current user: public

If you have questions about the server, please let us know.

Query: sp|Q5VV42|CDKAL_HUMAN CDK5 regulatory subunit-associated protein 1-like 1 OS=Homo sapiens GN=CDKAL1 PE=1 SV=1, from H.sapiens

Results of PSI-BLAST search in nr85s
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380    .  390    .  400    .  410    .  420    .  430    .  440    .  450    .  460    .  470    .  480    .  490    .  500    .  510    .  520    .  530    .  540    .  550    .  560    .  570    .
# E-value Template Links and tools%idFirst MPSASCDTLLDDIEDIVSQEDSKPQDRHFVRKDVVPKVRRRNTQKYLQEEENSPPSDSTIPGIQKIWIRTWGCSHNNSDGEYMAGQLAAYGYKITENASDADLWLLNSCTVKNPAEDHFRNSIKKAQEENKKIVLAGCVPQAQPRQDYLKGLSIIGVQQIDRVVEVVEETIKGHSVRLLGQKKDNGRRLGGARLDLPKIRKNPLIEIISINTGCLNACTYCKTKHARGNLASYPIDELVDRAKQSFQEGVCEIWLTSEDTGAYGRDIGTNLPTLLWKLVEVIPEGAMLRLGMTNPPYILEHLEEMAKILNHPRVYAFLHIPVQSASDSVLMEMKREYCVADFKRVVDFLKEKVPGITIATDIICGFPGETDQDFQETVKLVEEYKFPSLFINQFYPRPGTPAAKMEQVPAQVKKQRTKDLSRVFHSYSPYDHKIGERQQVLVTEESFDSKFYVAHNQFYEQVLVPKNPAFMGKMVEVDIYESGKHFMKGQPVSDAKVYTPSISKPLAKGEVSGLTKDFRNGLGNQLSSGSHTSAASQCDSASSRMVLPMPRLHQDCALRMSVGLALLGLLFAFFVKVYNLast
1 0.000e+00UniRef50_A0A1F8JRR0 tRNA-2-methylthio-N(6)-dimethylallyladenosine synthase n=1 Tax=Chlamydiae bacterium RIFCSPLOWO2_01_FULL_28_7 TaxID=1797606 RepID=  ali  26  1...........................................................MKEIKTFFIKTYGCQMNELDSEILSTQLENKDLTQVQDESSADIVILNTCSVRDMAEQKVFGQLYKLKENNKIVGIAGCMAVSKKQELIPFVDFLIGTNNLLDISQTIDNILTKNQKIYKTSKFHETG-----LEDILINRQNKLKASVSIIRGCNNYCSYCIVPFTRGKEVSRSKESIIKEVKILAKNGYKEITLLGQNVNSYGNDFKTSFPDLLYNL-NKIDGIERIRFMTSHPKDISIDLM--HAIRDLEKICEFVHFPIQSGSNRILKKMQRSYLKEEYLEKVFKLKEIVPKATIGTDIIVGFPTETEEEFLETHDVFKLVNYDTAFIFAYSPREKTPAIKWDDINKDLKLERLQKLLNLYKSLEKYQTLINSFTEVLVESFNAEQRILKGRNRRFEKVIFKGDISLVNTLQNVKIIGFKHQTLIGEKI....................................................................................... 434
2 0.000e+00UniRef50_R5V5B2 RNA modification enzyme MiaB family n=1 Tax=Firmicutes bacterium CAG:631 TaxID=1262996 RepID=R5V5B2_9FIRM  ali  25  1..............................................................MSQFFIYALGCKVNTYELESIKESLIALGLQQTFDVTQADYILLNTCCVTNTAQSKSRQKISSFQKANPILIVMGCYAQGFEKEVQEHVQLLVGTKNRHQIVDYISKLEKESQISLV----EDVLNYHVYENLKVSHYSENTRAFLKIQDGCNNFCSYCIIPYVRGPIKSRDVKDVLEEAKTLLKNGYKEIVLTGIHTGSYGKDLNDNFSDLVEKLL-QLDGLYRLRISSIEESEIDDKLIYLLK--TSPILAKHLHIPLQAGSDAILKLMNRKYDAQTYLQKIQKIQHEIPQIAISTDVIVGFPNETEDDFLKSVEMCKTIGFSKIHVFPYSSRNQTPAAKMKQIHGSIKKERVKTLTALSDTLRYNQQFVNQEVEMLVETIDQD--IAYGHTSIYVQCKIDTKKVFKNDIIKVRLIQIHQDHMIA.......................................................................................... 428
3 0.000e+00UniRef50_T0C6Q7 Ribosomal protein S12 methylthiotransferase RimO n=12 Tax=Oligoflexia TaxID=1553900 RepID=T0C6Q7_9PROT  ali  24  15...............................................................RTVYFTSLGCSKNLVDAQVMLGHMGLNGFNVVTEPQDSEVIVVNTCSFIEAAKQESIEMILDLADYKKALVVSGCMAQRYSDELLPEVDMFIGTGEYNKIVPLLTALENNK----LEKKSFVEVPRFIHTEFDPRLNTSPFTAWLKISEGCNRNCTFCIIPTLRGRLRSRTVESLVEEAKKLSETGVRELNLISQDLSDYGVDLENNLFELLSGL-ETVDGVDWVRLFYFYPDELTDEVIE--KMATSSKVCKYLDMPVQHFSDYVLKRMNRKITGEKIMERITKLRERIPGIVLRTSIIVGFPGESEEDFEKLLEGIKQARFNHLGIFRYSDEEGTPAYRLKDKSQEVIDERFDRLYEVQKEIARNQEFLGQTVEVLVEGTHEDTDLLVGRPDIDGKVIINDRDLKIGDLVKIEITDVLDFDLVGRVI....................................................................................... 461
4 0.000e+00UniRef50_A0A1F6GQX8 tRNA-2-methylthio-N(6)-dimethylallyladenosine synthase n=2 Tax=Candidatus Lambdaproteobacteria TaxID=1817794 RepID=A0A1F6GQX8_9PR  ali  24  1..............................................................MKKAYIQTFGCQMNEHDSRRMRHLLDQEGFEPALTPEEAELVVLNTCSVREKPEHKVYSLVGRLAQLKAKIAVAGCVAQQEGKKILKAVDLVFGPDQLFNLPQMLADVKAGKRGVYTEAEREKKVQNFIPEEELAAGEVEGGQGMVVITKGCDNHCSFCIVPRTRGALASREPENILAEAADLIEKGAKEILLLGQNVNSYQV-GNTGFLELLKE-VAELPGLKRLRFMSPHPNDWNLALTEL--MAQKKVLAKALHLPFQAGSDRILAEMRRDHTKAQYLEKLAQLRERIPNLQLTTDVIVGYPTETEAEFGETLAVIEAGRFFQIYGFMYSPRPGTKATKLDDIPLEVKEKRLQQVIALQGRIQNEDEHLGQDFELLIDSAHPDQGTMQGRTEGGVRVSVADPDLEIGDLVQVQVTERRDHSLVGV......................................................................................... 437
5 0.000e+00UniRef50_A0Q0P6 Ribosomal protein S12 methylthiotransferase RimO n=211 Tax=Firmicutes TaxID=1239 RepID=RIMO_CLONN  ali  25  1............................................................MNRYKIGLISLGCDKNRIDSELLLGKLNEKN-DIVNDPNKADIIIVNTCGFIESSKQESIDTILEMAKYKKMIIATGCLTQRYSKELIPEIDIMLGVNDYANIQNYIDDFFNEHNKICQCKYSDISINEGKRILT-----TAKHMAYIRISEGCNNLCTYCIIPKIRGKYRSRSIESIINEAKELANMGVKELILVGQDTAIYGSDLYKRLSQLLREL-SNIEDIEWIRILYTYPEEITDELIE--EIKNNDKVCKYLDIPIQHISNTVLKRMNRKSSKELITDNIKKMRKEIDGLCLRTSIIVGFPGETEDEFNELKEFVEEIKFDNLGVFKYSQEEDTAAARMDQVSEDLKEERLATIMSIQQNVSINKNKLEKVYKVLVEGQNDK--YYIGRNEIDGAIFFKCDKILVGEFVYVKITDTLEYDLIGVVCDES.................................................................................... 442
6 0.000e+00UniRef50_A0A1Z8ZW87 tRNA-2-methylthio-N(6)-dimethylallyladenosine synthase n=15 Tax=Verrucomicrobia TaxID=74201 RepID=A0A1Z8ZW87_9BACT  ali  27  1..........................................................................MNERDSEQVAQTFSERGYTLTPTEHDADAILINTCSVRDQAEQKALGMMGKYRDQRAHVVFMGCMAQSRGEELFPHLDLVVGTQKYHRVFDYVDSILNRRVISARVVDTEEEVGSQNTIRDHIPRESRRATAFVSIMQGCNMRCSFCIVPDTRGKERGRPISDIAEEVKRLVGEGVREVTLLGQIVNLYGRDGKSPFVQLLEE-VHEIGGLDRIRFTSPHPIGYRDDLVEAFTY--LPKLCSHIHFPMQSGSDRILKAMRRPYKNEKFLTICDKMKAARPDLAITTDIIVGFPTETEEDFQDTIDCVQHVGFDNSFIFRYSKRKDTPAAEMDQLTESVKEERNQRLLKVQDEITRAKKLIGTTQTILCEGPSKTNERLSGRTSQNKIVIFDGDAERMGEILDVKIEDSTGFTLYGTP........................................................................................ 461
7 0.000e+00UniRef50_Q1MQ52 tRNA-2-methylthio-N(6)-dimethylallyladenosine synthase n=2 Tax=Desulfovibrionales TaxID=213115 RepID=MIAB_LAWIP  ali  25  1............................................................MLQRNFHIITFGCQMNTNDSFWLSCSLQKKGFQEV-SLEDASIIIINTCSVREKPEQKVYSKIRHATKNNPDVVIAGCVAQQLGAEKFPQVRLVSGSDGIAMAPDAIERLYAEPDLKLNLTDFSEYYPEREYAFSKLTLSNNNTMAYVNIMQGCDNYCTYCIVPYTRGKQKSRSVQAIVEECQQLIDSGVKEIVLLGQNVNAYGLDNGVNFAMLVHTIAS-LPGLERLRFFSAHPKEFSSELIDLFGEFST--LCPRLHLPLQSGSDKILRRMGRKYSMDEYISIITKLKKVRPDIALSTDFIVGFPGETEEDFLQTLQSINTIKFMSSFSFCYSDRPGTRSSTFNKVDHEVKIKRLEQLQATQLEHSWLKSRVGVETTVLLEKVSRKNNSWQGRDPNVVNVILPQSTNISNTLLPVRIIASKKHSLVAEPL....................................................................................... 455
8 0.000e+00UniRef50_A0A1Y5F9D7 Ribosomal protein S12 methylthiotransferase RimO n=1 Tax=Halobacteriovorax marinus TaxID=97084 RepID=A0A1Y5F9D7_9PROT  ali  25  1.......................................................MQTTKFENRTVFFTSLGCSKNLVDSQVMLGYMGLDGFEIVPEPKEAEVIIVNTCSFIEAAKQESIEMILDLADYKKALVVSGCMAQRYSDELLPEVDMFIGTGEYNKITKLLRALEDGK----LESKSFVEIPKFIHTEFDPRLNTSPFTAWLKISEGCNRNCTFCIIPTLRGRLRSRTVASLIAEAKKLAEGGVRELNLISQDLSDYGVDLEDNLFELLSGL-EAVEGVDWIRLFYFYPDELTDEVIE--KIAGSKKICNYLDMPVQHFSNHVLRRMNRKITGDRIMNRIERLREKSPGIVLRTSIIVGFPGESEEDFQELLSGVQQAKFNHLGIFRYSDEEGTPAYKLDKVDQETIDDRFDQLFETQREIVRELNQVGKVIDVLIEGQHEETELLIGRPDIDGKVIINESDIEEGDLVKVEITEVLDYDLVGRVVT...................................................................................... 456
9 0.000e+00UniRef50_A0A1V4MMI8 Uncharacterized protein n=1 Tax=delta proteobacterium ML8_D TaxID=1775672 RepID=A0A1V4MMI8_9DELT  ali  25  1...............................................................MRVALYTLGCKVNQFETAALAEDFISKGANIVPYTQEADIYVVNTCTVTSRAACQSRQMLRRVRRSRKKVIATGCYVQTGAQEILDAVPGLVGNDQKAHLVDLAFELEDG-----LEFYVGNISRVTAIAPFTIKRPWGRTRAFVRIQDGCNSFCTYCIVPYARGRSRSLSPELVERQIDILVQEGIKEVVLTGIHIGIYGEDLKTSLLCLLKRLCSAFPQL-RFRLSSIEPSEITPDMISWAMSA--PNFCPHWHISLQSGSDKILKLMNRRYTSSLFRGLIMQLRTAMPEAAIGSDVLVGFPGEDDPAFQKTLELISELPITYVHAFPFSPRPGTIAAEMKNVSKKEKAKRGQAIRDLGNKKAFYRLHVEKILECLMEGRDKETGLWKGLTPNYIPVLVETGTDLKNQILPVRITKAEKGMVFGTLL....................................................................................... 434
10 0.000e+00UniRef50_A0A1V5JZP3 tRNA-2-methylthio-N(6)-dimethylallyladenosine synthase n=1 Tax=Candidatus Aminicenantes bacterium ADurb.Bin508 TaxID=1852832 RepI  ali  26  1..........................................................................MNVNDSEKMAGLLESRGWTQVYAERSASLFIVNTCAVREKAQEKLFSYLGRLKRYKETIVVAGCVSQLLKEEIAPFVDLLLGTNAYPRLLEYLDQREE-----------SDFRLSRHWNEVTSLHRRSSFSAFLSIMEGCDNFCSYCVVPFTRGREKSRPLSLILRELDELSAQGYKEVVLLGQNVDAYLDEKGGGFADLL-EVVAQRSGASWIRFLTSHPSKFSLRIAEV--MARNDKICRALHLPFQAGSDRILSLMNRGYSKAEYLSLVKAIKERVPDIAMAADIIVGFPTEREEDFLETMEIVEEVRFENIFSFLYSPRPGTKSSKMDDVPPSVKGERLIRLQERQKEIQLEENRIGSVQRVLLEERNKDPSQTVGRTAGGRVVNILGP-CETGQFADILIDGAGPHNLKGRI........................................................................................ 415
