLELCTMPPPSSGGVALLEILRLLDGVDLRGLGWHHPD----ALHRLIESERIAYADRAHLGDPAFTAVP--VAELTSPAYAALRRGAIDDRRASKSADVKAMSAAQESPDTSHLSVVDGERNAVSLTFTVNYGFGSGVVVPGTGVLLNDEMDDFSAPGVPNAFGLVGGEANSVQPGKVPLSSMTP-LVAAKAGKLYLVAGSPGGSTIITTVLQTLLHVVDYDMDCQAAVAAPRLHHQWLPESTRLEAGFDTATKGALELRGHAFTTTDGWGNAMCIRVLDDGTLEGGADPRGEGVARG. 493
207 0.000e+00UniRef50_A0A182VVH1 Uncharacterized protein n=23 Tax=Culicidae TaxID=7157 RepID=A0A182VVH1_9DIPT  ali  40  67.....HMYESAAICSDSDICSNIGRDLLKQNGSAVDATIGTMFCTGLTNLQSMGLGGGFIMNIYRRQERRAYTLDAREIAAGQATADMLHDPSTTNEGPLSVAVPGELKGYWEAHRRFGQLAWSEVLRPAQELCRRGIPISKHMQDSLSFNSKAL-NDERMRNLFTDTGRRKLQGDFIRPTKLCDTLDRIALEGGDTLYQGTLANEFAADLQDMGSIITVDDLRSYSVRWNDSMPIDL-DGDTMYVVPPPASGVLLAFIMNILKGYHFQPDDARSIEDTIRTVHRIVEAFKFAYGKRTEIGDPRFVDVAELTSNLTSVEYAEAIRSRIEDAVTTKPADYDGFFFTPNNDGTAHISVLAPSGDAVSVTSSVNFYFGAGLMGERTGIIVNSGMDDFSSPGLRNYFGLPGSEANFIRPHKRALSSMSPTIVTDPGHSVKLVIGAAGGTKITTAVALTIMRVLWFGYDIKEAIDAPRFHHQLIPMAVQYEYG................................................... 551
208 0.000e+00UniRef50_A0A137PGU3 Gamma-glutamyltranspeptidase n=6 Tax=Conidiobolus coronatus (strain ATCC 28846 / CBS 209.66 / NRRL 28638) TaxID=796925 RepID=A0A1  ali  33  91.....VKGLHGGVASEQGDCSKIGVDILKEGGSAVDSAIATGLCIGTINP-----------------SGNVEHIDFRESAPAASNKTMYKRPEQVQVGGLAVGVPGEIKGFELMHRKYGKLPWAKLFAPSAKLCNEGFRAGTELVRQLNLAKDWIFENEEFSKVYVKNGELVDVGDIVKRPGLGATLEKIGKEGSSAFYEGEIAREIVDFTQKNGGILTLQDLKSYKPIIRPYAEGKFFNSTVISTTAPSA-GSILISTLQLLEEV-IKTNGKGS---TSDVYHKFIESLKFGFAMRTKIADPDFSEISKFSELILTKDYIKKLATEVDLTSTHNFGYYHPQYDTKELPGTTHISVIDNTGLVVSLTSTVNLEFGSHLMTPVSGIILNDEMDDFSLPNVTNGFNLPPSPLNWVQPHKRPLSSTVPTIVVGPNGD-IISLGGSGGTRILSAVAQILLEVEVNGKDLNSAIDTPRIHHQLIPETIFLEKAFDQDIINGLYTKGHNVTRWPRHKSVVQIVKRKDGSIEALSDGRKHGLAYVY 621
209 0.000e+00UniRef50_UPI000B90E61A gamma-glutamyltranspeptidase 1-like isoform X1 n=5 Tax=Acanthaster planci TaxID=133434 RepID=UPI000B90E61A  ali  39  123.......FRRAAVAADVGICSEMGRDILKQGGGAVDAAITSLLCVGVVNPQSSGLGGGMFMLVYHKDMGKAEALMARERAPAAATANMTRE----TFGATSIAVPGELSGMWEAHQRYGRLPWGKLFQPVISLAEEGFPVTAHLARALSILSRRVANWPEHAGFLTRDGTWKGVGETVYAPKLARTLRAIAMNGVSELINGTTAQRVVQEIQDYGGLITAADLADYKAEWREVNAAPIGQGRSVLTTPSPSGGPVVQFLINVLGNYKISSADFETTERQIKTYHRFVEASKFAFALRSYLGDVEAPEVQEVLDKMRSEEYAKTVFAKIREDAVTNASGYDALLNTASSGGTCHISVVDESGNAVSVTSSVNYYFGSMILSNTTGLILNNEMADFDTPSSQ-----PASSANHVAPGKIPLSAMSPVIVVKENGGAELVVGSAGSRAIITTNALVALRSAFTDASLKDIIDDKRIHNQLQPNNVAYENGFPTDVVDGLVNMGH-VVESRTLISVAQAIKRSEDGWTAYSDPRKKGQAAGY 654
210 0.000e+00UniRef50_A0A160V8C7 Gamma-glutamyltranspeptidase n=21 Tax=root TaxID=1 RepID=A0A160V8C7_9ZZZZ  ali  25  7..RSTVLATHGMVATSQPLAAMAGVRILMEGGNAVDAAIASAAVLNVVEPVSTGVGGDMFALIWNNKDKSIQAINGSGRSGMASTIDALKAEGMPQRGVHSVTVPGAVHGWETLLNECGTMPLSHLLQPAIQYAEEGYPVSDIISFQWSNQVEMLSKLPSGQEMLL-NGKAPKHGDILKIPTLGRTLRAIAEGGSEAFYNGDIAEKMAAFIQEQGGCITTADMTNHTSDWQDPISTDYRG-VTCWECPPSDQGVAALEALNIIEGYDIAGMGAQTAD----TYHHLIEAMRLAFADAQYVADPGFAEIPT--AEMLSKEFASKRRALIDPNHALETVPYG---KVQGGSDTVYISVVDGEGNACSFIYSIYSNFGSGLIVPDTGIVLHNRGALFS---------LDHNHVNALEGGKRPYHTIIPGLAT-KNNELYLCYGVMGAFMQPQGHLQLISNLVDHGMDAQAALNALRFIV--TENDVSFEEGLPPQVLADLTSKGHNTKMISSYMGGAQLIQRDPGVLHGASEPRKDGCAIGW 533
211 0.000e+00UniRef50_A0A2A6CIF4 Uncharacterized protein n=5 Tax=Chromadorea TaxID=119089 RepID=A0A2A6CIF4_PRIPA  ali  39  82.......YAKAGVAADNEYCSEIGRNALLQGGNAVDAAIAALFCIGVMDSHSAGIGGGHFMTIYNATTNKCHVIDAREIAPAAADENMYKDKDESQIGWRAIAVPGELHGLWTEYSKFGKVTWKSLVDPTIALMKEGYPTSHALAKALMEKRDIILKEPTMSGFVNPTGDVYQPGQQIRRQSFVETLEKVANDPIQLFYKGEIAKKVVEEFKVNGGLITLEDMAGYQSIIREVITVSLQGGRHICGPPPPAGAAVAMGILNALDGY---KYDMKSFDDIATMYHHFIESSKFAYASRSRLGDSAFVNATEIAKNMTTPEWAKWVRSLITD-VTHPDAYYGGTFEAPADHGTTHISVIDKFGNAVSVTSTINLLMGSIRASNSTGILWNDEMDDFSLPGHPNYFGFPPSPANFIKPGKRPQSSMSPIVIFDKDDRQLLSVGGAGGSTIISGVASVALHALWLNANVKQAVDAPRLHNQLQPNVTQYESNFPTDYIDNLIARGHIMEKTD-NLTVVTAVERSDKQIYANSDFRKESGPAGY 624
212 0.000e+00UniRef50_I4Y8Q0 Gamma-glutamyltranspeptidase n=2 Tax=Wallemia TaxID=148959 RepID=I4Y8Q0_WALMC  ali  35  2.......................GVDVLKNGGNAADAAVTSTLCIGVMNMFSSGIGGGGFLLHRTPE-GDISSIDFRETAPGLADPYMFEHPHSAQIGGLAVGTPGELAGLHALHEQYGSLEWKDLVLPAAELA-KGWPVPKELARRIEISRDWILKDPIWKEWLAPHGTTLKEGDWIARPAYASTLETIAEQGVSAFYEGEIGESFVRTARDAGGILTVDDLHHYKVVYGKGYNTSVNGLD-VHTCGFPTSGPVMLFMLNALESLDMVP-----PRKTADDLHKFIETMKFGFAERTRIGDVPFMNDTTAMLNMLNKSYAQETVDKITD-RTHTWEYYGPDFEGKDTHGTTHLTLVDDDDGVVTLTSTVNGLFGSHVLDEHTGIILNNEMDDFSIPGHPNMFGLWPSPYNLPEPYKRPLSSTAPTIV-EREGNLVAALGGSGGSRIFGSVLQTLLHIL-QGYNPSAAIEAPRVHDQLFPPVVTFESGFSRHLIREMRLRGHNTTVFDFNLGAVQAVTIEDNFKYAASDSRKGGVAAAY 509
213 0.000e+00UniRef50_A0A1B0EW75 Uncharacterized protein n=1 Tax=Phlebotomus papatasi TaxID=29031 RepID=A0A1B0EW75_PHLPP  ali  38  15.........................DVFTRGGHVVDAAIATMFCLGLTNMQSMGIGGGFIMNIYLRDAQKAYTLDAREISATAAHEKMLHDSRTTIEGPLSLGTPGELMGYWEAHQRFGRLPWRDLVAPAIKVCEQGFPMSRHMEDSTKIN-PRIQYDYMLRGLFFNTNSFRRMGSIVRPTKLCETLRIVAEKGGADLYNGTLADLFVEDLKELGSIIKREDLEAYRVKWSDSIPIK-MNGDTMYIIPPPGSGLLLGFIMKILKGYHFSADSIATKNETIRTYHRIIEAFKWTYGKRTEIGDPEF----------------------IDDTTTQQPKDYGGNFHISEDQGTAHISLLAPNGDAISVTSSVNFYFGCGNMGNRTGIIFNSGMDDFSSPGLKNYFGLPGSPPNYIRPRKRALSSMSPTIVVGNDGNVKLVIGAAGGTKITTAVAMATMRILWFGQDVKEAVDAPRFHHQLIPMWVDYEYGTEEYIVEGLERLGHKTNRYNYRGSIICAIKRNDTAIYGNADFRKEGDVFGF 508
