current user: public

If you have questions about the server, please let us know.

Query: sp|P59091|CU093_HUMAN Uncharacterized protein C21orf93 OS=Homo sapiens GN=C21orf93 PE=5 SV=1, from H.sapiens

Results of PSI-BLAST search in nr85s
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .
# E-value Template Links and tools%idFirst MDSLTERCRPQPLAALGPADAQLHGPAAAGGGVGPRVMLSSLCREHPWQGRCPPIPAHGKEVRQLRHLHRTRPPDTHQDMARGPGLPHTHGLPARPSHVRHQTEPVQVASRWHVPSDGLCRPCHVHQLLHPPLVPALGALast
1 7.000e-68UniRef50_P59091 Putative uncharacterized protein encoded by LINC00315 n=1 Tax=Homo sapiens TaxID=9606 RepID=CU093_HUMAN  ali  100  1MDSLTERCRPQPLAALGPADAQLHGPAAAGGGVGPRVMLSSLCREHPWQGRCPPIPAHGKEVRQLRHLHRTRPPDTHQDMARGPGLPHTHGLPARPSHVRHQTEPVQVASRWHVPSDGLCRPCHVHQLLHPPLVPALGA 139
2 1.000e-62UniRef50_UPI00083BAFE6 LOW QUALITY PROTEIN: putative uncharacterized protein encoded by LINC00315 n=1 Tax=Rhinopithecus bieti TaxID=61621 RepID=UPI00  ali  81  1MDSLMERCRPQPLAALGPADAELCGPDAAVGGVGPRVMLSSLCREHPRQRRC---XTHGKEVRWLQHLHRTCPPDTHQGAARGPGLPHAPGLPARPSHGRHQTEPVQAAFRWRVPSDGLCHPCPVQQLLHPPLVPALGA 139
3 3.000e-28UniRef50_H2P3G2 Uncharacterized protein n=1 Tax=Pongo abelii TaxID=9601 RepID=H2P3G2_PONAB  ali  91  1.....................................................................RTRPPDTHQDMAQGPGLPHTPGLPACPSHVRHQTELVQVASRWHVPSDGLCHPCHVHQLLCPPLVPALGA 70

FFAS is supported by the NIH grant R01-GM087218-01
1 4 0 1 8 2   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Li W, Wooley JC, Godzik A. Probing metagenomics by rapid cluster analysis of very large datasets. PLoS ONE. 2008;3(10):e3375. Epub 2008 Oct 10.