11 0.000e+00UniRef50_A0A2E1I0Z9 tRNA-2-methylthio-N(6)-dimethylallyladenosine synthase n=4 Tax=Bacteria TaxID=2 RepID=A0A2E1I0Z9_9FLAO  ali  25  1............................................................MHSKSFFVKSYGCQMNVYDSEKITSILENKGMTEKQEINNADVVIFNTCNIRDKAAHKVYSDIGRVTKKNKTIAVVGCVAQAENSEMFNKIDIVLGPQSYHLLPQMINDSEKHKENLINTDFIINEKFDYIKEE----KKSKGVSSAITIQEGCDKFCSFCVVPFTRGPEYSRHFNDIKLEAESVSARGASEIVLLGQNVNAYNYSYKGKNHHLLINLISEINEIKRIRYTTSHPINMSEELIKLHS--ENKKLMPFLHLPVQSGSDKILKKMNRKYSSYDYRRIIEKLKKSNPNIEISSDFIIGYPGETEKDFDETLKLVEEIKFTQSYSFIYSERPGTKASEEDEISLKVKKERLSILQQKLKDIQYNKSFYDKSVKVLVENQSSNPKYFFGRTPFMQSVYLESDSVKIGQEMDVKITSCNHKSLYG.......................................................................................... 434
12 0.000e+00UniRef50_A0A2H0T745 tRNA (N6-isopentenyl adenosine(37)-C2)-methylthiotransferase MiaB n=1 Tax=Parcubacteria group bacterium CG10_big_fil_rev_8_21_14_  ali  22  1...........................................................MPKDTKYYIATYGCQMNKSDSERIEALLESSGFKRASKAEDADLILLNTCSVRQTAEDRIYGALSKLKRKKPHLGVTGCMAGRDKNGIIRKIDLFFEINDLAKLPEMISKKWKNKVK-------NTQKPYSSNYLSIAPKPAEWWRGSVVIQTGCSKYCTYCVVPYARGTEKNRSVNAILKEARALVKKGAKEIILLGQAVNS-----HPKFAEILKEI-NQLEGVNRISFASAHPMHMTPEIIKALA---LPKMVNYLHLPLQSGNNDILRRMNRNYTCEKYIKIIERVRKARPNIALATDIIVGFSGETRKQFQDTVSLYKKCDFDLSYNAMYSPRTGTSAYRRDDVSREEKRRRWRILQELMEKLRKNKKYFGKIVEVLVDG--CRAGKCYGLSREYKRVVFKGDKFLIGKILNVKINKTKEWELEGEL........................................................................................ 438
13 0.000e+00UniRef50_B2A3C0 Ribosomal protein S12 methylthiotransferase RimO n=11 Tax=Firmicutes TaxID=1239 RepID=RIMO_NATTJ  ali  26  1...............................................................MKVGIISLGCAKNQVDTEVMQGILENSNYKMTDDYYDADIIIVNTCGFIDDAKEESVDHILEVAQLKKVLIVAGCLSQRYQEEEIPEIDAMIGTDTQDKITEVISSALKGNYISFYDRLNKIDEQLFLRQPYQP-----GPSAYIKIAEGCHNYCSYCAIPLIRGGYRSRTIEDIKIEANHFIEKGSKELTLIAQDTTNYGSDIYGKFSTLLDEL-ATIPGDFWIRVLYAYPTRITDSLIEV--INRHEKICSYLDIPLQHIDDDILTSMNRGGNKEQILNLIHNLRKNIPDITLRTSLIVGFPGETDEKYQNLISFMQEIEFDHAGIFKYSDEEDTQAYNFDKVSEDVKEQRYQEAWEVQKEITRKKNLVGTEMRVLIEEAEDEPTTKVGRTEGDGAVIIPDCEASSGDFINVEIVQALDYDLIGEMTNE..................................................................................... 442
14 0.000e+00UniRef50_T0SVW8 Ribosomal protein S12 methylthiotransferase RimO n=4 Tax=Oligoflexia TaxID=1553900 RepID=T0SVW8_9PROT  ali  25  15...............................................................RTVFFTSLGCSKNLVDAQVMLGHMGLNGFQVVFEPNEAEVIVVNTCSFIEAAKQESVDTILELADYKKALVVSGCMAQRYAKELLPEVDMFIGTGEYHKIVPLLKALEENK----LEKKSFVEIPRFIHTEFDPRMNTSPFTAWLKISEGCNRNCTFCIIPTLRGRLRSRTVESLVKEAQTLSETGVRELNLISQDLSDYGVDLDENLFNLLSGL-ETVEGVDWVRLFYFYPDELTDEVIE--KMATSSKVCKYLDMPVQHFSDYVLKRMNRKITGEKIMERIQKIRSRIPGIVLRTSIIVGFPGESEADFEKLLEGIKEARFNHLGIFRYSDEEGTPAFRLEKVDQATIDERFDRLFEVQKEIARNEEFLGQTIDVLVEGTHEDTDLLVGRPDIDGKVIINGDVELKGDLVKVEITDVLDFDLVGKVVT...................................................................................... 462
15 0.000e+00UniRef50_A0A2D7PJJ4 tRNA-2-methylthio-N(6)-dimethylallyladenosine synthase n=4 Tax=Bacteria TaxID=2 RepID=A0A2D7PJJ4_9DELT  ali  25  1..........................................................................MNVHDSEKLANLLHHAGLDRARDESSAGLLIINTCSIRDKAENQLYSDLGKLRQPGRLIGVGGCVAQQVGDRLFPHLDFVFGTHNLKLVPAMVSGARSGQRAVEVGESRSV-DRFDLPMAPRPVGEAARCKAFVTVMEGCDMFCSFCIVPATRGREISRPASGILEEVRRLADEGVREVTLLGQTVNAYGRDVKRGFAELLAELDH-ITGIERIRYTSPHPLFFDRALVQ--AHASLKSLCPHVHLPVQSGSDRILDAMRRRYRRESYMEIAHSLRSAVPGITLTSDLIVGFPGETEEDFEQTLDLMQTVGFEDSYSFIYSPRPGTGAAEMPGLDRAEGRRRLDALQGLQRRLTYHRRRVGSSTRVLVEGPSRHGGQVCGRDPHHRVVNLVSGEIKPGDLVEVEIVEATPHSLLGEAV....................................................................................... 442
16 0.000e+00UniRef50_A0A1V5TEK9 Threonylcarbamoyladenosine tRNA methylthiotransferase MtaB n=1 Tax=Firmicutes bacterium ADurb.Bin262 TaxID=1852887 RepID=A0A1V5TE  ali  25  1...............................................................MKAAFYTLGCKVNRVDSGAMGAALEKAGYEIVGPNIEADVYVINSCTVTAESDRKTRQAVRRFRRPGAVIVLAGCLPQAFPDKAAEGADIVTGNKNAAQLPGLIERFLTDRQTLSAVTPHAAGEAFGA---SGGSFEGGRTRAVVKIEDGCDRYCAYCILPYVRGPVRSRSLQSLREELAALEAAGYPEVVLTGINLAAFGRDTGSSLLEA-AALACSHEGFKRIRLGSLEPDLLTDEMIE--QLSKLPKLCPHFHISLQSGCGRILKAMNRRYTPDEFEAAVNLIRGAFPGAAITTDIIAGFPGETQADFEESLAFVQKIAFEKVHIFPFSARPGTAAARLPGVDRGTIQKRCRQLNAAAQEIRFLRRQTGKTVEVLLEQKGPD-GLWIGYTSNYTPVAVSGTGLRRAMIVSARVTRADETRCLAEV........................................................................................ 427
17 0.000e+00UniRef50_A0A2H0PPD6 tRNA-2-methylthio-N(6)-dimethylallyladenosine synthase n=1 Tax=Deltaproteobacteria bacterium CG11_big_fil_rev_8_21_14_0_20_45_16  ali  25  1..............................................................MKKVFIQTYGCQMNEYDSQQMLQVLSAKGFEKTTRPEEAQLLLINSCAVREKSEVKALSFLGRIAKLKKVIGFGGCVGQTEGPKLLKFLDFAFGTNNYRELPQMIEDFEH--------RWADTSADDERDTLLPSFRPDSKSQAFITITNGCDKFCSYCIVPFTRGRELSRMPEEIVAEAEILVQRGVSEIMLLGQNVNSYGKNRYTKLHELLESEGGKLSGLKRLRYTTSHPRDFDEDLARDFR--DLEILCEYLHLPFQAGSDAVLKRMRRFYRIDSYLRKLEKLREYSPDIALSTDIIVGFPGETREDFQKTLDVLRQVEFDNAYYFKYSARPYTRSEQMDDVSPEEKTERIQALKELQRSISRKKYRIGRKVEIMLEGPSRKSHLWTGRTRGNRLVHLPKEDTFAGDILWAEILDATHCWLDGRRLDLPRA.................................................................................. 447
18 0.000e+00UniRef50_A0A1W9P954 tRNA (N6-isopentenyl adenosine(37)-C2)-methylthiotransferase MiaB n=1 Tax=Candidatus Cloacimonas sp. 4484_209 TaxID=1968525 RepID  ali  25  1..............................................................MKKYYIITYGCQMNVYDSHLMEYLLEKDGFKKTDDIKKADAIIVNTCAVREHAVERAISRLKSLKKPNLRIGLTGCIPQHKKEEIIPFVDFIIGPDKYKNIVSTVSGT----------NGTFLGFNDTEIYSDLIPARGNFPEAFVSAMRGCNNFCSYCVVPYTRGKERSRNIADILTEIKKLADTGYKRVILLGQNVNN-YNYNGNRLPHLLSK-VAAIDGIQRIGFLTSHPAYFPIEVIDI--MKEEKKIEKYLHLPVQSGSTRILKLMKRGYTKEEYLNLINSIRNKIPDIALSTDIIVGYPTEKERDFLETLELIKSVRFDFAYMFKYSVREMTLASIFDDVTDEIKQKRLKKLIQIQNDITKQKSFKNKIFDVLIVEKNKKNSLESGITVYNKRVIVKGEFNK-GELVPVKINDIQGWTPIG.......................................................................................... 424
19 0.000e+00UniRef50_A0A1G1LJP0 tRNA (N(6)-L-threonylcarbamoyladenosine(37)-C(2))-methylthiotransferase MtaB n=3 Tax=unclassified Candidatus Omnitrophica TaxID=1  ali  25  19...............................................................KTVKFSTLGCRLNQYETQAIREQFLRGGYEETGDAQDADVFVLNTCSVTSESDRQSRYLIRRFHRSKPKVVVTGCYAERNREEIIPGVTLTVLNREKSELYDLFER----HGRDPSCLRRAEPAPRRRFAPLQISHFEGRSRAYVKVQDGCNHACSFCKVVLARGPSRSRPVEKVVEEARRLVDDGYLEVVLTGIQLGAYGYDLRKRLVDLLG-LLPQIPGLERIRLSSIEPTDVTDELI--SSMASNPKVCPHLHIPLQSGADQVLERMNRRYRRSAYTDLIHQLRGSINNFVLTTDVMIGFPGETSEDFEQTVEVLEETEPYKLHIFPFSPREGTRAARFNTVASDEVRGRRHLAYQLEKKLRRRERFLGHTVDVLAEETRRGQGWTTGRSRHYLKVRFSVPGAQPGLCYPVRMTQIEGDELLGYAVADS.................................................................................... 452
20 0.000e+00UniRef50_B8E0G0 MiaB-like tRNA modifying enzyme n=3 Tax=Dictyoglomus TaxID=13 RepID=B8E0G0_DICTD  ali  29  1..............................................................MRKVAFYTFGCKVNQYETENLKILARNAGFEIVPFGKEADLIFINSCAVTHVAERKARRLINLIKNPNAKIALAGCYAERSSEKLV--LDFVLDNKQK-------------------------WEFFGGSEDSAFVTSEDRARAILKIQDGCNNFCTYCIVPYLRGRERSKPFDKVMEEAQKLVENGFKEIVLTGIRLGAYGRDLGDKLSKLLLKLF-EMDGLVKIRLSSIEPMDITEGLIKL---ADHPKLCKHWHIPLQSGDDEILKKMNRRYDTKYFEQIVYKLREKVPDVAITTDIIVGYPEESEENFNNTYLFAERMGFMRIHVFPYSPRPFTPAYKLKPLPYEVITKRKEKLIKLSNDLWERYKFIEKELEVMVEE--RKENLYRGTTDNYIKVEFESNLLLKGEYIKVRLLKVDEEKVWGEVLE...................................................................................... 410
21 0.000e+00UniRef50_A0A257BGR9 Ribosomal protein S12 methylthiotransferase RimO n=3 Tax=Bacteria TaxID=2 RepID=A0A257BGR9_9BACT  ali  26  58................................................................TVRLITLGCAKNEVDSEEIAGVLQRAGYRLDAHTETPDVVIINTCGFLESAQREGMQVIREALQLKKRVIVAGCMVQRLGESLLPEVDAWVGVGQMARFAEIVDSVRSTRQPITDIQPPHHRWAEVPTRL----RSRAPWTAYLKVSEGCDHQCTFCTIPSFRGRHVSKPLERVLAEARWLAENGAKEINLIAQDTTQYGYDLYKQFPTLLREL-NAIEGIEWIRIHYAYPSRITDALIHT--MASLPKVVKYLDVPLQHADAKILRAMRRPGDGERYLKMIEQLRAAMPQIAIRTTFIVGFPGEGEQEFQNLLRFMQKAQLDRVGAFIYSREKGTPSAELEQVPFRVKRERFDQLMRFQQPISRNKQLIGTTLRVLIEGYSEEGNYAIGRSDVDGLVYVKHCTASPGEFVEVTITHADVYDVWGE......................................................................................... 494