214 0.000e+00UniRef50_A0A1Y2WPW9 Uncharacterized protein n=1 Tax=Daldinia sp. EC12 TaxID=1001832 RepID=A0A1Y2WPW9_9PEZI  ali  31  51RQRPLSFEKNGAVASAGDICSRVGTSIIHRGGNAVDAAVATDFCLGVTHSWIAGLGGGGYAIVRD-SSGKSECVDFRETAPAASDRDMFNNPNASTTGGLASGTPGQLRGLEYLHKRYGKLPWKEVIDPAIKVARGGFTINQLLLNAMTRAENFFVNNADWAEVFAPNGTMLGVGDTVRMERYADLLETVSTHGADSFYTGPVAAKISDVVQRDGGIITAQDLKGYKVETSTPLEITYGDYKIMS-CRSTAGGTIVLMTMNTFQQF----LARDDIHGMNLTLHRLVEAMRFGYAARATLGDPNFNPGQNVSEQLIQKYTADSVRQKISDNHTLPVEAYNPNLDIIHNHGTSHLSAADASGMAISLTSTPNLSFGSRLMVSGLGLIMNNEMDDFSVPNRSNHFGYIPTESNFIEPYKRPLSSMGPVIVDHANNSFYVATGAAGGSHIISGVEQTLWRLLDLSFSAKGAVDAPRFHDQLIPNVLNLEESWDKGTHDFLQSLGHDVQWGNVGV-DIHVIMLSNGTFEAAGESRLEGT.... 589
215 0.000e+00UniRef50_A0A1V0RN55 Gamma-glutamyltranspeptidase n=13 Tax=root TaxID=1 RepID=A0A1V0RN55_9RHOB  ali  29  52...QPVEAQNWMIAAAHPLAVDAGARVLREGGTAADAMIATQLVLGLVEPQSSGLGGGAFLVWHDGASGAITTLDGRETAPLAATPTLFQDANGAVVGGRSVGTPGTPALLAEAHARWGRTAWAGLFSEAIALAETGFPVSPRLAGLIAEDADRLKIFKDTREYFLPGGAPLAPGHILRNSDYADTLRLLADKGVSAFYAGEMALDIAERVQRSGGVLSPLDLAIYRVKERPALCTPYRGYEVCGMGPPSSGASTVGQILGLLEPFDLSSLGPQSPE----AWRLIGDASRLAFADRRYLADNDFVAVP--LKGLLSPDYLKQRSDLLRGDDALPVTPGRPDFDSLELPSTSHISIVDGYGNALSMTTTIENGFGSRLMVG--GFLLNNELTDFSF--ATHDAGLP--IANALAPGKRPRSSMAPTI-LRRDGVPVLVLGSPGGSSIIGYVAKTIIAWVDWGLDVQEAVSLPHLVNRFGPY--DIEPG-ARALVPPLTEMGFEIRETA-LTSGLHVIAI-GAELAGGADPRREGLAFG. 589
216 0.000e+00UniRef50_A0A2A5A1V3 Gamma-glutamyltransferase n=1 Tax=Candidatus Marinimicrobia bacterium TaxID=2026760 RepID=A0A2A5A1V3_9BACT  ali  30  36..........GTVVSAHPIATEIGMEVLRDGGNAVDAAMAVGFAMGVVDQFHSGIGGGGFIVIRMA-DGTIHTIDGRETAPAAATRDMYLRNGLSQEGVLAVGVPGIVAAYEEALELAGTKTLAEAVQPSIPVARDGFVLDEPYAHVIRETAEKLKTDPASRAIYLHDGSPLAAGEMLLQPDLAATYEKIAARGTDYFYKGEFAEQLAAFMEANGGLITEADMAGYKVHYREPIVGDYRDYKIIGMAPPSSGGVHVLQILNMLEATDLKGKSTWDSESIYLTTRFMSQAFK----DRSHLGDSDFYNVP--VDRLISQNYADSVVAVVMSETSAEVPETGASSFEWSPGSTTNFCVMDRWGNAVVVNQTVNLWFGSKLTLPGTGVVLNDQMDDFSAPGVPNAFGLMGGEANSIAPGKRPLSSMSPTIII-KDNKPVLFLGGAGGSRIITAVLQLIVNFVDFGMTVETAQEQPRFHHQFKPDILFVEPDFLESMLAAQKNRGYEVIE-NGSLGRVQAIGWNEKRYEAGPDPR........ 558
217 0.000e+00UniRef50_D1C224 Gamma-glutamyltransferase n=5 Tax=Terrabacteria group TaxID=1783272 RepID=D1C224_SPHTD  ali  27  9..RAVVMAREGMVATAHPLATAAGLDVLRRGGNAMDAAIAAALVTGVTLPAMCGLGGDAFMIYYDGRTGEVTAINGSGIAPQAASREYFVERGMPFTGLLSVAVPGAVHAYFTAMERFGTMEPADLFAPAIRYAEEGFPLTTEGNQTIAAYAEGMSRFPTSAEIYLPGGAPPKPGHLLRNPNLARSMRLIVEGGPEVFYQGEIAEEIARFMAENGGLMTVEDLAGHESVVYQPLQTEYRGY-TVYQTSLPSQGIIMLEELNILSNADLAAMGAGSAD----TIHLMVETKKLAFADRAYCGDPKFIQVP--LETLLSPEFARERFKAIDMSRAMERCDAGIIPEQV--GDTTYLCVVDRDGNAVSLIHSLSAAFGSQVVAGNTGILLNNR--------AGRGFTLEEGHPNVIAPGKRTMHTLNCYLVTQG-GKLRWVGGTPGGDGQPQWNMQVITNLIDFGMNVQEAIEAPRWLSFNLPNVLRIEGRAGAEVIEDLRRRGHRVEVLGDWGGAAQVIEVDPGTLFGGSDPRTEGLALGY 543
218 0.000e+00UniRef50_A0A023X5H8 Gamma-glutamyltransferase n=1 Tax=Rubrobacter radiotolerans TaxID=42256 RepID=A0A023X5H8_9ACTN  ali  32  46......RGVGGAIATESPVASEVGLGVLDSGGNAVDAAVAATFAMNVARPQSCGIGGGGFM-VYRGADGEAAALDFRETAPEAITADAFTGDGITFTGHKTVGVPGTVAGMQAALDRYGTMSLAETIAPAESLARSGVAVQPVVADEMAANAARLRLFPAASEQFLREGAPYRAGDVLVQPDLADTLSRIAAGGAEEFYRGETARLTVSDMESAGGLMTLEDLASYEAKWREPLVADYRGAEVIAMPPPTSGGVATLQMLGILEGYDLAAEGRYS----ARTLHRISEAQKVAFADREYLADPDFVDVP--VEELLDEGYLEERREEISPDEAAEPEPGDFGDAGTEGEETTHISVVDATGNAVALTCTIEQSFGSAVVAPGTGFLLNNELTDFSEPGT----------ANEPEPGKRPRSSINPLIV-AQDGEPTLVTGAAGGVTIVMGAFQAALNHLDYGLDPAEAVDAARL-DEAVPGEMTLEDRVSPVEQAELIAKGHTISREGEYLPRVQAVGIDPGEALATTDPRSG...... 573
219 0.000e+00UniRef50_UPI000640F348 gamma-glutamyltranspeptidase 1-like n=1 Tax=Hydra vulgaris TaxID=6087 RepID=UPI000640F348  ali  36  133.......YAKAAVSSDAGACSKIGVNILRQNGSAVDSAIATTLCLGVINMYATGIGGGGFMLIYIKENNTFEALDFRERAPGKSTVDMFEKNNKSRYGGQAIGVPGQIKGLYFAWRKYGRLPWEKIVDTAIQLTTEGFVVHPILNRVATLSKEFIKTDAGLRNLLLTSGQPIQAGTVLKDPKLAETLKIIRDD-PESFYSGKLAEKIVKDISIAGGIVTLDDLAEYKVETRN-IITTYINDLKLSTIGLPSGGVSVIQFLNILKGYFLSPMDPTDPEKSAKTYHRIIEALKFTFAQKSKYGDPNFLDVNKETEHALDENFGDSLRLKIDDSKTRDFQYYGSEYVIPSDKGTSHASILAENGDAVSVTTTINEWFGCMYRSTETGIIYNNEMSDFSTMNTVQEGPLAPSPYNKVHSGKTPVSSMSPIIMTDKNGEVKFVIGGTGGGRIIASVSQAIINKMWFGLDLAHSVASPRLYHQLWPNYINIEEGISEEIIKKLQAKGHTFETILPMKTSAQAIYVEPGIVYAMSDPRREGKTDGY 674
220 0.000e+00UniRef50_A0A291JWW7 Gamma-glutamyltransferase n=40 Tax=Bacteria TaxID=2 RepID=A0A291JWW7_9GAMM  ali  29  49...........AVAAANPLATDAGYQVLKAGGNAIDAAVAVQMVLTLVEPQSSGIGGGAFLMHYDGSN--VQAFDGRETAPAAATGELFMEDGEPVASGLSVGVPGVLRMLEQAHAEHGQLAWRELFTPAITLAEEGFAVSHRLHTSLANDTA-LREDPLARAFYYDEGEPLAVGDTLTNPALAAILRRVAEEGSSAFHEGAIAEDLVARVQSHPGEMSLDDLSGYEPVEREPICTPWQEWEVCGFPPPSSGHITVMQILGILDQQPLIEAPLDNGAPSSGWLHQFLEASRLAFADRRYIGDPDFVEAPGDWRTMLAPEYLNQRSRLMGEASLGDSEPGNPGEPEQPEYGTSHISIVDGDGNALAMTTTIEQAFGSRILADGGGYLLNNELTDFAFEPESE--GLP--VANRVEPGKRPRSSMSPTLVFDESGELVASLGSPGGAAIIHYTARSLVAMRDWGLDAQEALDLP--HAITLGGDVYLEEGFSEETAEALRGRGHQVSE-RELTSGLQAIMKEDGTLYGGADPRREGVVMG. 594
221 0.000e+00UniRef50_A0A021X9P4 Gamma-glutamyltranspeptidase n=541 Tax=cellular organisms TaxID=131567 RepID=A0A021X9P4_9RHIZ  ali  29  60.......................GEKVLADGGSAIDAMIAVQTMLGLVEPQSSGLGGGAFLVYYDAGTGRLTTLDGRETAPMEATPRLFLDEKGAVVGGRSVGTPGTVMLMQEAHNRWGRKPWKDLFIPAETLARDGFSVSPRLAGLIATEGDRLKTFETTAAYFFADGAPLKAGRILKNPAYAETLSAIAGGGAPAFYTGTIAQGIVDTVRSSGGVLSLADLQNYQVKERRPVCTSYRALDVCGMGPPSSGAVVIGQMLGMLENFDLKALGKDNAE----SWRLIGDAQRLAFADRRYLADTDFVPAP--IKGLLDKTYLGERARLLDGDKALAVTAGKPEWDALELPSTSHFVIVDAAGNVVSMTTTIENGFGSRLMTG--GFLLNNELTDFSFKTHDEGMPV----ANRVEPGKRPRSSMSPTIVL-KDGKPVLAIGSPGGSQIIGYVAQALIAHIDWGMDVGQIVAMPHLINRFGPY--DLEAGTAAEKLAALKALGYEVKV-GEMNSGLHAIAISTDGLTGAADPRREGVAVG. 583