22 0.000e+00UniRef50_A0A1J5GFH4 tRNA (N(6)-L-threonylcarbamoyladenosine(37)-C(2))-methylthiotransferase MtaB n=5 Tax=unclassified Atribacteria TaxID=1047049 RepI  ali  25  1..............................................................MKKVAFKTLGCKVNQYETEIILNLFQDEGFQIVNFNQKADVYIINTCTVTKEADRKSKQMIRKAIGQNKKIIVTGCFAQSNYQEKIRGINLITGNSDKNSILQQFKELDFHNTVVKVTPAKFLKKYDNVIKNKSIL----RARAWLKIQDGCNNFCTYCKVPYVRGPARSRLIDDILQEVSNLENSGIKEVVLLGINLGTYGEDLKANLSKLI-SLINNFKGIKRIRLSSIELVNINNELLDTF--GKCSKLCHHLHIPLQSGDDKILKLMNRPYNTSIFGKKIFQLKKKIPNIAITSDIMVGFPGEDNESFNNTYKFIRKMCFSKIHIFKYSNREKCLAILMPNVDNEIKKERSKKLINLASELNFRNKYLGLDVDVLVEDEIKDKEYSRGITDNYIKVIIPDLIGKRGEIVKVQLNKIYSDYII........................................................................................... 432
23 0.000e+00UniRef50_E8T5Q6 MiaB-like tRNA modifying enzyme n=5 Tax=Desulfurobacteriaceae TaxID=558314 RepID=E8T5Q6_THEA1  ali  28  1..............................................................MKRVAFYTLGCKMNFHETAYLEEQFKGAGYRVVPFEEEADVYVINTCTVTHTADAKSRKAIRRAKQRNPKVVVTGCYSEVYPEEKVKEADLITGNVEKQNLVELVEARLRGELPRTVVKGVWRDGTFQRL---TIESFEGRTRAFVKVQQGCQLFCTYCIIPKARGPMVSLPPQEALSQIKRLVEAGYKEIVLTGTHLGAYGREFGWSLARLVEEAV-KIPGLYRLRLSSVEPVEFTPHLIEV--ITGSEKVAPHYHVPLQSGSKSVLERMGRRYTPSDYERVIEELVKRRPECCVGTDVMVGFPGESEEEFNETLEFIKSLPLGYLHVFPYSRRRGTVAARLNSVTPQEKRRRGELLREVGTEKSFRKRFLGKELEGLVIKQSPYGS--VALTGNYIQTILNG-EVPTGSTVKFTLTKVG................................................................................................ 420
24 0.000e+00UniRef50_A0A0S8E353 Uncharacterized protein n=1 Tax=Omnitrophica WOR_2 bacterium SM23_29 TaxID=1703776 RepID=A0A0S8E353_9BACT  ali  25  1..............................................................MQTVCFKTLGCKVNQYETQAIREQLNNLGLTETTDA--ADVYIINTCTVTKKSDDESKRTIRRALKSNPNVLVTGCYAEKDRGELMNGIGAIVSNVKKPSIPSIL---------------LGRDITEEDIFTFSISDFSGHTKAFVKIQDGCDRFCSFCKIPFVRGRSRSRQLKDVVEEVKRLVKRGFKEVVLTGICLGSYGRDFGTDLVKLIDEL-EKIDFNFRVRLSSVDPEDVSGELIK--KFVTSKKMCRHLHIPLQSGDDNILKVMNRRYTASKFIDLVTKLKYSIKDVAITLDVMVGFPGEAEINFKNTLETVKEISPLRIHIFPYSKREGTKAAKFDDVASDIVKERIKRLKGFQQENSFRKHFIGKELEVLVEKRDKSTGLLTGYSDNYIKVLFYGPDELMRDLIRVKILDVTYNFTLGR......................................................................................... 418
25 0.000e+00UniRef50_I3VIC5 tRNA-2-methylthio-N(6)-dimethylallyladenosine synthase n=6 Tax=Bacteria TaxID=2 RepID=I3VIC5_9BACT  ali  27  1..........................................................................MNVADSERAATGLRQSGYDLCDAVEDADVVLLNTCSVREKAEGKVYTRIGEVRKPNLMIGVMGCVAQLEGAKVFPTVNMVIGTRATDRISSMIERAARGERRVLDLGERDLNESWDV----SPVERRSPHVAFVPIIEGCNKFCSFCIVPYSRGRERSRAANEITAELRNLMSLGYKEVHLIGQNVNSYGFSGATPFCRLLRAVAA--TGFPRIKFTTSFPRDFHPDI--VAAIEEHENLCDWIHLPVQSGSDRILKLMRRGHDRTAYLAKIERIKKSRRRLALTSDMIVGFPGETEEDFQQTLDLVRECEYDGLYLFKYSKRPGTPAAAFDDVSDAIKKDRFLELERVQRSQQEYRSYVGRVLKVLVEKQSSRSETLMGHSTCHKVVNFAGDKKLEGNIVDVMIAEVKTNSLYGTLVNRSAV.................................................................................. 436
26 0.000e+00UniRef50_A0A143XFU3 Threonylcarbamoyladenosine tRNA methylthiotransferase MtaB n=69 Tax=root TaxID=1 RepID=A0A143XFU3_9BACT  ali  25  1............................................................MQQRRVSFHTLGCKLNFSESSTLAREFEQGGFVRVAPEAEADICVVNTCSVTEHADKKCRNLIRKLHRRNPIIAVTGCYAQLKPEDIIDGVDIVLGNNDKGDLYKRVLELTGKGRARVYSCDTDSLTRFFAAFSS-----GDRTRAFLKVQDGCDYCCAYCTIHYARGASRNLPVADAVAEARQIAAAGQKEIVITGVNTGDFGRTTGEKFIDLL-RALDAVEGIERYRISSIEPNLLTDDIVEF--CAASPKFQHHFHIPLQSGSDRILGLMRRRYTTARFAGRIEAVRRLMPDAFIGIDVIVGFPGETEADFGETYAFLERTAPAFLHIFPFSERPGTPAALPGKLQPAVAARRGAELEALCERLTFCAKAVGTEDRVLFES-TRRGGMMFGFTGNYRRVKAPYDRARVNTVCRVRLGAMDEHDLAGEILD...................................................................................... 432
27 0.000e+00UniRef50_A0A1I6D8R8 Ribosomal protein S12 methylthiotransferase RimO n=1 Tax=Desulfotomaculum geothermicum TaxID=39060 RepID=A0A1I6D8R8_9FIRM  ali  24  5.................................................................IGFISLGCPKNRVDTETMLGCLEGAGYTLTGDLAEAEIIVINTCGFITAAKEESIEAILEAARYKKTLLVAGCLPQRYGRELLPEIDGVMGTGAVPEIIAALDRMQADERVLAVHDPGYIDHAPAPRKLTTP-----GHTAYLKIAEGCDNCCSYCAIPAIRGPYRSRPMDVVLAEAQDLCARGVRELVVVAQETTRYGLDLYGRLRELLQGLVA-LEDCRWIRLMYCYPTSFTDDLIELIASAE--KICPYIDLPLQHINNRILKMMNRRGNKEVIVNLITKLRRSVPGLVLRTTFIAGFPGETEEEFAELLDFMERVKFERAGVFGFSPEEGTPAAALPRLDEETIAARVDKAMRLQQGISYNRQQVGREVQVLVEGWDDEAKMYWGRTEIDGRVFFTSDDVRAGDFVQVKILAAAEYDLSGV......................................................................................... 440
28 0.000e+00UniRef50_A0A0S8KDP8 Uncharacterized protein n=1 Tax=candidate division Zixibacteria bacterium SM23_81 TaxID=1703428 RepID=A0A0S8KDP8_9BACT  ali  25  1..............................................................MPMVAFYTLGCKLNQYETEAMRGQLEEKGFHSVDFHQEADVYVINTCTVTHRSDVRSRQMIRRAARRKRLVVVTGCYAQRAPQQLIPGVDLVLGNAEKARLLEYVDR---QRGQGVFVSRIEGQRDFPEMEVT---GFARHTRAFLKIQDGCDGHCTYCVVPMARGRSRSRKFSVVAQQVKGFIQAGYRELVLTGVNLGRY-RDPQRPEVDLLY-LLQWLEGLGRVRLSSIEPTDLTDRLIDFLGY--SKKVCRHLHIPMQSADDQILQAMNRPYRAVEYAHLIERIAREIPGVAIGTDVIVGFPGETEKQFGATRTMLQNLPICRFHVFSFSGREGTPASTMHQVSPEVRRHRSHVLRSLSKSLAFRRSFLGTQLTVLMEQRDMATGLLTGLSDNYIKVLTKGSDQMMNCLVPIKIQRVAKEGTWGRPI....................................................................................... 431
29 0.000e+00UniRef50_A0A1V5WBY4 (Dimethylallyl)adenosine tRNA methylthiotransferase MiaB n=2 Tax=Chloroflexi TaxID=200795 RepID=A0A1V5WBY4_9CHLR  ali  28  1..........................................................................MNLADSQRVAAGLERLGYTATARAEDADIVVLNTCVVRQQPEDKAVGRLQQLRSVKRVLALMGCMVGARLEQRFPWVDLFLPPSDPTELWAYLRELLDEAQTLIADAESRRLALGRTDTVLPTSEEGRAVSAYVPIVLGCSHACTYCVIPYRRGPERSRPLEAIVAEATQLASQGVREITLLGQIVDRYGYDLETPLVTLLRR-VHEIAGLERLRFLTSHPNWMRDDLLD--AVATLPKVCEHIEVPVQAGDDEVLKHMRRGYTVEDYRRLVARLRERIPGVSIATDIIVGFPGETEAQFENTVALLETLQLDKAHIARYSPRPLTVATRRDDVPYEEKERRRRTLEQVQARITLNARLEGQQVEVLVEGE--KKGRWFGRTRTDRLVFFAAEGNWLGRLAQVAITWSGPWSLIGEPVA...................................................................................... 436
30 0.000e+00UniRef50_A0A1V6BSI4 tRNA-2-methylthio-N(6)-dimethylallyladenosine synthase n=3 Tax=unclassified Spirochaetes TaxID=1130380 RepID=A0A1V6BSI4_9SPIR  ali  23  1..............................................................MRRFFIETYGCQMNKADSLSLSEKLRLSGYSEGRDPENSDIIIINTCSVRKTAENRIWGRLGYFKNLKRKVVVMGCMSQRIGDEIKNGVDLVVGTFYKDKIPYLIENFNKKNGNVFT-------DEKELPFSYSSPEAGNPAKAFVTISSGCNNFCSYCVVPYLRGREISRNSAEIIDDVVKLTQKGVIQATLLGQNVNSYGLDKGDTFPELLKKIARETD-IKWIKYLSSHPKDFTDELIEV--ISSEEKVANYLHLAVQSGSNRILEKMNRKYKIEDYIDKITKLKNLVPGLNLTTDIIVGFPGETSSDFQDTLNLMKTVEFDDAYMYKYNTRENTYSSDADDVSDEEKLERLQTIIDLQIEIRKKKKRIGDIFEVIPERKSKNNNEILGLTKEDLMIIYNSPDFEIGKIVKLKAVKLTGNSLFGERV....................................................................................... 433
31 0.000e+00UniRef50_Q9C7H2 At1g72090/F28P5_4 n=12 Tax=malvids TaxID=91836 RepID=Q9C7H2_ARATH  ali  44  1.........MEDIEDLLAGGVPLNAVGINPKTNKSKRISSKPDQITASNRDSLAPPSMKIPGTQTIYIKTFGCSHNQSDSEYMAGQLSAFGYALTEVPEEADLWLINTCTVKSPSQSAMSTLITRGRSGKKPLVIAGCVPQGSRDKELEGV-SVVGVQQIDRVVEIVEETLKGHEVRLLTRK-------TLPALDLPKVRRNNFIEILPINVGCLGACTYCKTKHARGHLGSYTVDSLVERVRTVISEGVKEIWLSSEDTGAYGRDIGVNLPILLNAIVKELPSDQMLRIGMTNPPFILEHLKEIAAVLRHPCVYTFLHVPVQSGSDSVLTAMNREYTASEFRTVVDTLTELVPGMQIATDIICGFPGETDEDFSQTVELIKDYKFPQVHISQFYPRPGTPAAKMKKVQSKIVKQRSRELTSVFEAFAPYTGMECREERIWITEVATDGIHLVGHTKGYVQVLVTGPESMLGTSAMARITSVGRWSVFGEVIE----TFSSANRETKSREETKLPCSSNVSTCETCTCSAESCGEERSGEACNISGNISGQDDNK........................ 546
32 0.000e+00UniRef50_A0A1W9HNE3 Uncharacterized protein n=1 Tax=Nitrospira sp. HN-bin3 TaxID=1827378 RepID=A0A1W9HNE3_9BACT  ali  24  1............................................................MGTTRASLHTLGCRLNQAETSILGEGLRRKGFELVEFGQPTDVLILNTCSVTEDAERTSRYLIRKTLKHSPHVAVTGCYAQTGMEQLKRGIDLIVGHQFKLDLPAYVHELRKRSTPDIHHTKTMGRGDFALPYFAEP----DSTRALLKIQDGCSAMCSFCIIPFARGHERSRAFDDILREAESLVAGGYREIVLTGVNIGQYVH-GGNDFCALLRRL-DQVEGFDRIRISSIEPTTISEELLDL--IASSKKFCPYLHIPLQSGDDEILQAMNRRHAIKEYRALIDRAFTKIPDLGLGTDLMVGFPGETDEAFQNTLAVATDLPFSYIHVFPYSTRPGTAAARLKQIPSPSVKKRADQLLELAKRLAFHNKQIGKTVSVLFE-AGTHSAYRFGTTPNFTRVAVTDAAELQNQIMPVTITAATDRYGFGHI........................................................................................ 432
33 0.000e+00UniRef50_A0A2P8EIR3 Threonylcarbamoyladenosine tRNA methylthiotransferase MtaB n=1 Tax=Fusobacterium naviforme TaxID=77917 RepID=A0A2P8EIR3_9FUSO  ali  25  1..............................................................MRTAAFHTLGCKVNTYETEAMQQALLRAGYELRSFEEPADVYIINTCSVTNIADRKSRQMLHRAKSLNPDAVVAGCYAQAAGGKLKEDVDLIVGNHEKRELAALLERYFAGNVDRAACVAVGDIAAVRAYDDISADTMSDHTRAFLKIQDGCNQFCSYCIIPYVRGRVRSRAFPELKEEVERFAAQGYRELVLTGIHLSSYGRDLEENLSDVIC-LLDRVEGIERIRVGSLEPQIVTEDFVR--RLAGLRHFCPHFHLSMQSGSDAVLRRMNRHYSTAEFRRGVDTIRRVFPDAAITTDIIAGFPGETEEEFQETLAFTEEICFYETHIFPYSRREGTRAAEMPQCTRAVKAARAEQLAALNRRHEFRERRIGRWEEILVEEVAELNGYLLGNTREYVRIAAENETAPVNALISGQVTGFLTEELL........................................................................................... 471
34 0.000e+00UniRef50_A0A2H6EFT4 Threonylcarbamoyladenosine tRNA methylthiotransferase MtaB n=1 Tax=bacterium BMS3Abin03 TaxID=2005711 RepID=A0A2H6EFT4_9BACT  ali  24  2..............................................................KKKVALHTLGCKLNFSETSTIGNQFMQRGYSIVDAKEKADIYVFNTCTVTENADRECRQLIRSALRKNPYIIVTGCYAQLRPEEIINGVDVILGSKEKFNLFRIIDDFNKNDLACIFVSPTVSLTGFGEAHST---NADSRTRAYFKIQDGCDYKCSFCTIPLARGISRSMDFKNAVDEFKGLVNNGYKEIILTGVNVGDFGNRQNTDLYKLLKELV-RVDGEFRIRLSSIEPNLLSDDIIGL--IADEEKLCDHLHIPLQSGSPVILKAMQRRYTISDYKKVIGNAADKIKDAGIGVDVIVGSPGETDEDFWLTYNFIKDLPVSYLHVFTYSERPDTLAINLPRVDVNERKKRNKILRNLSEKKRFYEKMLGKEFDVLFENENHR-GKMMGFTSNYIRVAADYKQDLINRLTKVNLTGIDDRGL............................................................................................ 426
35 0.000e+00UniRef50_A0A2D9LDU8 tRNA-2-methylthio-N(6)-dimethylallyladenosine synthase n=4 Tax=Alphaproteobacteria TaxID=28211 RepID=A0A2D9LDU8_9RICK  ali  26  2..............................................................KKRFSILTYGCQMNVYDSLKIQELLGSIGFSDSSSFFDADLIILNTCHIREKATEKVYSELGKIKKSRKIIAVMGCVAQAEGDEIFPYVDIVIGPQSVHNLPTLVTEAMERRNKRKSLKLIDVDFPARNKFNYFKHNKPQGASAYITIQEGCDKFCNFCVVPYTRGKEFSRSIEDVYVEANNLVALGSREIILLGQNVTAYGKDFKEQGIHKLIEKLAKIKDLRRIRYITSHPLDIDQNIISIH--GTEKXLMPFLHLPIQSGSNKILRSMNRKYTVEDYISIVKKFRAICPDMQFSSDFIVGYPGESEQDFQXTIRLVKKIKFAQSFSFKFSPRAGTPSAEKEQVDPKISSKRLSILQXLLXSHQFNRSSEGKIVPVLIEGEREEKGKFFGRTPCMXMVNXNGSKSLVGKIVDVKIEKSGKGSLGGHLAN...................................................................................... 447
36 0.000e+00UniRef50_Q6MGT1 Ribosomal protein S12 methylthiotransferase RimO n=12 Tax=Bdellovibrionales TaxID=213481 RepID=RIMO_BDEBA  ali  25  1.......................................................MKQETAQNKKVHFISLGCPKNLVDSEIMAGTLMKDGYEVVGEADQADTVIVNTCGFIEDSKKESIQRILDMSDLKKKVVVAGCLTQRYKDDLLPEADLFVGSGEFQNIAKILKNSDEGEKQ-----KTFFNLPTYLQEEATPRVNSQPHRAYLKISEGCMKRCAFCAIPLIRGNLQSRSIDAIVAEAKLLVAGGVKELIIISHDFTDYGFDIKESPVELL-KALDQVEGLQWIRLMYLYPDGITQEMVQVIK--NSTKIVKYFDMPLQHVNDQVLKSMNRKMTRDEIETALMNIREHLPEAVIRTQFIVGFPGETQEQFEELLNFVAEQQFDRVGCFKYSPEENTPGGRMEQIDEETKQYRHDALMEVQQNISREKHFVGKTLQVIVEGFSEETDLLQGRPDIDGVVLINDGQAQVGDMVKVHITDNMEYDLIGEIVVE..................................................................................... 456
37 0.000e+00UniRef50_A0A0P0GIB0 tRNA-2-methylthio-N(6)-dimethylallyladenosine synthase n=2 Tax=Candidatus Xiphinematobacter sp. Idaho Grape TaxID=1704307 RepID=A  ali  25  1..........................................................................MNEQDSRQVSKMLVDRGYCLVENEEEADVILLNTCSVREMAEQKAIGKMGMLRKLRPRLILGGCMAQIRGDGLLPHVDLVVGTRKIHRVAEYVDAIFRRSQQARMDDERLPIVEVGEEQDASTTSKESRATAFVSIMQGCNMHCAFCIVPQTRGSERSRSMEEIVEEVQMLVDEGVLEVILLGQIVNFYGRDNKSPFVQLIERI-HRIKGLERIRFISPHPIGFQQDLIDCF--ARLPKLMEHVHLPLQSGSDRILRSMRRGYTVSTYLRLVEKLRAARPDLAISTDIIVGFPGETEEDHLATKEVYRTAGFDHAFIFRYSPRRATRASAMEQVTEEAKEARNQDLLHLLRVTSARKACVGTRMEILCEGPSKTNSRFSGRTRTNQLVVFDGSNRHVGQIFDVLITGSSASTLYGDP........................................................................................ 439
38 0.000e+00UniRef50_A5GE34 MiaB-like tRNA modifying enzyme n=18 Tax=Desulfuromonadales TaxID=69541 RepID=A5GE34_GEOUR  ali  25  8.............................................................AMNTVAITTLGCKINQFESAAMSEALGKDGFQVIPFDDVADIYVINTCTVTSRTDAESRRLIRRASRQNPRIVVTGCYAQVAFEELMPGVNLILGNSEKKGIAALLKEIGDGRQVLVSDISREKDAGGAQLES-----FAEHTRAFLQVQNGCDAFCSYCIVPYARGRSRSVPLDEALAGIRTFAAQGFKEVVLTGIHLGGYGLDLTPPLTLLDILIAAEKQQLERIRVGSVEPTEVSDALIAFLAGSKL--VCPHLHIPLQSGNDQVLSRMNRKYAANLFREVVEKLVCALPDICIGTDIITGFPGESAEEFEQGYRFLESLPVAYFHVFPFSPRTGTPAATMDHVRSSVIKERAKALRKLSKKKAYYRTFLGKELPVLIQNR-EENGMLKGLSRNYMPVFVKGDDSLINNEQRVRITGVVREEVKGEVVADDPAP................................................................................. 444
39 0.000e+00UniRef50_A0A022Q593 Uncharacterized protein n=6 Tax=Viridiplantae TaxID=33090 RepID=A0A022Q593_ERYGU  ali  48  1.........MEDIEDLLVGGGGGAPFRIPVAAAVGIKPKKSVSRDYLKDY-----STSKIPGTQTIYIKTFGCSHNQSDSEYMAGQLSAFGYNLSENQDEADLWLINTCTVKSPSQSAMDTLITKCRNAKKPLVVAGCVPQGSRDKELDGVSIV-GVQQIDRVVEVVEETLKGHEVRLLTRK-------TLPALDLPKVRKNMFVEILPINVGCLGACTYCKTKHARGHLGSYTVDGLVGRVRSVIDDGVKEIWLSSEDTGAYGRDIGVNLPILLNSLVAELPGSTMLRIGMTNPPYILEHLKEIAEVLRHPCVYSFLHVPVQSGSDRVLTAMNREYTVGEFRTVVDTLMELVPGMQIATDIICGFPGETDEDFEATVNLIKDYKLPQVHISQFYPRPGTPAARMKKVPSNIVKRRSRELTTVFESFTPYVGMEGKIERIWITDIATDGSHLVGHTKGYIQVLVVGPESMLGSSATVKITSVGRWSVFGEVIQIHSQNT------KPRKNSARVEKNSCSNSKETCCSEESETCACGLTSGCGQ................................... 521
40 0.000e+00UniRef50_A0A1F2QC88 tRNA-2-methylthio-N(6)-dimethylallyladenosine synthase n=1 Tax=Acidobacteria bacterium RBG_13_68_16 TaxID=1797171 RepID=A0A1F2QC8  ali  26  3...............................................................RTYFVETWGCQMNVLDSQRLAGVLEAHGLRPADRPEDADITLLNTCSVREKAVHKVLTRLGELKQVKRVVGLCGCVAEQEGRGLLARLDFVLGPGRVAQLGRALEAVAAGEKVSLTGFSPSQEYDAHLI------ARGGGARQFVTVIHGCNQHCTFCIVPYTRGHEASRSLAEIAREVEALVAAGAKEITLLGQTINAYRCPTGAGFGELLGTLGA-VPGVWRIQFVTSHPKFFIDNMIE--AIATTPNLGTYLHVPFQSGSDAVLKRMHRGYTRDGYVELVGKLRGAMPEVTLSTDVIVGFPGETEEDFEATLDVVSQVRFGQLYGFIFSPRPRTPAARYPRVPRTVARGRLERLFALQATVQFNQSLINRDVEVLVDGPAKRGESWQGRGPDNRVVNFPANGIRAGEVARVVVTGATAHALLGVRAADRKNGWPTPAA........................................................................... 449
41 0.000e+00UniRef50_A0A1F7SI24 Ribosomal protein S12 methylthiotransferase RimO n=4 Tax=Bacteria TaxID=2 RepID=A0A1F7SI24_9BACT  ali  27  1...................................................................MISLGCPKNSVDSEIMLGLLEKEGFRLTTNKEEARIIIINTCSFIESAKSESIEAILEITELKKKIIVTGCLPQRYQDKLIPEIDFMLGLNHVTDIVKICKKSIRRNSSIPPSPLLQRGVRGDLTNLLPRKLLTPKATAYVKITDGCDNWCSYCTIPSIRGSFRSRSIASIVDEAAILAENGVKEINLIGQDTTSYGRDFKKNFINLLKKLID-VKGIEWIRILYTYPSEINPELISL--IRSEKKICKYLDVPLQHIDNSILKNMRRRYTGRDIHCLIDKIRKSIPDISLRTSIITGFPGETDKQFKKLCSFIKEIGFDNLGAFSYSREEGTKAYALKQIPEKVKIKRLKEIMRIQKNISFRKNLIGSCQKVLIEGYSQETDLLAGRPDVDGITYVNEGNPATGEISDILITNAIGYDLVGKVI....................................................................................... 462
42 0.000e+00UniRef50_A0A2N1S0K7 tRNA-2-methylthio-N(6)-dimethylallyladenosine synthase n=7 Tax=Spirochaetes TaxID=203691 RepID=A0A2N1S0K7_9SPIR  ali  25  7......................................................PLSDTLKTHSRYWLETYGCQMNTAESNALEAALQAAGMQPALRAEDADCAILNTCSVRKTAENRIWGRIGHLKQSHPTLVVTGCMAERLGEEFLPAVDHVMGTNDKQRIAALL--------------SGGSDERDAAYSFTQSYYKDGDVKSYVPIMNGCNNFCAYCIVPYVRGREVSRDPQSVYDEIHRLEDAGVREITLLGQNVNSYDYTWNGRFPDLLSDIASQVSSIRWIRFESPHPKDFSKELIAV--IAQEQAVAKHLHVPAQSGSTRILQLMNRKYTRESYLQLIGNLREAVGGITFTTDVMVGFPGETEDDFHQTLSLMREVRFLEAFMYYFNPREGTKAVSMDQLSSEVRMARLQELINLQRSISHEERCTG-TVEVLVEQISKRNEHYLSRTEHDEMVVFPVSPVRVGDFVNVALTG.................................................................................................. 432
43 0.000e+00UniRef50_A0A0A2VY44 (Dimethylallyl)adenosine tRNA methylthiotransferase MiaB n=1 Tax=Beauveria bassiana D1-5 TaxID=1245745 RepID=A0A0A2VY44_BEABA  ali  28  1..................................................................................MADLLDSHGFTLTDNANEADVLLLNTCSIREKAQEKVFHLLGRWKHIKAKIGVGGCVASQEGKKIAHYVDIVFGPQTLHRLPEMINQVRGTRSPVV-----DVSFPEIEKFDRLPEPKAEGPTAFVSIMEGCNKYCTYCVVPYTRGEEVSRPCDDILFEIAQLAEQGVREVNLLGQNVNAYRYDGGISFAELL-RLVAAIDGIDRIRFTTSHPIEFTDDIIEVYR--DTPELVSFLHLPIQSGADRVLNMMGRTHTALEYKSTIRKLRAARPDIQISSDFIVGFPGETSQDFEQTMKLIADVNFDTSFSFIFSARPGTPAADMDDVPEDEKKQRLYILQDRQQVMEWSRKMLGTVQRILVEGTSRKSIQLSGRTENNRVVNFEGTPDMVGKFVDVEITEVLTNSLRAKLVRTESEMGLRIAETPASVIARTRKE............................................................... 443