222 0.000e+00UniRef50_A0A1C3RGQ8 Gamma-glutamyltransferase n=3 Tax=Terasakiella TaxID=196080 RepID=A0A1C3RGQ8_9RHIZ  ali  27  47..KPLVKSQKAMISVANPLAAQAGYKILRAGGTAIDAAITAQMVLNLVEPQSSGIGGGGFLLVYDPHTKKIISYDGRETAPKKVTPSLFLKENGATVGGRAVGIPGLLKMLQLAHQDYGRLDWSLLFEDGAQLAEKGFPVSPRLHHLLKKDR-FLKKDPIAKAYFYNKSQPHPVGHLLKNPAFAQSLRQIQSGGVDSFYFGQLADKIVDKVTSNPGLLSHGDLMSYKAIKRAPVCLDYRSYHICGMAPPSSGGLSVLQTLGLMEKYDLN----NDPKPLIDRTHLFLEASKLAFSDRNHIADPDFVKVPT--DELLASNYLIGRQTLIQHNQTTPVPAGGPAPDNTEHGSTTHMSIVDSQGMVVSMTTSIENAFGARQMVG--GFLLNNQLTDFSFLPEKNGVKI----ANRVEPLKRPRSSMAPTIVLDQEKRPVLTIGSPGGSRIIGYVAQSLIAVLDEKKPLDQAIAQG--HMTNRNGATELEKGTEAAHRAQLEALGHQVK-LKDMTSGLHAIQIQDGRLAGAADPRREGVVLGY 592
223 0.000e+00UniRef50_A0A090LGS7 Gamma-glutamyltranspeptidase family-containing protein n=3 Tax=Strongyloididae TaxID=6246 RepID=A0A090LGS7_STRRB  ali  35  113.....ARYKKAAVTSDNGLCSEIGRDILLKGGNAVDSAIATLLCIGVVNPQSSGLGGGFIMTIYDSKLKKCISLDAREMAPSEAKENMFVKKPLSFVGWKSIGVPGELHGLWTAYTKYGKVNWTTLFEPSIALAKDGFPVTAHLAVSLQKKKTYIMDDDDMKKMFTNTGRLYEEGDFLKRPLLANTLLSLAENPVDLFYNQGIAQTISEEIKENGGYVSKEDLGKYETVIYDPIEVDLPGGLTMCGPPPPSSFLITQAIVMVMNKFNLNNL------NDPLFYHRLIEIEKFAYSQRTKLGDKAFVSMSDLIQNLTDPSYYNNVYESVK-NISQPIEYYSPSRSQAPDHGTSHITIIDSDGNGVSCTSTVNQLLGSVRASPTLGIIWNDQMDDFSSPGLTNSFGYTPSSSNFIKAGKRPMSSASPTIIYHKEGEIKMSVGASGGSYIISATAQVIIRSILFNQTVKEAVDAPRFHHQYLPYVTEYELFTPNNLIKILENYKQNMTGKEKLSSAVQILEKDNGYIYGNSDFRRETYPTGY 659
224 0.000e+00UniRef50_B8NM71 Glutathione hydrolase n=15 Tax=leotiomyceta TaxID=716546 RepID=USTH_ASPFN  ali  32  57..........GAVASEHALCSRYGADMLERGGNAADAMVATMFCIGVVGMYHSGIGGGGFMLIKSP-DGDFEFVDFRETAPAAI-----VALGKNTSAGLRSGVPGEVRGLEYLHRKYGVLPWSVVLEPAIRTARDGFLVQEDLVNYIDMAEDFLSKHPSWAVDFSPSGSRVRLGDTMTRRRLAATLERISVDGPDAFYSGPIAEDMVASLRNVGGIMTLEDLANYTVVTRDTSHIDYRGYQITSTT-APSSGTIAMNILKVLDTYD----EFFTPGTTELSTHRMIEAMKFAFGLRTRLGDPSFVHMEEYENHILSAEMIDHIRQSISDSHTQDTSAYNPGLEVVNSTGTAHIATVDHQGLAISATTTINRLFGNQIMCDRTGIIMNNEMDDFSVPTSPPTFGHTPSSTNFAEPGKRPLSAISPAIILHPDGSLFLIAGSAGSNWITTTTVQNIISGIDQNLAAQEILATPRVHHQLIPNHAIFETTYDNGTVDFLSQLGHEVTWYPPAASMAHLIRVNDGGFDPAGDPRSGGVVA.. 584
225 0.000e+00UniRef50_A0A1J8R9F1 Uncharacterized protein n=2 Tax=Agaricomycetidae TaxID=452333 RepID=A0A1J8R9F1_9HOMO  ali  39  83.......AEHGAVASENQRCSNIGVDVLKEGGNAVDAAISAVFCVGVVNMFSSGIGGGGFMTVRIPGSSEVYTIDFRETAPALANSTMYKDDPISRFGGLSVGVPGEIRGLEEAHRRWGKLPWARLVQPSADLAAE-WTVDKELARRLQMFGTVMLSLEDWRAVFAPEGRILLEGDTIRRTNYSHTLSVIASEGPDAFYKGPIADSIIRKIQATGGIMTNEDLDKYTVKVDHALQGTYHD-KKVYTSRAPTSGPVLLHVLNLLERYDLVGEG-----RTGLNVHRFVEALKFGFAARTRIGDPYLHNGTARVAEIPMKSYADAVAANLTDDRTHPPEYYNPEFDVKIDHGTSHTTVVDEDGMAVTLTTTVNLVFGSMVLDPETGMILNDEMDDFSVPGTPNGFGLWPSPYNYPEPGKRPLSSTSPTIIENADGSFYLAIGGSGGGRIFGSVIQVILN-LDWGMDVSEAIEAGRVHDQLYPLTVDVDDIVSESVLIALSERGHNVTVSD--------INRKDGRIYAASDSRK....... 608
226 0.000e+00UniRef50_UPI0006730CA9 gamma-glutamyltransferase n=2 Tax=Brevibacillus reuszeri TaxID=54915 RepID=UPI0006730CA9  ali  24  7.DPSMEKATQGIVSVSHPLAAEAGIKILQQGGNAVDAAAAIQFSLNVVEPYMSGIGGGGYMMVYLKDQNKIIALDGRETAGMNANPDFHLDEDGKTTSGHAPGTPGLLRLVEESLQKYGTMNLADVLDSAIEQAEQGIEVNWATERYTANEVRRIQKYEATEQVFMPGNESIREGDRLVQPDLAKTLRLIKEHGAKVLYEGEVGEALAREVQKHGGRLTMADLRAYTVKEAEPIRAPYRGYEIVSMGPSSSGGITMIQMLKLLEPYDLQSMGHLSAD----YMHHLLEAMHLSYADRAHMADEDFCPVPK--AGLLHPDYLSERTRLINPEEATKVEPGEPWPAATEDGGTTHFSVIDQWGNMVSFTSSIGSVYGSGMMVPGYGFLLGNHG---------VAFQTEAGSVNQIEPGKRGLSSMSPTFVL-KDNEPFMALGSPGATTIIASVAQVILGVIDFGLPIQQAILAPRVYSSTYP-RVEWEYGIEPDVLRALVAKGHAFEATPPYIGDVHAVLYDTKSMYGGTDDTREGTVLG. 554
227 0.000e+00UniRef50_A0A2G4FQU1 Gamma-glutamyltransferase n=3 Tax=Planctomycetales TaxID=112 RepID=A0A2G4FQU1_9PLAN  ali  27  26.......FNKGVVVSVSQPGSDAGLRVLKSGGNAVDAAIATAFTLAVTHPAAGNIGGGGFMVVHPPQKGEPTVFEYREMAPKSAFETVFNKNDG-MFTHKVSGVPGTVRGLALAHQRFGSKPWGQLLIPAIELAEKGFPISKQLANSLNGLLATSKEFEELQRVFKPTNSLWQTNDILIQKDLGNTLTRIAKFGPDEFYLGTTADLISNEMKIGKGLISKDDLALYQARERNPIKLEYKGYSIYGSPPPCSGTITLGLMLNMIEPVDIKKMGRWSPE----TFHLLIETMKRAFCERAHLGDQGFIDIP---ASLLDKEFAKKLAAGINPQKATPSADLAKDFNSKESDNTTHFSIVDAQGMAVSNTYTLEQSYGSKVMVRGAGFLLNNEMLDFNFPGETNTTGRVGTKANLIAPGKKMLSSQTPVIV-AKNGTPYLVTGSPGSRTIINTVFNIIINVIDFEMTAQEAVDSARLHHQWFPDKAYFEEAGNPKYMKKLRAMGHDI--SSRRQGDAHSILIDPKTLHPGLDHRIEGGLAG. 556
228 0.000e+00UniRef50_A0A0L0CB20 Uncharacterized protein n=1 Tax=Lucilia cuprina TaxID=7375 RepID=A0A0L0CB20_LUCCU  ali  39  615..........GAVVSNGKGCAEIGSQMLIDGGSAVDAAIATLVCEGVILPHSMGIGGGFVATIYTKKAGRIETLIARESAPAAAHKNMFVGQT-SITGARAGAVPGELLGYWELHQRYGRLPWKVLFQPSIKLCKEGHWVSKYLAAALLSKEAAIRNEPTMAEIFVKDGSLYKEGDYMKRPALGNTLEKIANNGVGEMYDGEIGKMFAEDIQEMGGIITEQDLKTYKVIWDDHVVANVTGGYKLYTTPLPSSGALLAFILNVMS--DLY------TTNQEIYWQRVIETFKHAYGQRTNLGDLEYDTIKETFDKLISQEFANDVRKLIHDETTFDMSYYGANFTIEEDHGTANMAVLAENGDAITITSTVNSYFGSKVRSRRTGIILNDEMDDFSTPGVINSYGVPASPANYIKPGKRPMSSMCPAIILDKEGNVKMLVGAAGGTKITTSIATAIMKYLIFNETMHQSINDGRLHHQLAPMRIDAEIEVPINVRNYLTKVGHNLSILPSGFAAVTAIGVRTGVPEPFYDRRRVGSTA.. 1144
229 0.000e+00UniRef50_A0A0K8LH83 Gamma-glutamyltranspeptidase 1 n=3 Tax=Aspergillus TaxID=5052 RepID=A0A0K8LH83_9EURO  ali  33  55..........GAVASESQECSNEGKNILQNGGNAADAMIATVLCVGVVGMYHSGIGGGGFMTIREPKPGTYSTIDFRETAPAGAHRDMYKNRGAAQIGGLASGVPGELKGLQYLKEKYGRLTWSQLVQPAIKKAEEGWEVSKDLEIYMNRAKDFLLEFP-WNETFAKEGKRVKEGDLVKRKKYAETLQTIAMDGVEEFYKGKIGKSITKAVQSDDGIMTEYDLRNYVIVQREPLIDRYHDHTIVS-PMAPSSGVIAQKVLKVL---NLYGDLFKNLTNVHRDTHRMIEAMRFGYAMRRKLGDPAFNEMEEFQEKMLSNEEINRVHGNITDDSTHEESYYGGGDPGRERGGTSHMVTADNTGLAISLITSVNLFFGSHVMDPDTGIIMNDSMDDFSIPGEANAFGYIPSPENFICPGKRPQSSMSPVIVTGPD-KFTFLAGSAGGSHITSATIQNIIHVVDEGLSAEEALRKPRLHDQLNPYICSFEHGYDMNTVAEMARLGHNASWIMPGMSTAQAIRWSNGGFEAAGEPRSGGAA... 599
230 0.000e+00UniRef50_A0A259F4A3 Gamma-glutamyltransferase n=3 Tax=unclassified Hydrogenophilales TaxID=1798413 RepID=A0A259F4A3_9PROT  ali  29  43................................NAVDAAAAVQFALNVVEPQSSGIGGGGFMLIHLAKTGETFIVDSRERAPAAASADMFAPDGLPMTSGLAVGVPGTLRGVDTALTRWGTKTLADTLAPAIELAEHGVRVNRFLAADIANDGGRTRIHPETAAIFRPGGVPLAEGDWLVQPALARTLKRIAARGPDAFYRGALARSIVRAQQATGGRMTLADLAQYEVAIRDPLVGQYRGWTLVGMPPPSSGGLTVLQMLGLLERFPLGDAAQGYGFGSPKTLHAMIEAMRLAFADRAWIGDDDAAPLPR--QGLLHPDYLATRAALIQPDRRMDPPQAGPSRTPQESPHTTHFSIVDRWGNVVSYTSTIEYTWGSGITVPGYGFLLNNELTDFNFLPAADASASNPG-ANDVAPHKRPRSSMAPTLLF-KNGKPVAAYGSPGGATIINSVLNVTLNLIDHGMSLQQAIDAPRLHAQCEGGATFMQPRFSVAAQDALRDWGHATDGCQATIGSVQAIVIDSGTHHGAADPRREGTVI.. 587
231 0.000e+00UniRef50_A0A2D4VGE9 Gamma-glutamyltransferase n=9 Tax=Proteobacteria TaxID=1224 RepID=A0A2D4VGE9_9RHIZ  ali  27  56.........................EIIKKGGNAIDAAIAVQAVLTLVEPESSGLGGGAFMVYFDKAADEVLAYDGRETAPAGATSKLFLDDDGAVVSGRSVGVPGVVKMLWLAHQQHGALPWSDLFEPAIRLAENGFKVQPKLQEWLEWD-PVLKNMPVAGDYFYKTGVPYKAGEIIKNPTYARTLREIAEKGPDGFYAGDVAQAIVDAVHARPGTLSLDDLAGYQAKERGALCRPYRIYRICTMPPPTSGGLTTLQTLGILENFDLKGMGAMT----VTSMHFIAEAEALAYADRRYIGDPDFVDVP--VDAMLDPKYLASRAALIDASLSMKAAPGNPGEEHADNRGTSHFSIIDPDGNVVSMTTSVEGPFGSHLMAG--GMILNNQLTDFSFLPERDGKPV----ANAVAPGKRPRSSMDPVIVFNKDGSFHAAIGSPGGSKIINYVNQSLIAMLDWDMDVPAAIGLPHFMDRNGP--LEIEKNVLEQKIPEFEQLGHEVKV-ERMMSGLHGLLVPDGSLDGGADPRRDGNVV.. 579
232 0.000e+00UniRef50_A0A2P6TRP8 Gamma-glutamyltranspeptidase 1-like n=4 Tax=Chlorellaceae TaxID=35461 RepID=A0A2P6TRP8_CHLSO  ali  39  123..PRSVTAAGGLVAADNGRCSEIGAAVLREGGNAVDAAIATALCQGVLNPQASGAGGGHFMLIRLP-NGTAECIDAREFAPGAANETMFVDPDASISGGLAVAVPLELRGMWTAHHRHGRLPWKRLFQPAIKLAASGFPAHPYLVATLESQIAALSQWPAIRDTFLRQGRGPRVNETCKRPQLAALLQDVAEEGPDVLYVGKYAEQLAADIQAAGGVITTVDLASAAPVISQPLRRHIWGLDWIGAPPPSSS-AAVLAALEILAGYEQPLAGSGSVG-----VHRMTEALKHAFALRMSLGDPGFVDLSAILSALNSSDFIDSLRSSISDSGTLPFSAYGGAFAHPEDHGTSHLSVVDADRMAVAMTTTINTGFGSKVLSPSTGLLLNNQMDDFSTPGQPNVYGIAPSKANFIRPRKKPFSSMSPLIA-ERNGSLVLAIGASGGPRIISAVLQACVRLVAYGEGLFPAVANPRLHHQLTPNLLYVEDWYDADTAELLATRGHNVS-STAWGAVTQAILVDTGELHGVSDPRKDGAPAA. 679
233 0.000e+00UniRef50_A0A1J1J6M3 CLUMA_CG020993, isoform A n=1 Tax=Clunio marinus TaxID=568069 RepID=A0A1J1J6M3_9DIPT  ali  38  43.........QGAIAANGIECAAIGKEIYKAGGNVADVAVATVLCEGITCPQSSGLGGGFLLTIYIKETGTVETLNAREVAPKLATPDMFVNDSASVRGGKAVAVPGELKGLWELHQKYGKLPWAELVQPSIKLARDGHVVSPYLQNIFSRNENSIRNEPTLKEIYINTNRSYALNEYIKRPKLAETLEIIAREGADAIYRGSLAIGLINDIRERGGIITDEDLLDYQVRWRYPVSTTLNDNSTFHTFPLPSNGAITPFILNLLKDYDLK--------HDSLSYHRIVEAFKFAYAKRSLLGDEPTDEIKELMRNLTDIQYAEEIRELINDEKTSDFEYYGARYENQEDHGTAHISILMPNGDAVAVTSTINYLFGAFFVSESTGIIMNNEMDDFSTPGFVNIYGIPASPANFIQPGKNPLSSMMPSILLDENGNP----------KQINN---------WWSC-------ARRLHHQLAPMHVQFDTDFDQDIVRDLEKYGHQIVENPPGFAAVVGIAKNDGVVEGVVDPRR---AAG. 542
234 0.000e+00UniRef50_H5TAZ3 Gamma-glutamyltranspeptidase n=20 Tax=Gammaproteobacteria TaxID=1236 RepID=H5TAZ3_9ALTE  ali  29  6...................AASVAMDVLNNGGNAVDAAIAAHFSLAVTLPEAGNIGGGGFMVIH--YEGANDFLDYREVAPQNAHRDMYLNKDGSIYGVLASGVPGSVSGMWALHKKYGSMPWEQLLAPAVALAKDGFVMPKMLADSIAQYIEYLQEQNNFADYFA----SAKAGKLFVQPELAATLSRIQTLGEDGFYKGETALLIEQFMQQHGGLISRSDLVQYESKWRAPIISQWREYKVISAAPPSSGGIAVAQWLQMYDAVKARVPNQTIAHNSPLYVHILAEAGKRVFADRAYLGDPDFFEVPKT--ELLAPEYIAKRASSININAISDTSAIRPGLAQSE--QTTHFSIVDKHGNAVSNTTTINLGFGSGMVVAGAGFLLNDEMDDFSVRGVPNFFGAVGGVANEIQPFKRMLSSMTPTIVL-KDGNIAMVTGSPGGTTILSSVYLSILNALEFSMPVQSVVDSPRFHHQLLPDEIWYHEAMPQETMQALEAMGY--TSKTSQFGDLHIIVNRGNGLEAASEARGRGKAI.. 522
235 0.000e+00UniRef50_A0A2E3UPD0 Gamma-glutamyltransferase n=4 Tax=Bacteria TaxID=2 RepID=A0A2E3UPD0_9GAMM  ali  26  45...HPVVARHGMVVTQNELASRVGQNILEQGGNAIDATVAIGFALAVTLPRAGNLGGSGFMLIHMEQAQETVALDFRSIAPSAARLEDFIDEDGSTFGVRAPAVPGTVAGLYHAWQKFGSLSWPLLLAPAINLAKEGIAVSEDLAYALAEAMPIMSQYPSSIVAYARDDNSYLAGEILHQPDLAWSLERISEQGANALYSGDIAEKIIDFMDRSGGYISSQDLQNYQVKEREPIATNYRQHKVVTMPPSSVGGLALLQMLNVLKQFDVSRLEPGS----ARSLHLLAEVMKRVNANRRQIGDTDFVSVP--IKGILSEELAKEIAASIDLEVALPVSVIKPIDANPDSRETTHYSVVDDFGNAVSTSYTLGYSFGSGLVVPGTGILLDNQMRNFAHR--------EPGHANEMKPGKRPVSTMTPTLVFDVNDKVKIVTGTPGGSRIHNVIMQLLVNLIDYQMNIAEATHAPRIYQGWRTSELAIERGVNADTSSLLQVMGHDVQLQQT-MGSTQSIARGEERLYGSADPRRPGAALG. 574
236 0.000e+00UniRef50_UPI00077AA39F gamma-glutamyltranspeptidase 1-like isoform X1 n=2 Tax=Acropora digitifera TaxID=70779 RepID=UPI00077AA39F  ali  37  82.........HAAVVSDVKECADVGLDLLRKGGSAVDAAIGTMLCVGVMNPESTGIGGGGFMLVVPQNDGEAKVIDFREVAPLAASKDMFHGNDLASWGGLAVGVPGEIRGYELAHKKYGKLKWSELFAPAIKIAREGFSVTEHTERSLKNLKENVIG-TELGKVVAPKGKLLKEGDKMSNPALANTLQKIADHGADAFYMGPIADSLVKAVRSAGGILTKKDLKIYNALEKEAINSTYKGYRVITT-PLPSGGPVLISMLNILDGFKFSKED----QDKSLTYHYVIEAMKFAFGQRSLLEDSN--NLTDIIQEMLSKKHANLLRAKISPNQTFPLSHYELMVDQAASHGTAHVSAIGPDGDLAAITSTVNGHFGSGIMTK-TGILLNNEMLDFSIPGVQRVVGAGPPKANFVAPGKRPLSNTVPTAVLHEERRCWLSLGGSGSYHIIPAVANTLINILSFNFPLQEAIEKGRVSYGLTSGKTEIEKRFPKELVQVLENIGHNVTNHSS-IADVNGLSYFKEEIVAHGDSRRGGA.... 609
237 0.000e+00UniRef50_A0A1Z8SE77 Gamma-glutamyltransferase n=1 Tax=Flavobacteriaceae bacterium TMED48 TaxID=1986717 RepID=A0A1Z8SE77_9FLAO  ali  28  29.........KGAVVSAREEASKIGVEIMAQGGNAFDAMIATDLALTVCYPNAGNIAGGGFLVYRLADS-ETGSLDYREQAPMAANADMYLDPGKSTLGGMAVGVPGTVAGLEAXXXKFGSLPWEDLVQPAIDLARKGYRVTKKQXSSFXGKXXEFIEVNGERTFYAQG---FKEGDLVKNTALAVTLERIAKYGSAGXYQGENAVALIERVQETGGXMTLXXLLAYXPIWRDPXHFSXKXLXIYTMGPPSSGGIXLGQIMKMVEPFDIGQXEQNSLE----TIQXVVEAEXRSYADRSYLGDPDFITIPX--DSLLNTDYLANRMASFDFXQATKSSDISPGTVWXESEETTHYSILDAMGNXVAVTTTLNGSYGSKVFVESGGYFLNNEMDDFSSPGVPNMFGLIGGKANAIAPEXRMLSAMTPTIV-XKDGKLSMIVGTPGGSTIITSVLQTILNVYEFGMDMQEAVSAPRFHHQWLPDVVVFEPRFDSLFIAKLQAKGXDIKEYTRIIGRVDAIHLEENKITTGADPRGDDKAV.. 557