44 0.000e+00UniRef50_UPI0009DF128C 30S ribosomal protein S12 methylthiotransferase RimO n=1 Tax=Clostridium sp. Ade.TY TaxID=1391647 RepID=UPI0009DF128C  ali  28  1...................................................................MVSLGCDKNRVDSEIMLGIMNKE-YEITNNPKDADIIIVNTCGFIDKAKQESIDTILEMAKYKKDLIATGCLTQRYGKELMPEIDIMLGVNDYIKIAKLIKQFMEEKNVDLEFTEVEYSDNN--INEGERILTTNKSTAYIRIAEGCNNFCTYCIIPKIRGKFRSRNMDSILEEAKTLVDRGVKEIILIAQDTTLYGSDLYKSLHKLLKEL-SKIDGLNWIRVLYCYPEEIYDKLIEEIAI--NEKVVKYLDLPIQHISDHILKLMGRKTTKLDITNKIDKLREKIPNIAIRTSLIVGFPNETEEDFNELKDFLSEYKLDKVGVFKYSREEGTPAAIMEQIEEDVKEAREKELMLLQSGISERINKIDNVYDILVEGKNEE--YYYGRNDIDGNVFFKHCPVNIGEFVEVRIEKNTEYDLIGV......................................................................................... 434
45 0.000e+00UniRef50_A0A2N1Q3B5 Ribosomal protein S12 methylthiotransferase RimO n=1 Tax=Tenericutes bacterium HGW-Tenericutes-5 TaxID=2013848 RepID=A0A2N1Q3B5_9  ali  26  1...............................................................MKIGFISLGCAKNLVDSEMILAILENAGCEIVQNEEEADAIFVNTCGFIEPAKEESRETIKEMSRYGKKLIVVGCYAERYREQLLPFIDRVITLADYPKIHLILNEVFNQEGLKFLPLKYENRL-----------LATSKFSPYVKIGEGCNNNCTYCAIPLIRGKFRSRPLEEVVSECRKLVKQGAKEINLISQDTTRFGRDLNPELPELLREI-SMIKGVKLIRVLYLYPDEITDEL--LLEVKNNPLVAPYFDIPIQHISSKVLKRMNRRGDEEFLKGLFKKIKDMMPEAILRTTYIVGFPGETEADFNQLLKFTEEVEFDRLGVFTYSKEEDTAAYDFEDIPEEVKQERMDKIMKLQKKITRKNNQVNKVHQVLVENYDPESKFYYGRSDIDGMIVFQSEKELIGDFVNVLITTSYGYDLIGDYVNEVK................................................................................... 436
46 0.000e+00UniRef50_A0A1V6G3Y1 tRNA-2-methylthio-N(6)-dimethylallyladenosine synthase n=1 Tax=Planctomycetes bacterium ADurb.Bin069 TaxID=1852902 RepID=A0A1V6G3  ali  25  3...............................................TTDDALLPPADHAQSPRRVHAEVFGCQMNKLDAQIGLEALLRAGCVRAENIADADTVVFFTCAVRQHAEDRFFSNLGKARGPGRLVAVAGCVAEEHGAELFPFVDLVCGTRHFHRLPELLARVRPAAPVVATGEAGVTYARRRSLDPR-------PAQAYVSVMRGCSLACAYCIVPSVRGPEVSRPPQEIRREIETLAAAGVKDVTLLGQTVNSYGRSLGPHSLAALLASLAGIPGLARLRFVSSHPRFMDEALID--AMAALPNVCEGLHLPAQSGSNAVLKRMGRGYTAERYLEIIAACRARIPGFAPAGDFIVGFPGETEEDFRATEDLMRAVRYQNVFVFKYSPRPGTRAAALDDVPAEVKQARNARLLALQREIALYRAEIGKTVEVLVEGPSRRPARFTGRTRSGKIVLFP-PVDAIGGLIGVRVEDATHLALYGTAASGDADAAR............................................................................... 458
47 0.000e+00UniRef50_A0A2V3IGB2 tRNA-2-methylthio-N(6)-dimethylallyladenosine synthase n=1 Tax=Gracilariopsis chorda TaxID=448386 RepID=A0A2V3IGB2_9FLOR  ali  25  189..........................RQSVQPTKLGATREKGYTVNPNMRRTSQKPPHIIPH--SFFIQTFGCQMNASDSERIAAQLESQGYHQIDDPNKSAIYMLNTCALRDHAEQKVYSYLGPHAQRKPQLIVAGCVAQQEGDALLPEIDIVMGPQYANRITDVLNLYHTSKAQVVAVDPIHIHEDISK------PKRSSSITAWVNIIYGCLERCTYCVVPNTRGLEQSRPMSSIRREIEALAAEGYREVVLLGQNVDAYGRDLYPTLSELLRYI-HDVDGIERIRFTTGHPRYISENLINT--VYELPKVMEHFHVPPQSGDSQVLKAMKRGYSRERYINIARRIREKMPDAAICADTIVGFPGETDDAFQNTVSLADEVVFDANMVRAYSARPNTIAARPDQVNEEVKMERLAIMNKKMREQARSRRYLGRTVEVLVEGMNKRSNEVSGRERTNRIVFCEGGTELIGKLIEVTVLEAYPFSLRGIL........................................................................................ 657
48 0.000e+00UniRef50_R5QLE9 MiaB-like tRNA modifying enzyme n=4 Tax=Firmicutes TaxID=1239 RepID=R5QLE9_9FIRM  ali  26  1..............................................................MKSVALHNLGCKVNSYELDVMQQYLQNEGYKIVNFNQKADIYIINTCTVTNIADRKSRQMLHRAKKQNPIVVAVGCYVQTNEAEIEKDIDLAIGNNRKNELVEIIEAYLDKRQSQTPDEQTTASSEEKEYEEMQLVHTAEHTRAYIKIQDGCNQFCSYCVIPFARGRVRSRKPEQVEEEVRRLAEAGYHEIVLTGIHLSSYGLDFGESLLRLIERI-HAVDGITRIRLGSLEPRVITEAF--AGALAALPKVCPHFHLSLQSGCDSVLKRMNRRYTTEEFARSVEILRLVYEHPAITTDVITGFPGETEEEFAQTVSYLEKIRFFEMHVFPYSRREGTVAADMPQLTEKEKKQRSSVLLAMTARHSKEYRYIGKEQEVLFEQCHEIEGYLTGHTRNYVRVAVPDPAEMTNQERICCLTGADDETLLGT......................................................................................... 473
49 0.000e+00UniRef50_A0A1I1LLP7 Ribosomal protein S12 methylthiotransferase RimO n=3 Tax=Clostridium TaxID=1485 RepID=A0A1I1LLP7_9CLOT  ali  27  1............................................................MTKYKVGMVSLGCDKNRVDSEIILGKMNKE-YEITNNPKEADVIIVNTCGFIEAAKQESIDTILEMAEYKKLLIATGCLIQRYGNELIPEIDIMLGVNDYNKINEVITDFIEGNKKAAELLNYSDDNINEGERVLTTQKE----SAYIRIAEGCNNFCTYCIIPKIRGKFRSRKMENIINEAKDLATRGVKELILIAQDTTLYGSDIYKNLHVLLKEL-SKIEGIKWIRVLYCYPEEIYDELI--SEMANNKKVVKYLDLPIQHISDNVLKLMGRKTTQKDITNKINKLRNNIPDMIIRTTFIVGFPQESETDFNEIIKFLEEYKLDKVGVFKYSREENTPASIMDQIPEEIKSEREEKLMTIQEKISNNKLKIGKLYDILVEEYN--GEYYKGRNEIDGNVLFKSSKSVIGEFVKVKIIKNMDYDLVGVVEDEP.................................................................................... 444
50 0.000e+00UniRef50_A0A1V5J2U3 Threonylcarbamoyladenosine tRNA methylthiotransferase MtaB n=1 Tax=Firmicutes bacterium ADurb.BinA052 TaxID=1852896 RepID=A0A1V5J  ali  26  1..............................................................MRRVAIATLGCKVNQYDSDALAAEFGRAGFEVVPFGDRADVYVVNTCTVTQIGDKKSRQLIRRAHAKNPEAVVTGCYVQASPSEAIPGVSVVSGTSDRAGIVRAVTDLVQNQGATAVL--VSDIGECRIYEELPSEGTAERTRAYVKIEDGCENFCAYCKVPYVRGPVRSRDFERIREEVARLCARGFREIVLTGIDLGAYGRDFGPSLADVL-QMAARTEGIARLRLSSVDPTDVTDRLLDI--MGSEPAVCPHLHVPLQSGDDHVLERMNRRYTSAQFEAVVARARARVPDLAVTSDVIVGFPGEDEAAFEATMALCGRVGFSRLHVFQYSRRRGTVAAGLGQVPREDKQRRSERLIALGRELAFHRGLLGQIVHVLVEK--SHGAACEGLTGNYVRVVADGGALQPGAMAAVLVTEAHEGFVQGVV........................................................................................ 437
51 0.000e+00UniRef50_A0A1F8MFI9 tRNA-2-methylthio-N(6)-dimethylallyladenosine synthase n=2 Tax=unclassified Chloroflexi (miscellaneous) TaxID=189774 RepID=A0A1F8  ali  24  1..............................................................MQHYFIWTIGCQMNKAESQQIAGYLDSAGYQAATSLADADLVVLNTCVVRESAENKVLGTLGLLKHPDLQILVTGCFVNRELQRRFPHVDLLFRPGDFPELIAWGRKRGAFVDQRLLGGVYPEPDSSVALFPQNDKRRRARTRALVPIIQGCDNFCSYCIVPYRRGREVSRPSEEIVCEVRELVRRGTKEVTLVGQNVDSYGHDLPPDLADLLKEL-DGMDHLVRIRFLTNHPKDMSLKLVE--AMASLNKVCEHLELPLQSGDNDILKAMRRGYTVEQYKELAHTVRAKVPQISLSTDLIVGFPGETDEQFERSLSLVREMRFDVVHVAAYSPRPDTVASRQDNIPVEVKKERLNKIEELQTTIAINSKLLGGTVEVLAEG--RKGGKWFGRSRSNKLVFFEDAGDWLGRLAIIQIEKTSPWSLGG.......................................................................................... 444
52 0.000e+00UniRef50_A0A1E9AKH8 Uncharacterized protein n=5 Tax=Firmicutes TaxID=1239 RepID=A0A1E9AKH8_9FIRM  ali  23  1..............................................................MMKVYVQNLGCKVNLYEAQAIKNSFEQRGYEVKEDFDDIDVYVINTCTVTNKSDSKSRQMISKVKKKNPIVIICGCYSQINSKEIMNIADIIVGTQGRNKIADYLEEYLNLGEKKNYVEDNIDKNYEELLFD----KNFDSTRAFIKIEDGCNNFCSYCIIPYARGRVRSRKADSIIKEIETLAKDGYKEFVITGIQITDY-EDNDIDLIKLL-EMIDEVPGVERVRLGSIQPKLLKDETVE--RLARLKHLQHQFHLSLQSGSNKVLKLMNRKYTREDYIENTSKIYKAMPDSAITTDIIVGFPQEDDEDFKESIDIVKKVNFLKVHVFRYSRRKGTKAYDMKQIAESVKKDRAEILEEYQERHIFINKFIGDEFEVLFEE--KKDEYFEGYTSNYIRAYLKTNENLHNQIIKVKVEKFRDGILV........................................................................................... 424
53 0.000e+00UniRef50_A0A1V4R2J9 tRNA (N(6)-L-threonylcarbamoyladenosine(37)-C(2))-methylthiotransferase MtaB n=1 Tax=Candidatus Latescibacteria bacterium 4484_10  ali  25  2.......................................................SNATVAQNKTVSFYTLGCKLNQYETEGMREAFRKRGVRIVPFGEPSNICVVHTCTVTQRTDYQCRQALRRAAQVCKDVVATGCYAQTDPNRLIEGVGFVVGTGGKTELPDLVSHVLDGGPKIVVGPR----DELRRFAEWDVRGLSGHTRALLKIQDGCDQFCSYCIVPFARGPSRSRPLENILREAKRLVEAGYREIVLTGVHIAKYGLDLSPNLLDILERLEH-LEGLERFRLSSIACPDFSKAWIDF--IARSKRVCRHVHLSLQSGDDEILRRMNRRVGADARHEVISLLHERVPGIALGADVIAGFPGESDAQFERTRCLIEELPLSYLHVFPFSKRPGTKAAGMKQVPEKVKKERAAVLRKIGKRLAFAEQFVGQTLPVLFEGRDRKTGLLTGLSDNYIRIMAEGGDAWMGRIVDVRLKGAVNGRMRGRI........................................................................................ 440
54 0.000e+00UniRef50_A0A026WZF1 CDK5RAP1-like protein n=4 Tax=Bilateria TaxID=33213 RepID=A0A026WZF1_OOCBI  ali  25  63......................APSLKDFLASSIAVDV--------TPSEEAIPYVQDIRGENQKVYIKIYGCQMNVNDADIIWSILKSHGYKHTQSLDDADIVLLVTCSIRDGAEQKIWNTLNHMKKKKKKIGLLGCMAERLKTKILEKVDVIAGPDSYKDLPRLLAVTDDETAVNVVLS-----FDETYADVAPVRLDQDSIRAYVSIMRGCDNMCSYCIVPFTRGRERSRPIASIVDEIRQLSDQGVKEVTLLGQNVNSYRKKGGLRFSDLLDK-VSLINPEMRIRFTSPHPKDFPDEVLRL--IAERANICKQIHLPAQSGNSTVLDRMRRGYTREAYLDLVDHIRDIVPSVCLSSDFIAGFCGETEEQFQDTLSLIENVKYNNAYFFAYSMREKTKAHRRDDVELHVKLERVGRMVAMYRKKKLNAAQVGQHQLVLVEGTSVRSDELQARNDGNVRVILPSREIQAGDYVVVRIDDANVQTLRGTPLYHSSIT................................................................................. 579