238 0.000e+00UniRef50_P15557 Acylase ACY 1 proenzyme n=153 Tax=Bacteria TaxID=2 RepID=PAC1_PSES3  ali  28  16.EKKPASGSRGMVVTNHPLASAAGAQILLAGGNAIDAAVASLFALTVAEPMMVGILGGGLSHIRLA-DGRHVVIDNLSTAPGKATAEMYERDRQNVVGAKAVAVPGALKGWCEALARFGTLPLAEVLQPAIGLAERGFVVTPYLSNCITDNAGDLARDPGLAAMLLPGGKPLQPGMRLVQSDYAASLKLIAAEGPDALYGGKLGRALTDYMAANGGLIDQADLANYRIELREPIRGSYRGYEIIGPPPPSSSGVHITQMLNILEGYDIGSLGFGSTD----AVHLLAEALKIAFADRAVAADPAFVKVP--VARLIDKAYADERRALIEMEQAKSWTAGLSGG---ESADTTHVTVADAMGNVVSATQTINGLFGACVQIPGTGMIANNYMYNF---------DPHPGRALSIAPGKRVFTSMAPMMAL-KEGRIAFALGLPGALRIFPSALQAIVNLIDHRMSLQEAVEAPRVWT--EGGVLELEEAIPEAVAQALIARGHKVVRSPRVAGGMNAIAFNDGTLTGAACWRADGTPVA. 544
239 0.000e+00UniRef50_A0A0B7N6Q9 Uncharacterized protein n=1 Tax=Parasitella parasitica TaxID=35722 RepID=A0A0B7N6Q9_9FUNG  ali  39  44..SHKVSGEHGAVAVENERCSRAGLDVLKDGGSAVDSAIASALCIGVINSFATGIGGGGFMLVRT-SDGEYDFIDYRETAPGASTEDMYLNGTLSRISGLAVGVP-----YWR-DSRYGKLSWSRLFRDAIDIAKNGFVANELMYKRLKGSQAWLLNSPEWIEVFAPNGTIAQPGDIIKRPTLGKTLEVIADQGADVFYSGYIAKSIVKTTAKNGGIMTLADLGNYKALSRPVVSTSYHGYKIFTTS-APTSGPILLNILNLVEPYNFAQDG----RRNTLNMHRLVEAFKFGYAARTEMGDPSFTDIEGRMEEVISKEWADLVRKNITDDETHNAEYYQPHFAGNDPHGTMHLSVVDRDGSAVALTSTINLIFGSRIMDPETGIILNDEQDDFSNPGISNAFGYSPSAANFVAPGKRPLSSITPTIIEDENGLLKMVVGASGGSEIITATINTIINALDFNMDLFDAVGLPRIHHQLLPNKIGVETGFDSKIA............................................. 524
240 0.000e+00UniRef50_A0A142YHQ4 Gamma-glutamyltranspeptidase n=7 Tax=Planctomycetales TaxID=112 RepID=A0A142YHQ4_9PLAN  ali  32  30......TFTKYAVSAQESHAADVGRDALRAGGNAIDAAVATAFAMAVTLPEAGNLGGGGFIVAYLPASKRVVDLDFRETAPGSSTPRMYLDAEGNLLGAWAAGVPGTVRGLGTAHAKWGKLPWRDLVAPAVKLAREGFPISDELAVALNRVGDRMADFPESVAAFGPDGQPWKGGDLLVQGDLASTLERIAAEGPDEFYTGRTADLIAAYMTENDGRISRKDLADYRAKERPPVRTTYRGHDVYSVGPASSGGVVLCQMLNILERYDLMADGPQSPR----TLHRVTEAMRRAYYTRTRLGDPDFVDVP--FADLASKAAADELARSIDDSRATPSAELAPPIVSTEPDHTTHFSVIDGEGGAVAMTYTLEDSYGAKAVVKGAGFLLNNEMGDFNLPGRTDDAGAIGTYPNQIAPGKRMLSSQCPTLVL-KDGKVRMVTGSPGGRTIPNTTLWVVLNVLEFGLEPQAAVDAPRTHHSWFPDVVALEGRWPQETLKALTDMGHKLR-TGGRQGNANSIVVDDGRIFGAPDRRR....... 572
241 0.000e+00UniRef50_A0A182AJL2 Gamma-glutamyltranspeptidase n=16 Tax=Cyanobacteria TaxID=1117 RepID=A0A182AJL2_9CYAN  ali  30  35QRSHPVWSPGGMVAVQEPRAAAAGVELLRQGGNAVDAAIGTAFALAVTHPQAGNLGGGGFLVLWLPGKGTAVAVNFRETAPAAARPDLFVGPDGATRSLLSTAVPGSVAGLVLAQRCYGRLPLQRVIAPAIALAEQGFPVSRSLAEDLRRARPRLEADPTPRALFLTADRP---GAVLRQPQLATTLRRIAAEGDRGFYAGPTAAALVGLMRREGGLITQSDLEGYRAQLVRPLAGRFRGATVL-VPPPPSSAITILQLLAVLEPMPLASLGANGAE----SLHRMAEAMNLAYRDRALLGDPDQVAIP--LARMLAPAYVAAMRSALDLERHRPPDQVQQEPPLPESEDTIHLSTADRQGGMVALTTTLNFPFGNGIAVPGAGFLLNNEMDDFTAQGSPNAFGLVQGATNAIAPGRRPLSSMSPTLVFHADGRPWFATGSPGGSRILTTVLQVLLNRIEHGLNLAGAVAAPRIHAQLLPDRFFFEEGLSPDTRRLLEAKGHQL-VRSPAMGAANSVEITADGTLGVVDPRKEGLAAG. 598
242 0.000e+00UniRef50_A0A0H4W876 Gamma-glutamyltranspeptidase n=57 Tax=Proteobacteria TaxID=1224 RepID=A0A0H4W876_9BORD  ali  29  42QAKSLVTARQYMITTANPLASQAGEAMLARGGSAVDAVIAAQLVLNLTEPQSSGIGGGAFMLHYDAGSHELVTYDSRETAPAAARPDRFLRDGKPVNNGRAVATPGLLRGLALAHADHGRLPWAELFAPAIALAEQGFAVSPRLHTLIKDSPQLAAQPAAAR-YFLDGGKPWPVGHVLRNPEFARLLRRIAQEGPDAFYQGQVARDIVAAVRGHPGDLSEADLAGYRAVRREPVCGRYRGYRLCGPPPPSSGPLAVLQILGQLEPYRL------SGAQSLRTVHYFAESGRLAFADRDYVADPQFVDVP--VAAMLDPAYLRKRAALIHPERALPGDPAGARDDAFEVPSTTHLVAVDAQGDVVSMTSTIESAFGSKIFV--HGFLLNNEMTDFSSSWRDPEGRLV---ANRIEAGKRPRSSMAPMIVF-RSGKPWLALGSPGGSAIINYVAKTLVGVIDGGLDIQAAIDLPNMGSRNR--ATELERGALQALAPGLRALGHEVKLVDFP-SGVQGIMLREGLLEGGADPRREGVALG. 581
243 0.000e+00UniRef50_A0A219B2L2 Gamma-glutamyltransferase n=3 Tax=Sphingomonadales TaxID=204457 RepID=A0A219B2L2_9SPHN  ali  31  57..........ALVSAAHPLAAEAGKEMLRQGGSAADAALATLVALTVVEPQSSGIGGGGFLIYHDAESGRTFALDGRETAPEAARPDMFVDENGSQVGGKSVGVPGNVRLMQKLHRRFGKLPWARLFDPAIRLAEEGWEVTPRLHEMLTRSQERASLTPWARATFFAANEPKPVGTRLTNPALANFLRHLQAEGPNAFYSGRPASLLVQAVQR----MTTADLSNYEAKWREPVCGDYRGYRVCGMPPPSSGGTTVLAILKQLERFDLAAMGPDSPK----SWHLIAESMRLAFADRKYVGDPDFVSVPT--AGLVADGYTTSRGQLIDPARAAESEAGTPPGAQPPDGGTSHFVAADRDGDVASLTSTIESVWGSGLTVN--GYFLNNELTDFSFLPTKDGRPV----ANAVAAGKRPRSSMAPTIVYAPSGEVAFAIGAAGGPTIIAQTAKAIIGVVDWDMSIDEAIDAPQLYAALGP--VVLEEGSEAAYADTLSEMGHQVATSSLPL-KANGLARRGRGWVGGADGRGEGAVRG. 590
244 0.000e+00UniRef50_M2U6A2 Gamma-glutamyltranspeptidase n=2 Tax=Sphingomonadaceae TaxID=41297 RepID=M2U6A2_9SPHN  ali  32  51..........AIVSAAHPLAAEAGEEMLRAGGSAADAAMATLLALTVVEPQSSGIGGGGFLMYHDGESGRIYALDGREYAPRAAMPDMFLGADGSQVGGMSVGIPGNVRLMEKAHRRFGKLPWARLFDPAIRLAEEGFEVTPRLHDMLTRSKDRAALTAWARAYFTAADQPKPVGTLIRNPAAARFLRRLQAEGPSSFYTGRSASSIVQAVVSHPQAMTTADISDYKAEWRDPVCGTYRSYRVCGMPPPSSGGTTVIAMLEQLERFDLAAMGPEDPQ----AWHLIAESMRLAFADRKYLGDPDFVSVPT--SGLIDKAYTRARSDLIDPQRAAEVEAGTPPGAPPPDGGTSHFVTADREGDVASLTSTIEAVFGSGLTVN--GYFLNNELTDFSFQPVVD--GLPA--ANAIAPRKRPRSSMSPTIVYAPSGEVAFAVGAAGGPTIIAQTAKAIIGVIDWGLSIDEAIELPQLYAALGP--VVLEEDTPLAGLEGLKAMGHDTSVSDLPL-KANGLQRIGRGWIGGADGRGEGAIAG. 584
245 0.000e+00UniRef50_A0A1W9SGE2 Gamma-glutamyltransferase n=2 Tax=unclassified candidate division KSB1 TaxID=1046950 RepID=A0A1W9SGE2_9BACT  ali  28  30.ETNDVIAEKAMVATAHPIASAVGIEILKEGGNAVDAAMAVAFALSIAEPNASGIGGGGFIVIKMANKKEAVMIDYRERAPERAVAEYYYDKSLTTVGPSAIGVPGLVAGAEISLKKYGTMTLAQILQPAIELCKNGIVVSEKLNEMILNNIEKISNYPATAEVYLKDMFPLEEGDTLRNLDLASSLVKLSGQGGDIFYKGELAKLMANEIQQLGGVLSYSDLKTYEAKVRKPVRGKYRGYDIITSAPPSWGGTHLIELLNIMEGYNVKKMEHNS----AKYIHVFTEAMKMIYADKANAADPDFYKVP--VKTFLKKRYAKKLRKRIEPNKAR-FDYKSKKRSSRESTSTSHLSIVDEHGNIVALTQSINHWFGSGVVVPGTGILLNDHMNDFND---------KPGTPNSIEPFKRPASNTAPTIIL-KNGKPFMTLGTPGGSRIISALAQVIMNVIDFEMSMDDAIEAPRVHC--INKVLHVEGRINEKVIDVLREMGHEVKVRSDYFGGAQGILFNTNKLHGGADSRRDGKAIGY 559
246 0.000e+00UniRef50_A0A0F7M0T7 Gamma-glutamyltranspeptidase n=4 Tax=Proteobacteria TaxID=1224 RepID=A0A0F7M0T7_9GAMM  ali  30  33ENKS-ASYKTAIAVTANPYASEAAKAILAQGGSAVDAAITAQLVLGLVEPQSSGIGGGAFMLHWDAQTQQLSSWNGRETAPIAVEESHFLNQHGAVIGGHAVGVPGVIAMLDAAHKEYGKLPWARLFQPAIDLAQTGFTLSPRLHTLLSKM-PKVAVNPEISQYFFNNGHAKPVGTLLKNPAYAESLALIAQEGASAFYRGALAKKIVAAVQSDPGKLQLTDLADYHAQRNEAVCTSFMAYQVCGVPPPSSGGTTVLAILGILQSLDIADKPSATP-------HAFIEASRLAFADRNYVGDPDFVPVPTL--GMVDHRYLKQRAALIG-TKAHQGSPGKPPGAQPELPSTSHFSIVDTQGNVVSMTTSIETAFGSRIMVG--GFLLNNQLTDFSFSPINDEG---EKVANRIQAGKRPRSSMSPTIVF-KDGQPVLAIGSPGGARIIDYVALSLYRILAQGDSLSNAISEGHIVA--MGEQVELERGFTPGSVTSLQQLGHRVKESDQ-TSGIHAVRITKDGLEGVADPRREGTIAGF 571
247 0.000e+00UniRef50_R4XDB8 Gamma-glutamyltranspeptidase n=2 Tax=Taphrinomycotina TaxID=451866 RepID=R4XDB8_TAPDE  ali  34  28...SNTTALHGAVSTEVLECSEIGTEIIRQGGNAADAMVAGVLCVGVMAPWHSGQGGGGFMLVRSP-NGTYETIDFRETAPGLANETMYVNNTLSLVGGLAVGTYGEPAGLEALHSRYGQLPWSDLFQPAINLARNGFRMLPEAYTVVSNAYSFALTDPSFAAIYAPNGTIRPINSTLYRPTYAQTLAEVAAKGSIAMYQGRIAEATIEAIQRAGGIMTLSDLANYSVVSRKPSSVPYHEY-TLYSCPAPASGTIALSAMNILSGYDVS-----TSSNLNVSTHLITEAMKFAYGQRTVLGDPAFDNVTALEAAFLTPRVAGQVRSKLDISSTGPATLYDPSFQVLDDHGTSEMVAATSDGLVISLTTTVNTYFGSQIMVPSTGVILNNEMNDFSSPGSSNTFGYVPTEANFVRPFKRPLSSISPTIV-ERNGSFYFTTGAAGGSRITSATIQVLWHVLDLNATSLQALAAPRLHDQIQPNQTTFEYAYDNRTTAYMSARGHNVTFVAPGVSIAMAIALPNGTYDAASDPRRGGSVV.. 561
248 0.000e+00UniRef50_A0A2E2MQT4 Gamma-glutamyltransferase n=1 Tax=Rhodospirillaceae bacterium TaxID=1898112 RepID=A0A2E2MQT4_9PROT  ali  31  39.......YRNHAVSVSHPLAARAALEILNEGGGAVDAAIAAQMVMTLVEPQSSGIGGGGFLIRFDGKTQSIETYDGRETAPASAQEDMFLDARGAILGGRAVGVPGVIRMLELAHREHGRLPWPRLFRAAIQLSLGGFPISDRLARQIAGDR-HLAKVPATKAYFFDGEAPKPAGTILKNPDLADTLDRIAEKGADAFYSGDLARAMADAVTNHPAVMTVADISSYQAKKRPAVCADFRGYKVCGMGPPSSGGLAVGQTLGLLDHLPLAGTTPDS----AQALHLIAEAERLAFADRAYVGDRDFVPVP--VEGMVDPGYLARRARLIDPMKAKDQAAYPGPQDPLKGLSTAHMSIVDRFGNAISFTTTVESAFGSRLMVR--GFLLNNQLTDFSFRPEWRG----KPAPNRVAPGKRPRSSMSPTIVLDKDGRFLMAVGSPGGSRIIGYTARAVLGVLAWGLDMQGAVDLP--HVMNRGGATEIEEPLIPA-IAALKDRGHQVQV-GRMVSGLQGILRTPAGLTGGADRRREGIVLG. 574
249 0.000e+00UniRef50_A0A1Z7YLM2 Gamma-glutamyltransferase n=1 Tax=Gammaproteobacteria bacterium 42_54_T18 TaxID=1856293 RepID=A0A1Z7YLM2_9GAMM  ali  29  36.........QASVASAHPLATQAGMDILAEGGNAFDAAIAVASVLGVVEPYSAGIGGGGFWLLHRAADGKEVMIDAREKAPLAATHDMYVNKDLAVNGPLSAGIPGQPAAFAHITNAYGTLPLNRTLKHAIHHADQGFQVDRVYLQLAAYREKVLSRFPESHSTLVTNN--LTTDTVITQKDLARTLNTLATKGKAGFYQGPLAQQLVNGVTEAGGIWQLDDLLQYNVIERQPITFTYNNNKIVSAPPPSSGGVALAEMFNMLEAMEYPSLDPLTQH------HVLVEVMRRAYRDRAHLGDSDFYPVP--VSQLIDPIYGQNLAKSINLSKATDSSSLGKSYGNHSGTHTTHLSVIDKHGNYVSATLSINLPFGSGFTVPGTGVLLNNEMDDFSAPGSPNAYGLVGSQANAIAPGKRPLSSMTPTFATVDNHKQVAILGTPGGSRIITMVFLGLLEAIE-GKTPEDWVSRHRFHHQYLPDAIQIEPNFSKFEKAQLQRLGHKLKPVGRRYGNMQAILWNTGKVSAASDPRGVGEA... 568
250 0.000e+00UniRef50_A0A1M7EVL4 Gamma-glutamyltransferase 1 Threonine peptidase. MEROPS family T03 n=3 Tax=Bacteria TaxID=2 RepID=A0A1M7EVL4_9GAMM  ali  27  87.......ADSFAVVAANPLAVDAGYQILKAGGNAIDAAVAVQMVLALVEPQSSGIGGGGFLLHFDGS--QVAAFDGRETAPAGVDETLFLDQQGAVTSGRSVGVPGTVKMLEKAHAEYGKLAWKTLFTPAITLARDGFKVSQRLHQSLASNEA-LPRNPAAKAYYTAEGEPLAVGETLTNPALAAILEDIAQRGSEAFYEGSIARDLADRVQAQPGTLTVDDLESYEIKEREPVCTPWQQWEVCGFPPPSSGHLTVMQILGMLDQKPMAEAPLDHGAPSSDWLHRFIEASRLAFADRNYIGDPAFVEAPGDWQTLLAPAYLERRAELMSPDKSLEVAPGQPGPPRQPEYGTSHISIVDADGGAVAMTTSIEQAFGSRIFADGGGYLLNNQLTDFSFTPEVDGKPV----ANRVQPGKRPRSSMSPTLIFENNGELVASLGSPGGAAIIPYVAQTLVALRDWGLNAQQALELP--HVVTLGGEVYVEKRLPDATADALRERGHTLNERDLTSGLGVIVRQQDGTLFGGADPRREGIVMG. 647
251 0.000e+00UniRef50_D8PSJ2 Uncharacterized protein n=2 Tax=Agaricales TaxID=5338 RepID=D8PSJ2_SCHCM  ali  36  6........SRGAIASENKVASAIGAQILREGGSAVDAAIATTLAVGTLCSDNSGIGGGGFALIRTPK-GDHESLNFRPAAPAAVTSKMYLDPGASAVGGLAVAVPGELRGFEAMHKKYGKLPWSHLFEPSIKLARNGFPLTEDMARVVNIKSSWVYSHPTLSQWLTRDGELLPIGTLLTRPSYANTLETIAREGAAAFYTGEIAHGIVDAVQAEGGVMTLEDLRAYEVRRVEPLSVQFRGHK-VTSVGAPASGAVVLAALNILNNFD----DVGGP-STVKDAHRMIESLKHAFAHRTLLGDPMFVPLDAAQREFISPERGRMLWAKINDAKVHAPSEYKAEGFQKMDNGTSHIVAADASGLVVSLTTTITLFWGSRIIVPSSGIVLNDSMEDFSVEGVSNFWGYLPTPANYIEGNKRPLSSTSPFIIEDAQGRFRYAGGAAGGSRIVSCNVQHIRNVLDYNMDPAEALAYPRLHDQIAPQETHLEEGWDREVAAELERLGHNVKWLPVAASTACGVSYNSDEWKAAGEPRR--KVAG. 550
252 0.000e+00UniRef50_A0A109FFG4 Gamma-glutamyltranspeptidase n=2 Tax=Basidiomycota TaxID=5204 RepID=A0A109FFG4_9BASI  ali  38  12RNPSYVSGSNGAVASEEQRCSDIGIDILRENGTAVDAAIATALCVGVVNSFSSGIGGGGFMVIRPPSTKAPISIDFRETAPSLARPDMFTANRASKVGGLSVAVPGELRGFEAAYQACGGVTWERIFRPAAELARE-FKVGKELHRRLNARWEWIKDDDAFSEVFMRGGKFLQEGDTVRREAYAWTLDKLGREGASAFYEGEIADAIVRAARTTGGILTHDDMKAYRAVVRPAEVATYRG-RKYYTGSYPSGGPILQHLLNVLEGYD----TFAEEGKTGLGVHRFVEALKFAFAARTNVGDPPFINNDAKLAEIPTRKYADAVRANITDDRTHKLSYYNPQFDILEDHGTTHLSVIDQWGGAVSLTTTVNLIFGSRVMDTKTGIILNDEMDDFSTPGLPDAFGLRPSPFNYPEGGKRPLSSTSPLIMDHPSSEVYLALGGSGGSRIFGAVAQTLLN-LDWGYDLANAVEQPRVHHQLLPAYVSIESTFRPDLVEALQSRGHNTTLFDINLGIVQACMRDNGRFFATSDSRKNG..... 585
253 0.000e+00UniRef50_UPI000A2A7288 gamma-glutamyltranspeptidase 1-like n=2 Tax=Exaiptasia pallida TaxID=1720309 RepID=UPI000A2A7288  ali  42  52.......YKRAVVAADNGTCSELGKDILKKNGSAVDAAITVMFCLGVLNMHSSGIGGGGFMLVYKKGSQKAEVIDFREEAPAAANETMF-NXTSSKLGPIASGVPGEVRGYRKAWERHGRLEWKDLVQPVIDLALKGIKLGKSTXKAMXXSXXAIKNSPGLSELFIKNNEFVSEGDMINMTKLAKTLEIIRDK-PDDFYTGKLAEQIVQDAQQNGGIITLEDMKNYTVKVRKAL-GNKLGDHQWYSVPPPGSGAVLGMILNILKGYNLKPEDRSDENKAILTQ-------------------EKFSDI---FEKMIDLNFAESTRQKINDNKTYNNASYYGGFFAEDSGSTTHASILAPNGDAVAITSTINLYFGSKFRSRVTGIIMNNQMDDFSTPGEKNFFGVPPSPANYIKPKKRPFSSSSPIVILNKNGAVRMATGASGGTTITTSTALAVINYLWFGRTLSQAVDDPRVHHQLIPMYVLRDAQFDPEIVDGLKRLGHTFSDKN-FTAVVQAVAKDDGLLYGKSDPRKGGHSAGF 560