55 0.000e+00UniRef50_A0A2N2EU45 tRNA (N6-isopentenyl adenosine(37)-C2)-methylthiotransferase MiaB n=4 Tax=unclassified Elusimicrobia TaxID=1797919 RepID=A0A2N2EU  ali  26  10...............................................................RRVYIRTFGCQMNAADSSVMRGILENRSFEFSENPEEADLIIFNSCSIREHAEDRMFSNLGLAMKKNPKAILAGCTAKRHGAKLFPHLGAVVAPSELFSIGETAEKVLSGVAGIEALEGGYGFVP-----------RHGGVSEFVVIQTGCDNYCSYCVVPFLRAAERYRPAEDILREVRCLAASGTKEIVFLGQNVNSYRDETGGDFTDLLARA-AEIDGILRIRFLTSHPKDISAKLID--EFARNPRLARHLHLPVQSGSDSVLRAMNRKYTSADYLGIVEKLRESAKDVALTTDVIVGFPGETDSDFADTLALIRKADFDGVYVFKYSPREGTASFRMDDVTEEVKKERLAAGLALAKELALKKRYIGQKAETLFENDD------VGHSSQNYLVFKKGAKA--GDFGQVLIKAVSGFRLMAE......................................................................................... 423
56 0.000e+00UniRef50_A0A2E7G3L9 tRNA-2-methylthio-N(6)-dimethylallyladenosine synthase n=15 Tax=Chloroflexi TaxID=200795 RepID=A0A2E7G3L9_9CHLR  ali  23  6................................................................KYFIWTVGCQMNKADSERLENALSKIGFENSTTPADSDLIVLNSCVVRQGAEDKVVGMLKPLKEKNPILALMGCMVGKELKQKFPYADIFIQPQNYNPLIQYIENKLNIDTEGCLTQLSAKAD----------------VTAYIPIVQGCDKFCSFCIIPYRRGREICRPVKEIILETQYLSERGVKEITLLGQNIDSYGHDLKPDLGDLLKEL-NKIDGIERIRFLTSHPNDMSDHIIE--SVAELEKVCEHINLPIQAGDNEILNKMRRRYTNEEYRNLIEKIRSTIPNVSISTDIIVGFCGENDTQFQKTIDIIKDIRFDKVHAAAYSIRENTIAMRLDNVPLEEKKSRLNQIESIQKQILQEKNLCGETFEILVEG--KKNNNQYGRNRNDKLIYFDSKENLKGSMTNIKINKSTPWSLHG.......................................................................................... 423
57 0.000e+00UniRef50_A0A2M7ULK8 tRNA-2-methylthio-N(6)-dimethylallyladenosine synthase n=1 Tax=Candidatus Peregrinibacteria bacterium CG_4_10_14_0_2_um_filter_43  ali  24  1...............................................................MKYFIQTYGCQMNYSDSERLTTVLKKMGYEAVSAYPEADLIILNTCSVKQKAEDKIYG-LGELKRKNPKIGITGCMTGLRGERIMPTVDFVFRIKDLIKLPGILRKLHGVKGAEDVEDLCD--------YFHINPTIANITQVFIPIMNGCNNFCAYCIVPYARGREECRTMANILDEVEKVAKRGAKEVNLVGQNVSTYKSDVDPDFAQLLRKI-DAVKGIDRIRFFTVHPKDMTDDVIDLY--GELPGMVSHIHLPVQSGSNDVLKRMNRFYTVERFKELVDKLRARLPNIAISTDIIVGFCGETEEEFMESYNLINDCKIDLVYVSKYSEREGTLAAKKDDISKEIKRDRFDRITEVMKRISHEYNFLGKTVRVLVEKIRK--GYASGKTSEYKYCRFSDDKDLIGEYVDVKVDQAMEWCLEGKPVA...................................................................................... 443
58 0.000e+00UniRef50_A0A1W9VTA4 tRNA (N(6)-L-threonylcarbamoyladenosine(37)-C(2))-methylthiotransferase MtaB n=1 Tax=Candidatus Atribacteria bacterium 4572_76 Ta  ali  25  1..............................................................MIKVALKTLGCKVNQYETESIMNFFQDKGFQIVDFNQSADIYVINTCTVTQEADRKSKQMIRKAVRQNKKIIVTGCYAQSDYEDLIEGINLIAGNGEKNSILQQLEKINRHDTVIRVNPAKYLKKYDSNLKNRSSSLRA---RAWLKIQDGCNRFCAYCKVPYVRGPARSRPVKDVLEEVSDLSSNGVKEVVLMGINLGTYGRDIDKNLAKLI-SLISNFKGIKRIRLSSIELIDIDAELLDTFK--RCSKFCHHLHIPLQSGDDKILNLMNRPYDTSFFYQKISLIKETIPDIAITTDIMVGFPNEDNNSFSKTINFVRKICFAKIHVFQYSNRKECLADLLPKVDNRIKKERSKMLQRLSKELSFQNKFLNSTAKILVEDEIKDKEYSRGVTDNYIKVIIPDFVGKKGEIVNVKLNQISSNYVV........................................................................................... 433
59 0.000e+00UniRef50_A0A1F9DXR9 tRNA (N(6)-L-threonylcarbamoyladenosine(37)-C(2))-methylthiotransferase MtaB n=4 Tax=unclassified Deltaproteobacteria (miscellane  ali  25  8................................................................TISIATLGCKVNQFESEALIDTLIQKGYVFIPFEEGADIAIINTCTVTHRADFQSRQLIRRALRSNPKIIVTGCYPQVEPDAFIKGVRYILGNKEKNQIPTLLSLMQRGEFPKVQVGNIQKEILFSEISLH---SFHHHTRAFLKIQDGCNGRCSYCIVPYARGPSRSLPPERVSENLKIMKEKGFKEVVLTGIHLGAYGVDLNPPFP--LKKLMGQLEREERIRLSSIEPGDFSPELISVLS--QSRKICPHLHISIQSGDDEILKKMNRNYDRSFLSKLVQELHLRIPNLSIGADVIVGYPGETEVNFRHTYELVESLPFSYLHVFPFSRREGTPANQVPQVDDKEIKKRAEIMRELQKRQAYYRQFLNQELSVLGEDRREKGGRWKGLSRNYIPVLLNNQEDWVNQEWIVRVTELTEKSVIGKVVE...................................................................................... 446
60 0.000e+00UniRef50_A0A075APW1 Methylthiotransferase/radical SAM-type protein domain-containing protein n=2 Tax=Opisthokonta TaxID=33154 RepID=A0A075APW1_9FUNG  ali  23  35............................................DIPTSPSVTYIQDIISPLQRKVYIETYGCQMNVNDTEIVLSILQKFNYVRTVKTDDADVALLMTCAIRDQAENRVWERLHSLKHQKPKIAVLGCMAERLKSQLLEKVDVVCGPDAYRDLPRLLEDMDLYGKQ---GMNVMLSLEETYADVKPVRFDEKSPKAFVSIMRGCDNMCSYCIVPFTRGRERSRDMESIIDEFGFLVDKGVKEITLLGQNVNSYRKVGGRRFHHLLDQVSLKYPNV-RFRFTSPHPKDFPDDLLYLIK--ERNNICKMLHIPAQSGSSKMLEKMRRGYTRESYLELVDKIKAIIPDVALSSDFISGFCGETNQDHLDTISLMETVKYDMAYMFAYSLREKTHAHRVDDVPEQVKKERLNQVISTFKNIIREKKFIGTEQLVLIEGDSRKNEYFSGHSDQNYSAVIKKNQDKVGDFVQCKVVDTSEKTLICDFINLSSITEFNRTT........................................................................... 528
61 0.000e+00UniRef50_R6AL79 MiaB family protein possibly involved in tRNA or rRNA modification n=1 Tax=Clostridium sp. CAG:533 TaxID=1262818 RepID=R6AL79_9CLOT :  ali  26  1...............................................................MKVAIETLGCKVNFYESEVIKGIFINNKYEIVSLEDKPDVVVINTCSVTNQSDAKDRKIIRKAKRENPIIIVCGCYTQQDPKELKDDIDIILGNKDKTLIVTLLEEYLKNRKQI----KKIYNLQEAEFEEMQIAKNYDRTRAFVKIEDGCDNYCSYCIIPYVRGRVRFKDYDSAYNEIKALVADGFKEIVLTGIHTGRY-----PNLTKLIHEI-SKLDGLERIRISSIEITEINEEF--LTELKDNPKLCKHMHIPVQSACNNTLKMMNRKYTIEEFNEIIKKIRTVKPDINITTDLIVGFPTETEEDFNESLKNAEELKFGKIHVFPYSKRNGTAASKMKNVSDKQKTERTHKMLELSDEKEYYQKYINKEVILLTEEY--KDGYTYGYTDNYLRIKVK-ENIERGKIVKVKITSLEDLTLIGYLL....................................................................................... 421
62 0.000e+00UniRef50_F8AD91 MiaB-like tRNA modifying enzyme n=4 Tax=Thermodesulfobacteriaceae TaxID=188711 RepID=F8AD91_THEID  ali  26  1...............................................................MKYAITTLGCKVNQVESASLAEQFEKKGYKFVDFKEKADIYIVNTCAVTAKASYESRKLLRQALKNEPLLVVTGCYAQVGAEEILGYLKLIVGQREKAKLPEIIESLLPLKEKHIVISDVKDLKFCEPYPLS---YFREHKRAFLRVQDGCSLFCTYCIVPHARGPSRSLNLEKIREQVLRFLAAGYQEIVVTGVHLGLWGRDLSPDLVNLLEEL-----GVPRWRLSSLEPQELSEDILYFARKAKG--FCPHFHLSLQSGSNEVLRKMGRRYKVENFERLVLKIKELFPDAAIGADVIAGFPAETEKDFEETYALIEKLPLTYLHVFPYSPRPGTPAARWRQVPPHLVAERARKLQELSKRKAFYRAQVGQILEVLILRYLEEQGLYEGLSRNYVKVLFEAQEKELGHEISVKVERAVNSWLYGSKIS...................................................................................... 434
63 0.000e+00UniRef50_A0A1J4XS48 tRNA (N(6)-L-threonylcarbamoyladenosine(37)-C(2))-methylthiotransferase MtaB n=1 Tax=Candidatus Marinimicrobia bacterium CG1_02_4  ali  24  8...............................................................QSVSFKTLGCKLNQSESDAIMAKFEENQFRVRPFGEEVDLTIINTCTVTNDADSKSRATIRRAIRNSPRVVVTGCYAQVKPEDIINGVDLILGNDEKYHIFDHLNKLQHG-KLEEPLTIVNDEGEFTSVSEDGFISATSRTRVFLKIQEGCDYYCSYCIIPFARGKARSRPFTQTIDEARKLVDQGYREIVLTGINIGTYHTNGKQNLVDLLSAL-EQINGLDRVRVSSIEPNTVTDDLLHL--VAGSKVICDHLHIPLQSANDDQLSAMNRKYRLEEYARLMARFRTILPTAALGTDVIVGFPGETEAHFEKTTAFIQAQPFTYLHIFRYSPREGTVAAKLDNVQFHEIKRRSVVLHEVSQKLAYAEKFSGQTLKVLFDQF--RDGLASGYTRNYLRVQVPATQNISQSILPVTLSRSDRGNLQGTLAGE..................................................................................... 440
64 0.000e+00UniRef50_A0A1F4XJU5 tRNA-2-methylthio-N(6)-dimethylallyladenosine synthase n=1 Tax=Candidatus Abawacabacteria bacterium RBG_16_42_10 TaxID=1817814 Re  ali  25  6..............................................................MRKYHITTYGCQMNVSDSERIASMLEAMNFTASKTEAEADVLIYNTCSVRQKSENRSREKWQVMKQNNPVIGVTGCMVAHKGQRKLPEVDITFDIQELPQLPGKLAKTMG----------VDLVMPEYSEYLHILPKTKNKFQISVPIMTGCNNFCSFCIVPFTRGREKSRTVADIITEIKKFVKKGAKEVMLLGQNVNSYRKDDGKTFAYLLHK-VEEISGVERILYTSPHPKDMTDDVIE--AHATLKNLCPTVHLPVQSGSSAVLRRMNRFYTKESFLDLVQKFYDRVPGITISTDIIVGFCGETEQDFQDTLDLYRKAQFDLVYIGMYSPRPHSLAYKMDDIPRKEKERRFHILHALQEEIAEEKNYINKKIHVLIDKI--KNGVASGRSEHGKYVEIPFKGLELGEIVTVKVNEALTWVLRGEKVS...................................................................................... 449
65 0.000e+00UniRef50_A0A2V2DWW9 tRNA (N(6)-L-threonylcarbamoyladenosine(37)-C(2))-methylthiotransferase MtaB n=3 Tax=Clostridiales TaxID=186802 RepID=A0A2V2DWW9_  ali  24  1...............................................................MRIVYHTLGCKVNQYDTNAMKAVLEQAGHETVCDGSNADLALINTCTVTNMADRKSRQLIHR--EQGKPICVCGCLAQRDSEAMIDGVEAVVGTKNRSLIADIVGRIEAGERKINAVGDIASEHIFEPLSIA---DSDERTRANLKICEGCNNYCSYCIIPYARGPVRSREISDIAEEAARVAEKGVKEVVVTGIHIGSYGVDLKDRTLGDVITALDKVEGIDRIRLGSIEPSTVTEYFLECCK--RSEKLCPHFHLSLQSGCDTVLKRMNRKYTCAEYLDAVGRLRGAFESPSITTDVIAGFPQETEEEHKTTLAFLRKVGFSRIHVFPYSDRAGTAASRMDKVDGAVKKRRAAEIGVLAKEMEREESFVGTTQKVLFEKP-FDESRVIGHNERYIEIIAEGE---LNTITDVKIEGVTGNKLFG.......................................................................................... 422
66 0.000e+00UniRef50_A0A257UJ06 tRNA-2-methylthio-N(6)-dimethylallyladenosine synthase n=5 Tax=unclassified Deltaproteobacteria (miscellaneous) TaxID=122706 RepI  ali  24  3...............................................................RSVFIKTFGCQMNAVDSARMLSLLSSADYRAAATLEEADLVLLNTCSIREKADQKIYSTLRRWKRPGRLVGVGGCLAQQDGEALAPHVDIVFGTHNIANLPGMVRRAERRLTATALG-----MEDGFAHWDVVPYLPAGAVSAMVAIMQGCDNFCAYCVVPLVRGREVSRPSEDILSEVRALAARGVTEVVLLGQNVNSYGKKEGEPFPELLLRI-SAIERISRIRFITSHPRDLDDRTIRLFE--EISTLCPHVHLPLQSGSDRVLAAMGRGYTRGEYLARIEALRQVRPDMAFSSDFIVGFPGETEDDFRETLAVMEDIRFDSSFSFRFSSRPGTRAAEMEKVDPQEAAARLRRLQELQASHTRERAQVGREVTVLVEGTSRDPGMRCGRTPCNKTVNFT-PGSVGGPVRTVLVTGAGTHSLVGE......................................................................................... 433
67 0.000e+00UniRef50_A0A1G6DHQ4 Threonylcarbamoyladenosine tRNA methylthiotransferase MtaB n=1 Tax=Ruminococcaceae bacterium FB2012 TaxID=1520817 RepID=A0A1G6DHQ  ali  27  1...............................................................MKAFFCTFGCKVNQYETENIKEKMEASGFVPVNDHRDADVCIVNSCTVTSEADKKCRQMIHKIRKENPILVCAGCMTQAHKEKKLPECDIIAGTYSKARIPELIADFMNTGVRINAVKEHDPGASFEPM---TNASSDDKTRAYIKIQDGCDMHCSYCIIPHARGHIRSKPLEEIVSEAKGLIRSGHKEIILTGINLNCYGREKGGELLTDVIEALDALDEDFRIRLSSLEPELITDS--DILRWKNVKKLCPQFHLSLQSGCAKTLKAMHRRYTPEEYAVLCDKLRDAFDGCAITTDIMVGFPGETEEDHRESLAFSERIGFAEAHIFPYSRRPDTEADKLPQLDGVTKRCRFAEMNEICSRTRFLDSMIGTVRRVLFEKESC-AEYHQGHADNYIPVRVNGSGSLRRCFRNVRITGSNGEYCFGELLPEDK................................................................................... 437
68 0.000e+00UniRef50_A0A1J5EAL2 tRNA (N6-isopentenyl adenosine(37)-C2)-methylthiotransferase MiaB n=2 Tax=unclassified Deltaproteobacteria (miscellaneous) TaxID=  ali  24  1..........................................................................MNVADSELIQGILQDSGYQAAASLEDADVVLLNTCAVRERAEERIFGRLSNLQRPGAQLGVAGCMAERMRHERAPYVDFVIGPDSYRRLAEVLERSQTR-------PVTDVQLDRHEMYEGLTPVQTQNVCGWVTIQRGCDKFCTFCVVPFVRGRERAVGPAEVLRHVERLVARGVTTVTLLGQTVNSYLHE-GVDFAELLKR-VAAVEGIQRIRFTSPYPRDFTEELIDV--IAAEEKVSKALHLPLQSGSDRVLGLMRRQHTVQEYRELVSKIRCRVEGCALSTDIIVGFPGETEEDYRATVGCIQEFRFDAAFLFNYSEREGTYAARKDDVSPQEKGRRLTELIAIQEEISRYEARIGTTQAVIVEGSTRRDERMMGNTDDFKTTMFPGQGYRVGDLIEVKIVGATSHTLLGEPIRVPSAVPITLVDSLTEGISLGASAPAHG........................................................... 450
69 0.000e+00UniRef50_A0A2E5G5H2 tRNA-2-methylthio-N(6)-dimethylallyladenosine synthase n=5 Tax=Planctomycetes TaxID=203682 RepID=A0A2E5G5H2_9BACT  ali  26  2...................................................PVTPPDNHRQTSPCVYLETFGCQMNVLDSQLVQGQLRALGYHFVDNWKSADVVLYNTCSVRDHAEHKVYSRLGRVAQHKLLVGVIGCMAEREGVDLIPQIDLLCGPGELDQIPMLIDNALKGNTHRRSSTLGAAEDRLELLDLARSFSPDEHHSAYVRITRGCNKFCTYCVVPNTRGAEIHRPPDHIVEECKKLVDCGVVEITLLGQTVNHYHFDHGTRFSDLLARIHDEIPALQRLRFVTSFPRDFGDDILQV--IRDKPRICRYLHLPVQSGSNRILKLMNRGYSVEEYVDLLHRVRTTIPEAQIASDIICGFPTETEADHQATCDLLRQSKFKNCFIFKYSPRPGTAAIERDDVPEDIKRQRNNDLLAIQSQVSTHAQYTGQTVRVFVESLNKRTKKLSGRTDGDLIVSFEGEKSMIGTIVDVHIESALSLTLIGRTEAEPT................................................................................... 524
70 0.000e+00UniRef50_A0A2D6CSU9 tRNA (N(6)-L-threonylcarbamoyladenosine(37)-C(2))-methylthiotransferase MtaB n=1 Tax=Candidatus Poribacteria bacterium TaxID=2026  ali  25  1..........................................................MSDATPTAAFMTFGCKVNQYDTQAMAEALRDIGYEIRPISAGADLYVVNTCTVTSASDAKARKAIRALXRFXPHIFVTGCYAQAAKSDLIEGVTKVFGNREKFQLXEMIREAEITQTLSREFVGDPDAQVDLGEFGLSIATFDEQTRAMVKVQDGCSAFCTFCIIPYVRGRMRSRDLPDIVAEVERLAERGYRKVVITGVQLGSYGRDLRRDLADVL-AALHDIDDIARIRLSSIEPMDVPSNLIR--AVADLPKIAPHLHIPLQSGSTEVLERMRRKYTREEFLDLVAAIHEAMPDVGLTTDVMVGFPGETDAQFEDTCRAVEKSAFHRLHVFRYSPREGTPAASPDHVPAHVAVERSQVVRRLGKRLQYQEASLGGVVDVMVEDTREGPAEYAGYAGNYLRVLTDAKDEDIGLLRQVELVEVEDGYARGRLACHA.................................................................................... 444
71 0.000e+00UniRef50_A0A2M7RFP0 tRNA-2-methylthio-N(6)-dimethylallyladenosine synthase n=2 Tax=Parcubacteria group TaxID=1794811 RepID=A0A2M7RFP0_9BACT  ali  25  5..........................................................NNKAIKQYYTLTLGCQMNKLDAEKIDALLQKMNFKLTSNEREADLIIVLACSVRQSAIDRIHGRIKRLKKEKPLILLTGCVLPADRKGLGKQFDILLDMQELRTLPEKLRQKMKDIEDIFLESD----------YFKLPTKHESAFQAFVPISNGCNKFCTYCAVPYTRGREISRPASQIIQEVEELIKNGYKEITLLGQTVNSYKKEGVKNFADLLKRL-AEIKGDFWLRFLSSHPLDFSDKLIAV--IAQEKKICPHLHLPVQSGSNAVLKRMLRKYTREEYLKLIKKIKQRIPGVAITTDIIVGFCGETEADFGKTLDLYRQAEFDLAYLAQYSVRAGTQAAKKDDLPKAEKRRREKILNDLVAKIALKKNLVGKKVSVLIE--ANKKSFLLGKTDSSKAIRLNGGKALVGEFVYPTVTKALAWGLEG.......................................................................................... 432
72 0.000e+00UniRef50_A0A235BVW9 tRNA-2-methylthio-N(6)-dimethylallyladenosine synthase n=1 Tax=candidate division WOR-3 bacterium JGI_Cruoil_03_51_56 TaxID=19737  ali  21  1..............................................................MKSFFLQVYGCQMNFYEAGVVREIMKQAGYTETRKERDAEILLMITCAVRSHAEQRALGRFGTFREPGRIIGVLGCMAQRLKKTLATGADLVIGPDQYRHLPQLIQAVRETGKPQVAV------EQTGECYNEIFPEPHRPVCGFVTVMRGCNNFCSYCIVPYTRGRERSKSPGQVLAEAEKLATHGIKDITLLGQNVMAYHY-QDHDFVSLLRK-VHRVPGIKRIRFLTSHPNSSNEQI--FAAMARMPKICPFLHLPLQSGSNRILKMMKRGYTREEYLTKIALARKYLPGLGLTTDIMVGFPSETEEDFQDTLEVIKTVRFDFAYMFRYSVRPGTAAVQFPKVSEAEAGQRLTRLIDAQNRITREREMLNRTFELLIESHARGSGML-GRTRNNKAVIVHSPLS-VGETVTCQITRIKGWTPVAEV........................................................................................ 427
73 0.000e+00UniRef50_A0A1V6IJQ1 Threonylcarbamoyladenosine tRNA methylthiotransferase MtaB n=3 Tax=unclassified Tenericutes TaxID=713063 RepID=A0A1V6IJQ1_9BACT :  ali  27  1..............................................................MKTFTSVALGCKVNAYEVFSIEETLKAQGYKLAHQGDKVDVAIINTCSVTSNADQKSRQHIRKLAKPDAILVVMGCYAQLNKDLIIPEIDILVGTSNRSKIVDYIEEFKEHGQKIIAVEEEPRTFNYEELGATSVTPQA---RAYLKIGDGCDAFCTYCIIPLARGKMRSRDVRDIVKEAKDLVRRGYKEIVLTGIHTGAYGKDLGIKFSNIVEMILEACPSLHKLRVSSIEANEIDDDFLRL--MLKDKRIARHLHIPLQSGSDEVLRRMNRHYTTSEFIHKIENIREKVPNIAITTDVIVGFPGESEKLFNETVAFIKKVNFTQLHVFPYSARTRTPAASFEQVLGPVKKERVRTLINLSEDLSYAQRFVGEKMQVLIETYDDKEEVYVGHTTNYLAVRVKSDSDIKHEVITI...................................................................................................... 418
74 0.000e+00UniRef50_A0A1F9HXX9 Ribosomal protein S12 methylthiotransferase RimO n=6 Tax=Bacteria TaxID=2 RepID=A0A1F9HXX9_9DELT  ali  26  1..............................................................MQTVGLISLGCPKNLVDSEIMLGLLEKAGYMIVQNPAEADVLIVNTCGFIDDAKKEAIDTILEMAELKKKLVVTGCLPQRYKSELLPEVDLFVGTGEYNQIVELLRS----KDLSAHALKHLSTPQYIHNSATPRKIATPKHAVYVKIAEGCFHGCSFCIIPKLRGGFRSRPIKDIAAEVKMLVGNGARELNLIAQDTTSYGKDLNTNLVRLLEEL-SLIDGIFWIRIMYAYPTSITDEAID--AIANLPKVCKYLDIPIQHINDKILSAMRRKEKGRDIRLLIEKLRKRISGITLRTSLIVGFPGETGKEFNELASFVADGHFDHLGVFTYSREEGTSAARLKKIPAATKEKRRAKIMEIQASKSLNNKWLGKTIKVLTDGKNF--GRCEGQPEIDGLTYIPGKVLKVGEFAEVKINGAGKYDLRGVLICSCPNTT................................................................................ 454
75 0.000e+00UniRef50_A0A1W9XCL8 tRNA (N(6)-L-threonylcarbamoyladenosine(37)-C(2))-methylthiotransferase MtaB n=5 Tax=Desulfobacteraceae TaxID=213119 RepID=A0A1W9  ali  25  1..............................................................MQKFIITTLGCKVNQYESEAIAQSLKAAGWAQADREEPAGLCIVNTCTVTHKAAMQSRQAIRQIIRANPRIMVTGCYAQTEPDEKIEGIHDIVGHSDKHCIPEMVDSIVENWKSPSPAVTCHDISHERVFRQLPVTAFGSRTRPFLKIQDGCDAFCTYCIVPHARGRSRSMPPETVLEHITQLKAAGYHEAVLTGIHVGCYGLDFSPSLYSLLRRIHDS-EAIDRVRLSSVEPHELTTDIISL--VAESDILCPHFHIPLQSGDEQILKRMHRPYTKDFFRELVTRIHEQIPHAGIGVDTLIGFPGEDDAAFENTYALIRDLPVTYLHVFPFSPRKGTPAYTFDRVPSEIVKARCQKMRELGKKKAFYKNLIGQTADVLVEGRGPSDDFLKCVTPNYVPVLLSGQKNMKNTIVKARINELKDE.............................................................................................. 432
76 0.000e+00UniRef50_A0A1R3GG09 Uncharacterized protein n=7 Tax=Mesangiospermae TaxID=1437183 RepID=A0A1R3GG09_COCAP  ali  23  25............................................KLPSQPLNRIPTSELASKG-RIYHETYGCQMNINDMEIVLSIMKNAGYETVEAPESAEIIFINTCAIRDNAEQKVWQRLKRHWKSNPKVVVLGCMAERLKDKILKMVDVVCGPDAYRDLPRLLDEVDYGQKGINTLLSL----EETYADISPVRISKNSISAFVSVMRGCNNMCSFCIVPFTRGRERSRPVESIVKEVGELWKEGVKEVTLLGQNVNSYNKNMGLRFADLLDRLSTEYPE-MRFRYTSPHPKDFPDELLYL--MRDRYNICKLIHLPAQTGSTTVLERMRRGYTREAYLELVEKIRRIIPDVAITSDFICGFCGETEEEHADTLSLIKAVGYDMAYMFAYSMREKTHAHRVDDVPEEVKQRRLTELIEAFRGSTCYDAKLGTIQLVLVEGPNKRDTELIGKSDRGHRVSFNKRNPVVGDYVEVLITKTTRASLFGEALAITKLST................................................................................ 538