254 0.000e+00UniRef50_A0A208XN40 Gamma-glutamyltransferase n=4 Tax=Proteobacteria TaxID=1224 RepID=A0A208XN40_9BURK  ali  31  41RSKQAVMGRHFMAVTAHPLATEAAYRVLDRGGSAVDAAIAAQMMLGLVEPQSSGLGGGAFMLYYDAARGRVTVFDGRETAPAAATADRFMQDARPVDSGKSVGVPGVLRALELAHERHGKLPWPSLFDDAIDRARRGFPVSPRLAALLRGNR-RLAAQPAARAYFFHDGSPRREGEVLRNPELARTLAQVARGGGDAFYRGPLAQAMVQAVRSHPGDLSGADLAGYAARERDALCRPYRVYVACGAPPPSSGGLAVLQMLALLDHTPIGAAEPVS----AAAVHYFSEAGRLAYADRRYVADPAFVDVP--VRALLDPAYLARRSALIAADRSMKAAPGEPVPDTPALPSTTHVSIVDADGNAVAMTSTIEQAFGSKLFVG--GFLLNNELTDFALSPV-DGRGVP--VANRVEGGKRPRSTMAPTIVLRADARLRLVVGSPGGSAIANYVAQTLVANLAWGLDIQSAIDLPHYGSRNR--ATELESGTSEGLVPALRAMGHPVALQPFP-SGLHGVEISNGLLRAGADPRREGTALG. 588
255 0.000e+00UniRef50_A0A1B0GEJ3 Gamma-glutamyl transpeptidase n=1 Tax=Glossina morsitans morsitans TaxID=37546 RepID=A0A1B0GEJ3_GLOMM  ali  38  576..........GAIVSNGLGCADIGHEMLCDGGTAIDAAIATLLCEGVIVPHGMGIGGGFLATVYT----RIETVIAREWAPAAAHKNMFTGR-SSVVGARAVAVPGEMLGYWELHQHYGSLPWKSLFQPTIKLCKEGHIVSKFLAAVIKSKEKEIRNEPSLAELFVKDNSLCKEGDFLARPTLAMTLERIADNGADEIYGG--GKRLIKDIQNMGGLITERDLMNYKVQFAKNVEADIIGGYKLYTTPLPSSGAVLVFILNVMSGL--------YTDNQDIYWHRVVEAYKHAYGQRTNLGDDDAKMIKNTFENLISVQFAEKIRSLIHDNVTSNMLYYGANFSTKEDHGTTNLAVLAPNGDAITITSTINNYFGAKIISPSTGIILNNEMDDFSTPGAVNSYGVLSSPANYIYPGKRPMSLTCPSIILDGEGNVRLLVGAAGGAKITTAVAQTIIKYLIFNEPLDRAVNDGRLHHQLSPMKVLVEANVPKSIVKYLKEIGHEIEMLNSEFSTLTAIGMRSGCVEPHCDNRRDGSAI.. 1099
256 0.000e+00UniRef50_A0A2A5G3P1 Gamma-glutamyltransferase n=3 Tax=Proteobacteria TaxID=1224 RepID=A0A2A5G3P1_9GAMM  ali  29  39................HPLATQAGIDILSQGGNAFDAAIAVTATLAVVEPYSSGIGGGGFYLLHQAKKNRYVMIDAREKAPLRAHKDLYLDPGASITGALSAGIPGIPAALVHLAEKYGRLKLSQSLAQAILHAREGFPVDEYYQRMAGFRLKALQQNQSASEIFLQDEKVPEKDYLIVQSDLANTLELIANSGMAGFYEGELAMKMVKDVRKNGGIWTIKDLATYDIKERSPEVTVYKGMKLIAASLPSSGGLVLSEILRMLAELNIEEMD------EVQRIHHIVETMRRAYRDRAYMGDPDFIEVP--VDYLISDFHIKLLAASISRHKATLSSSLKAVVQPTAGTDTTHFSILDKQGNKVSATLSVNYPFGSCFVAKGTGVLLNDEMDDFSKPGVPNVYGLVGSHANAIEPGKRMLSSMTPSIVETKDK--IAVIGTPGGSRIITMV---LLSILDFNKNAAEIVNAGRFHHQYLPDEISYEPGFDEAKVKALRALGHKVRELDSDYGNMHIIVMDKGEAQAASDARGIGSAM.. 560
257 0.000e+00UniRef50_G0RXX5 Gamma-glutamyltranspeptidase-like protein n=4 Tax=Sordariomycetes TaxID=147550 RepID=G0RXX5_CHATD  ali  36  42.......GSRGAVASESAICSKIGVDTIAIGGTAADAMVATTLCVGVIGMYHSGIGGGGFMLVRDAH-GRYESIDYRETAPAAASQDMYHDANASVFGGLAVAVPGELKGLAYLHQKYGVLPWRTLVMPAVRVARDGFPVTEDLVRYMKNNNTFLVDDPIWAEDFAPN-----------------------------------AESMIKFIQERNGIMTLQDLKDYSLEIREPLNITY-GPYRLYTTEAPSSGAVMFNILKTMDQYP-----PEDLTNINLTTHRFVEAMKFAYGARLELGDPDFLNMSDYQKYMLSDKTAKDTRGRIRDNETQPVDVYNPNTYTTDGHGTSHIVTADASGLTVTSTTTINLLFGAQIMTPDTGIILNNEMDDFSQPNRNNSFGFAPSQANFIAPRKRPLSSISPIIAEHNNGTVFFATGAAGGSRIISATVQVAWRLLSFSMSMHDAIAAPRVHHQLMPDVLKVETGFDKGVAEALKEKGHVVEWMEPGLSAVQGIMRWDGTFDAVGETR........ 532
258 0.000e+00UniRef50_D1Y4L9 Gamma-glutamyltransferase n=24 Tax=Bacteria TaxID=2 RepID=D1Y4L9_9BACT  ali  27  26...KDVYAEHGMVAAAHELAAKAGVEILQKGGNAIDAAVATALALNVVEFNASGIGGGGFMTFYSEKTKDVICLDYREQAPASATKDMFKKEKWSAYGGKSVGVPGWLKGMTYALENYGTMTFAQVAEPAIRLAEEGFVTDPAQKGFIQDHFETLNQFPGTLPFFDEVGLPIEGGTLLKQPALAKTFRLIAEKGIDVFYKGEIGEAICRAVERTGGKMTMEDLASYRMYVRKPVVGTYRGYRIYSVPPASSGGTHVVQLLNIMENYDVKNLGFKSAKK----VHVFGEATKMMFADRSYMADTAYAKVP--LAGLQSKEYAKEEAGRITDAIVDKPEAGDPWKYDTERFSTSSFSVADQFGNVVTSTNTINFFMGSSVFVPEYGFLINDEMDDFASN---------PESVNAPEPGKRPLSCMSPTIVLDPEGRPFMSIGSPGATRIITAVAQCIMNAVDHGMTMDEAIEAARFHNQ-SGNEMRTENRYDKALLDTLELMGYKISLQEPYTGGAQGIMFNDKFLNGGADSRRLGAAVGF 573
259 0.000e+00UniRef50_A0A2G5TLQ9 Uncharacterized protein n=38 Tax=Chromadorea TaxID=119089 RepID=A0A2G5TLQ9_9PELO  ali  37  101.....AHYKKAAVTSDHGLCSEIGRDVLIEGGNAVDAMIASLLCIGTVNPQSSGIGGGFVMTLYNASTGMCQTINARETAPAAATETMFVNPKESVMGYKSIATPSELHGFWTVFNLYGKVSWARLFQPSITLAHDGFPVSSNLAMVLADKEKYIREEATMKDIFVNTNRVYEEGDILKRQRLASTYALLANDPVELFYKGGMAQTIAGEITDNGGFVNESDLASYETLIDDALSTHLPGDYEMCGPPPPSSFVITQSIIQVMAQF--YKDGQVDLDD-PLVYHRLIEAEKFAYAQRTKLGDIKFVEARALVDDMMTEEHTKKIAALIKD-TAQPLDYYGGKKDMAPDHGTSHVSIIDSHGNAVSCTSTVNQILGSMRASPTLGIVWNDQMDDFSTPGQKNSFGYAPSETNFIVPGKRPMSSMSPMIIYNKNNRVEMVAGASGGSYIISSTAQTVIRTLLFNQTVKAAIDAPRFHNQYLPEATETEEAMPKALRDVLEQYKQNFTVVPRQKSVVQGLISIEGFVEGNSDFRRKTYPAGY 645
260 0.000e+00UniRef50_A0A0N7Z8Z9 Putative gamma-glutamyltransferase (Fragment) n=7 Tax=Panheteroptera TaxID=33351 RepID=A0A0N7Z8Z9_9HEMI  ali  37  36.........RGAVVSNGGPCSAIGNKILRKYGNAVDSIIATMLCDGVTTMNNMGIGGGFVATIYIKSERKAYSLNARETAPAASEIDMYRNQSLSRTGGLSVAIPGELKGYGEMYDRFGKAPWSELFQPTIELCKTGVPINKHVATNIATYAEKIKQSPTL--YFLPDGSLPTEGDLVKMPKLAETLSEIAESGPDALYNGDLSELLVEDIKTYGGIITSEDLANYNVRWEEPVTVPIMNGLIMYSVPEPSSGTILGYLLSLLDGFKLPKSGRQTSNYSAQDTFVITEAFKYAYALRSSLGDPHFHNISEVQSKINDPELKKLVRSKLNVNVTSDPNFYGAHYYD-EDHGTANIAVLAPNGDAVVATSTINLIFGSGLVSEKTGIILNDQMDDFSTPGEINYFGVPPSPSNFIYPGSRPQSSMCPSIFVNSSGEVKLAVGAAGGTRITTSTALIALRTLWYNISLVEAIKMHRFHHQLLPMTWFFEPGTDKALIDGMANRGHKTEQGNKIDSCVTGILIKNGVIEASSDLRRPGNV... 576
261 0.000e+00UniRef50_B6IP47 Gamma-glutamyltransferase n=35 Tax=Bacteria TaxID=2 RepID=B6IP47_RHOCS  ali  33  39.DKPLVRAGREMAVAANPLASEAGLEMLRRGGSAVDAAIAAQLVLGLVEPQSSGIGGGAFIVVARP-DGTVTTFDGRETAPAGTRPDRFVGPDGALDQGRAVGTPGAVAVLALAHGRFGRLPWKDLFDPAIRLAEDGFPTPLRLAEVLERWRPALEQREDLRRVYYHDGAPLTVGETFRNPDYAATLRLLAAEGPAAFYTGPLAGRIADRLAAARGVVTREDLAGYRAVERAAVCGPYRVWTVCGMAPPSSGGIAVLQILGMLEPFDLAGPGPDDPR----SWHLLVEAMRRAYADREYLADPDQVAVP--VRGLLDRGYLADRSAGIDPARAAKVPAGNPPWVNPDVPGTSHLSTVDADGMAVAMTTTVESAFGSGLMVG--GFVLNNQLTDFSFLPERDGRPV----ANAPGPGKRPLSSMSPTVVLDGKGRPVLTVGSPGGSAIIAYVAQAVVAMLDWKLDPQAALAQPRVVNRN--GATLVEA-VPQALADGLAALGHKVER-RPVISGLHAIRVTPDGLLGGADPRRDGLPKG. 585
262 0.000e+00UniRef50_A0A1H7K4G6 Gamma-glutamyltransferase 1 Threonine peptidase. MEROPS family T03 n=2 Tax=Xanthomonadales TaxID=135614 RepID=A0A1H7K4G6_9GAMM :_  ali  30  40..............SGHKLATEAGLQIIREGGNAFDAAVAVSSTLGVVEPISSGLGGGGFFLLHDAKTGKDVMLDAREYAPESASPDKYLDKDGSINGPWSAGIPGLPAALVELATKHGKLPLKQSLAPAIKIATEGFPVYDRMSKGYAQRASEMEKYPGTREVYLRNGKPIQTGDLFKQPELAHTLTLLAEKGRDGFYKGATAKKLLAGVKAAGGAWTAEELANYQVKERAPIEFDYKGWKITTVPPPSSGGIALAEMLQILEGYDLKNMDP------VHRTHLVVEAMRRAYRDRTFLGDPDFTTIPQKV--LLSKDYALGLRSTINPEKATPSDLLSGNPTPLEDDETTHFSIIDAEGNRVGATQTVNLLYGSGLIPKGTGVLLNDEMDDFAKPGTPNSFGVMGYEANAPKPGKRPLSSMSPTFMDSADKAV--VLGTPGGSRIITMVLLGILGY-DDGLTAQQVAALPRYHHQWLPDLIEAESGFDDATARGLAEMGHKLKLSSHVWGNLQTVEWDKNTLSGGSDPRNEGAA... 572
263 0.000e+00UniRef50_A0A267GH36 Uncharacterized protein (Fragment) n=16 Tax=Macrostomum lignano TaxID=282301 RepID=A0A267GH36_9PLAT  ali  40  83......IYQYNAVSSDSAVCSTIGDHVLNLGGNAMDAGVATVLCVGVSNFHSAGIGGGSFLVYYNRTSKTATAFDFRESAPAAAYRDMYLPSNASLYGGLAIGVPGEVAGLAAVHAAHGRLPWRSVVEPVSRVLREGQRVSRPLADAIATVYPRVPDFKVLKNWMVNTNKPYRAGELLVDHAMASTMDKIASD-PQSFYNGSLADDILQEVRAAGGNITKDDLMKYQTRRLTPLTATLSKGLTLYSLPPPSSGAVLSLILGIMDGYGDSAQARSTQDGYVKFLHRLVESFKFAYAKRSGLGDAAFVNVTELVANMTSSSYASELRSRITDDATHDVNYYGPMFEWKEDSGTTHVSLVDSDGNAVAVTSTINTYFGSLVRGEKTGIVYNNEMDDFSQPNRTNYYGLPPSPTNFIAANKRPMSSMAPMIVVNADGHVQFVSGASGGSRITTAIAYTLARQLYLNETVKAAVDSYRLHHQLLPNVLNYNPDPPESIKQRLRQKGHKVQPFSS-TSVVEGIQRLSGGLQANADFRKPSKTGGF 630
264 0.000e+00UniRef50_UPI000C760082 glutathione hydrolase 1 proenzyme-like isoform X1 n=3 Tax=Eurytemora affinis TaxID=88015 RepID=UPI000C760082  ali  36  160.......FKKAVVASDGSPCATVGSQLLEEGGTAVDAAVAALLCNGVYSSQSMGIGGGFLMTIYDAESGEVVSLNSRESAPAFSSKDMFSNSTLALKGPLAVAVPGEIDGYYQARERYGSISWRRILQPTIDMCRNGIPVSWSMANTISDFD---FTDPTLRSTFTNTGVPYKEGDMYKREALANTLDRLAAAGRDEFYQGEVGRLLVQDLQKLGGKLTMADMAAYSSVWSPTVQTVLKSNLTVHSAPPPGSGAVLGAILNIMDQFP-------DHQDDVLFYHRLTEAFKFAYGVRSSLGDPQDNEITDLVNSLTSEAWARSVYRKINDRQTYDLEYYGAEFSMVPDKGTAHLTVLAENGDAVSVTSTVNTNFGCELMSPSTGIIYNNEMNDFSFPFFSNDFNLPPSPSNYVKPGKRPQSSMCPAIILDNQGKVRLLIGGAGGTRITTGVAQTLASHIWLKKSIQESIDHPRLHHQLAPNQLEYQTEFNKDILAGLIEKGHQLKDRGTAGSILTAVHIENGGFLGVSDYRKAGGVDGY 695
265 0.000e+00UniRef50_G7G726 Gamma-glutamyltranspeptidase n=156 Tax=root TaxID=1 RepID=G7G726_9GAMM  ali  29  34...........AVAMPDSFSADAAKSILEQGGNAVDAAITAQFVLAVTLPEAGNIGGGGFMLI--QKDGKGDFIDYRETAPTAAHRDMYLDDNKSIYGIHASGVPGSVAGMWLAHQKHGTLKWETLVQPAVTLAEQGFVVPPKLAKGVSHYIAHLKEQKNFEKYFAD----VKANKVFKQPELAVTLKRIRDNGQDGFYKGETANIIAKFMHQHGGIINQDDLKNYTAKSRTPIKASWNGYEVLTSPPPSSGGIAILQWLKM---YELQKPDAGLAHNSTQYVHLLSEIGKRVFADRAYLGDPDFFDVP--VSALTNINYLKERSNGISLTAISTTESIKPGL--KESEQTTHFSIVDKMGNAVANTTTINLGFGSGVVVEGAGFILNDEMDDFSKPGVMNVFGAIGGKANEIQPHKRMLSSMTPTILL-KDNTVKMVTGSPGGTTIISSVYESILNAVEFDMTAEQVVNSPRFHHQLWPNIIRTHIGLTDSVKAELTKMGYTIDEN--HFGDLHVIINKEGQLDAASEASGRGKSIVF 557
266 0.000e+00UniRef50_T0RQS9 Gamma-glutamyltransferase n=5 Tax=Bacteriovoracales TaxID=2024979 RepID=T0RQS9_9PROT  ali  28  36REAHEAKGQKYMITTQGVYSSKAAKKMFDMGGSIADAAAAASFVLAVERPQSTGIGGGGFLMYYDAKKNKPWAYDFREKAPINAKQDMFLDKDGSIDGIYAAGVPGMVAGIVDFHHRFGKLPLNTVMAPAIELANKGFKVYPELAKALEFRAPILGRFSASKKIFFNKGEYLKEGDLLIQKDLATTLSKIAKYGANGFYKGDVANKIIAENQRLGGLLTKEDLQKYNVVVRRPVSSTYKDYEVFSMSPPSSGGVHVVEILNIIEKDNLKEYGPHHPK----TIHLVSSAMQASFVDRAYMGDADFVEVP--VMGLTSKKYAKDVRYTIPESRALDPFLYQKLSVKNEHDETTHFSIMDGEGNVVASTQTINGLFGSGVVVPGTGIVLNNEMDDFSAKGVQNLFGAVGSDKNLVEPEKRPLSSMSPTIVFKK-GEPLLALGTPNGTRILTCTALTILNFIEHELPLYESVNAVRYHHQWQPDEILVEKGLPEKTVKSLMRMEHQLK-FEDYGCRIQAVAKNGETLHGVSDIRGRGYAVG. 586
267 0.000e+00UniRef50_A0A165JP85 Gamma-glutamyltranspeptidase n=2 Tax=Agaricomycetes TaxID=155619 RepID=A0A165JP85_EXIGL  ali  39  17.....................................................GIGGGGFMTVRIPGDG-VYSIDFRETAPDAANKTMFKDPLSSLFGGLSVGVPGELRGLQEMHNRWGKLPWKTVVTPVAHLA-KGWFIGPELARRLVLFKEFMESDPDWIPTFAPKGTILKQGEWISRANLSRTLYTIAEQGADAFYSGAIAESLVAKIRETGGVMTLEDFANYRVHVDKAMEGSYRGKKIFTT-KAPTSGAVLIHILNLLEKYNLPEEGL-----TPLNLHRVVEALKFGFAARTRLGDPAFIDDHALIREIPTKEYAEHIAPNITDDTTHTFEYYKPVFDVPEDHGTMHLSVVDKDHMAVSVTSTVNLVFGSRVLDTNTGVILNDELDDFSRPGIPNYFGLWPSPYNYPEARKRPLSSTCPTIIENADGSLYAVLGGSGGSRIFPSVAQVIVG-LDVGRTISEAVEGPRAHDQLFPAVLDLDSTFPAEHVAALQERRHNVSVINGIKAVVQGIMVDDGVIWAAADSRKNGIAAGY 497
268 0.000e+00UniRef50_UPI0003F0DD30 gamma-glutamyltranspeptidase 1-like n=1 Tax=Saccoglossus kowalevskii TaxID=10224 RepID=UPI0003F0DD30  ali  36  111........SHGAVACDVEQCSNVGVEVLKKGGNAVDAAISTMLCLGVVNPQSSGLGGGGFMMVKTKTS--VDAFDFREVAPDAAQEDMFQNETLSVKGGLAVAVPGELKGIEMVWKKYGLLKWGELFEPAINLATDGFTVTEATESSIDDTFDEL--SPELKALLAPNGKKLKAGQTLTRPTLAATLQIVATSGASAFYDSVLSDNIVNSVTSTGGILTRQDLRNYAAIERLPVETKYHDY-TVYSHPAPAGGPVFLSIINILENYNFTSADSNDP----LTYHRIIEAFKFAYSQKLQLGDPDKVEVNDVQDIMISKEAALFIKQKILDNSTFNASHYGPYFPDI-GQGTASVTVIDKDDNMVALTTSINYKFGSKIMTSD-GIILNNHMADFTWPEKQNDTMLANTTANYIEGSKRPQSSATPTIIYHETKNPRVVMAANNGSRIITAIAEVFLNVFSFGEHISDAIEEPRFHHGLVPNEVEVENGVSDDIIAGLESRGHDVVQVD-FLNQVMAVMKHQDMLTAHADSRKPGS.... 634
269 0.000e+00UniRef50_A0A2T9XZ40 Uncharacterized protein n=1 Tax=Smittium simulii TaxID=133385 RepID=A0A2T9XZ40_9FUNG  ali  41  121.DSQQVFGSKGAVAADEKRCSVIGLNVLKDGGSAVDAGIATGICLGLLNGYASGIGGGGFMLVRLP-DGKSELIDFREQAPEKATELMYKNNTQATVGGLAIGVPGELRGYELAHKIHGRLPWKRLIEPTIRLARDGFAIGKMLAYNLKRYDYIVNSTVGFKDVFLPDGSVKKEGDMAKRINFANTLQRVADEGANAFYASDLSEIMASWIQKTGGIITAQDFCNYTPKIRKAAVFDYHGRKIITGSPP-TSGTIVGFTFNIIEGYDFK-----DKAKKPTNIHRFVEALKFAFSQRTRIADPDFSNVTETFENQLSKSFAEATRKNITDDTTHPFEYYNPEYD-LEDNGTTHVSVIDKDGMAVSLTSTINLTFGSKVMDPSTGVIFNNEMDDFSTPG------------------------------------------ASGGSKIITSTAQVLLNVLEFGKNLKEAIDDSRLHHQLLPNVLSVEPNYSKEMRDIFVAKGHEVKEMSFGESVVQGIRIENGIIHAVSDGRKYGVPAAY 611