77 0.000e+00UniRef50_A0A1V5DAD1 Threonylcarbamoyladenosine tRNA methylthiotransferase MtaB n=15 Tax=Deltaproteobacteria TaxID=28221 RepID=A0A1V5DAD1_9DELT  ali  27  9................................................................RVAIATLGCKVNQYESAGIGEALARSGHALVPFSETADCYIINTCTVTARTNYQSRQIIRQAIRKNPEIVVTGCYAQTAPDEIIPGVSLIAGHGEKDRIPDLLGSLEKNGREIRVGD----ISPVRPFASLPVSRFQDHTRAFLKIQDGCNAWCRYCIIPSARGRSRSLSQDGVLEQLNLLGRAGYREAVLTGIHLGAYGQDLETSLVDLLKRIERERP-LERLRLSSIEPTEISDDLISLLRKSSL--ICPHLHIPLQSGDDAILSGMGRQYSAAFYKALLVDLEGAIPDLAIGIDVIAGFPGEDRASFENTRELIESLPVAYLHVFPYSPRPGTPAADMDQVPPDEKKRRAEILRDLGKRETFARRFQGRTLQVLVEERDRISGLRKGFSGNYLPVHINSRASQVNSLITVRLEGFEGTRILGRVLSP..................................................................................... 442
78 0.000e+00UniRef50_A0A2D5TW78 tRNA-2-methylthio-N(6)-dimethylallyladenosine synthase n=14 Tax=Proteobacteria TaxID=1224 RepID=A0A2D5TW78_9PROT  ali  25  1..........................................................................MNEYDTDKMFELLRAQDFTPAISMEDADLVLLNTCSVREKAEQKVYSELGRMRRLKKKIGVGGCVAQQEGAKILKRVDFVFGTDNLIELPEILRESDNGERTVHINRLAPRQKVRDFIPEFPSSASHLPLKAHLAITKGCNNYCSFCVVPLTRGTEVSRSPQNILEEAIKLCRNGTRELCLLGQNVNSYQAD-GVDFVELLKNL-DDITGLQRIRFISPHPKDFHPQLAD--AMADLPSVCEQLHLPLQSGSNSVLKRMRRWYTTQTYLEKVEMFCRRMPGGTISTDLIVGYPGETEEDFQNTLEMMQRVRFDLIYAFKYSIRPGTRAADEEHLSEEIKTERLRILLETHELILKEKHLLGSQQEILVEGPHRETDSMSGRTRGNHSVVIRNTDAPSGSLLPVRITGYRTHLLEAEAI....................................................................................... 427
79 0.000e+00UniRef50_C1ECD6 Uncharacterized protein (Fragment) n=2 Tax=Eukaryota TaxID=2759 RepID=C1ECD6_MICCC  ali  23  2...............................................................KNVYVETYGCQMNVNDSEVMLSVLKDRGYDETGDMHDADVILVNTCAIRDKAEAKIWQRLAYFKSEKPVVGVLGCMAERLKTQLLEAADLVAGPDAYRDLPNLIEAVAGTGEKAMNV----QLSVEETYADIIPVRKEGAHAAFVTIMRGCDNACAFCIVPYTRGRERSRDPASIEYEVRLLSEQGVKEVTLLGQNVNSYRREGAVQFAALLDR-VAAIDPEMRVRFTSPHPKDFPDEVLEV--IARRPNVCNCLHMPAQSGSTATLERMARGYTREAYLTLIDRVKEIIPGCAITTDIISGFCGETEEDHADTVSLMKAVGYEQAFMFAYSERDGTSAARHDDVPEDVKQRRLAEVIDAFRTTAAERQKVGRTHLVLVEGPSKKNERLTGKTDSDTPVGIYGGDERAGEYVAVRVTGCSTGTLFGECLGRTTLTA................................................................................ 494
80 0.000e+00UniRef50_A0A2E2AFP4 Ribosomal protein S12 methylthiotransferase RimO n=8 Tax=Nitrospinae TaxID=1293497 RepID=A0A2E2AFP4_9BACT  ali  24  1..............................................................MKKVGMVSLGCPKNTVDSERVMGDLASSGFKLTQNDKDAEVIIVNTCGFIESAKKESVDTILEMARHKKQLIITGCLAERYGQELIPEIDHMLGVGQYPQLKNIIEEVDPLSRNHVATPAEYYESYTDRLLTTAF------YTAYLKISEGCSNRCAFCIIPKMRGPMRSRSPESILAEAEHLAHKGVKELNLISQDTTMYGFDLGDGLVRLLAEM-AKVEKLQWIRLLYCYPTFLSSEMIEF--IASEPKVCSYIDVPLQHTHDEMLKRMKRQETEDGVRRMLDEIRLKIPNVALRTTFITGFPGETETHFQHTVRFLSEVEFDHVGIFTYSDEEGTTAFEYPNVPQEVKEERRNILMEFQKEIALRKNQVGKVEQVLVEGFDPENYLMTGRPDIDGQVILEKCEAEPGEIIPVRINQVVDYDLLGEP........................................................................................ 438
81 0.000e+00UniRef50_UPI00094E7E06 tRNA (N(6)-L-threonylcarbamoyladenosine(37)-C(2))- methylthiotransferase MtaB n=1 Tax=Colibacter massiliensis TaxID=1852379 Re  ali  29  1..............................................................MPTIAFTTLGCRVNQYDTDSMRSLFFAEGFTETDFNGRADVYVINTCSVTHMGEKKSRQIIRRAKKNNALVVVTGCYAQLSPDVLIPDVDAVIGTNERKNIVTIVRSLLGRAKAEAVLAVHDVMGRDTFEEIPLYPSAVEHTRADLKIQEGCNNFCSYCIIPYTRGSLKSRRPDAVIAEAKRLVSFGFREIVLTGIHLGAYGIDLPERPTLALILRRLLAEDVARIRMGSIESVEISDDLID--AINSSPRVCPHLHLPIQSGSDAILSAMHRRYTTEEYINLVRRLHEKVHGLTVSTDLILGFPGETDERFAETVKALEQLNFSHIHAFPYSPRQGTPAAVMGQVSGDVKKKRVEQINAMSQKEAILDGMIGQEVQVLLESV--ENAMGEGFSEHYERVRAEVPADYEGRIINVLLTGRDGSVLTGNI........................................................................................ 434
82 0.000e+00UniRef50_A0A2M6X582 Ribosomal protein S12 methylthiotransferase RimO n=1 Tax=Bdellovibrionales bacterium CG10_big_fil_rev_8_21_14_0_10_45_34 TaxID=19  ali  25  2.........................................................SEITENKKVHFVSLGCPKNLVDTEIMLGSLSRQNYSVTENPGEADTIIVNTCGFIDESKRESISTVGELKKNGKNLVVAGCLTQRYKDELIPEADLFVGSGEFQNIAEILKNREAGST----EKRYFNLPTFLQNEATPRINSQMPHRAYLKISEGCKKRCAFCAIPLIRGNLQSRTIPAIVAEAKLLVASGVREVIVISHDFTDFGWDLRRQNPEALLKALSEIPGLDWIRTLYVYPDGIDQKLIDLIK--SKDNLVKYFDMPLQHISDSILKSMNRKMTRQLIEAALKMIREEIPEAVIRTQFIVGFPGETEENFQELLGFIKEQEFDRVGCFKYSPEEKTPGSRMDQVDEQTKQRRHDELMEVQQEISRRKHLVGKTVEVLVEGLSEETELLQGRTEIDGIVYLRDGHAEMGEIVRVKIVESMDYDLVAEIIEREPRRSPLTSNGRAR....................................................................... 469
83 0.000e+00UniRef50_A0A0S3QT62 MiaB family RNA modification protein n=1 Tax=Thermosulfidibacter takaii (strain DSM 17441 / JCM 13301 / NBRC 103674 / ABI70S6) Ta  ali  28  1...............................................................MKVAFYTIGCKLNQFETEVLRESFVKKGWEVVPFKEKADVYVINTCTVTQQADAKSRQSVRQALKRNPIVAVVGCYSQIVKNELLKGAQIILGSQEKYEVVKYIEEFLKNGSRPIV----EVSDIARKFTFTPIEDFAGYSRAFVKVQEGCNRKCSYCLVRIARGPSRSAPLESVVEEVKSLADKGFEEVVLTGTHLGAYGEDLGTNLLTLLHNLVD-IPGVKKIRLSSLEPTELDDTLIDF--ITTHPKIAKHLHIPLQSGSNRILKLMNRPYTREFFEELIQKIVEKNDIIGIGVDVIVGFPTETDEDFQETYDLIKNLPVYYMHIFSYSPRKGTPAYEMPQVRPDIKRKRWEILNELKQEKAFVQRFVGKTLEGIVESRSASKGHWSGLTENYIPLIIKEEPELAGKVKKFKIIEAFEDHALAEL........................................................................................ 429
84 0.000e+00UniRef50_A0A1V5X9I6 Threonylcarbamoyladenosine tRNA methylthiotransferase MtaB n=1 Tax=Firmicutes bacterium ADurb.Bin193 TaxID=1852885 RepID=A0A1V5X9  ali  26  1..............................................................MKTVRFYTLGCKVNAYETEAMRSLFEKRGYTLTE-ADTADVYVINTCTVTSMGGRKSRGMISRARRSNPVIAVVGCYPQVFPDEKMMDVDIILGTTDRAKIVDLVEEFCGSR-------IDAIREKPDSFYENITSDGQSRTRAIMKIQDGCENFCSYCIIPYARGPIRSRPIEDIKEEAEALSKSGFTEVVLVGIHLSSYGRDIGLSLTDAISEVC-KTEGIKRVRLGSLEPGILTDKFLR--EISSFDKLCPSFHISMQSGCDETLKRMNRKYTSDEYLNAVGRLKETFEGCAVTTDVMVGFPQESDEEFEKSCETVRKAGFAGIHVFKYSKRKGTVAAKMEQIDPAVKAKRSQIMIDIGESLKKQNALIGKTEEVLFE--DKSGECFEGLTKTHIKVRCKGDD-LYGKYKSSIITEYKDGCLYGEI........................................................................................ 422
85 0.000e+00UniRef50_A1VF04 tRNA-2-methylthio-N(6)-dimethylallyladenosine synthase n=86 Tax=root TaxID=1 RepID=MIAB_DESVV  ali  24  1............................................................MHDRTFHIETFGCQMNVNDSDWLARALMERGFSPAPFGE-ARLTIVNTCSVRDKPEQKVYSLLGRIKKPDAFVAVGGCVAQQIGSSRFPQVRLVFGTDGLAMAPQALDRLVEEPDLKLSLLDFSEDYPERDAVLGQGAV---PASVFVNIMQGCDNFCAYCIVPYTRGRQKSRATGTILDECRALLDRGAREITLLGQNVNSFGQDSGTTFAQLLHK-VAALPGLERLRFVTPHPKDIAPEVVE--AFGTLPNLCPRLHLPLQAGSDRILKLMGRRYDMARYLRIVDDLRAARPDIVLSSDIIVGFPGETEEDFMETMGALETVGYAASYSFCYSDRPGTRAEMLDKLSREVKLERLERLQTLQNRLTERQDMVGKKVEVLLEGMSRKPGSWQGRDPYGNLVNVPQGSDVRGRFLPVVVAQAKKHSLLAE......................................................................................... 443
86 0.000e+00UniRef50_A0A1W9P5I0 tRNA (N6-isopentenyl adenosine(37)-C2)-methylthiotransferase MiaB n=1 Tax=Candidatus Omnitrophica bacterium 4484_213 TaxID=196852  ali  27  11.............................................................SPKKVHIRTFGCQMNEYDSEVIKTNLLQRGYLFTEESEEADVILVNGCSVREHAEERLWRNLRRLREEKPELIVLGCIAQNHKEKRFPFVNLVCGPHNLPEIFNHIEN-LNSRTRILAVDEEERDLENFHLTSTPGVEGGSPRRGYVLIMSGCNNFCSYCVVPYLRGREKSRRMESILEEVRMLVESGHEEITLLGQNVNSYRKNNKNDFVELLRE-VNKIDGVEKISFATSHPKDASEEL--FKAMRDLPKVDKYLHLPFQSGSNRILKLMRRGYTREDYLGQIKKLKEILPQCKISTDVIVGFPGEREEDFQETKELMEEVKFDNAYIFKYSPRPGTAAARLDDVPLEIKKERNQVLLELQKRIARRKN................................................................................................................................................... 396
87 0.000e+00UniRef50_R7DMN1 tRNA-I(6)A37 thiotransferase enzyme MiaB n=1 Tax=Coprobacillus sp. CAG:826 TaxID=1262857 RepID=R7DMN1_9FIRM  ali  26  4................................................................TYLIVTLGCKVNTYESEALKEALENRGYK--EDKKNPKVVIINTCSVTSVSDQKCRQKIRSLIKPNTIFVAMGCYVQMASGYLIPGVDILVGTSMRSKIPDLIEEYEKNGKLIDIVSKVDKNEKYENL---GISSFHDNTRAFLKIEDGCDNYCSYCVIPYARGEVRSRKKEDILLEVGRLIQNGFQEIVLTGIHTGGYGKDLNYHFSDLLEDILKTYPSLHRLRISSIEESEIDDKMIAL--MKEYPTIANHLHIPLQSGSETVLRRMNRKYDKKAYLEKLKKIREVRPDISITTDIIVGFPKESEEEFMETYEFAKACSFSKIHVFPFSSREGTPASKMPQVDPTIKKERVHRLLTLSNELAYESRFIGQEIEVLFEEYDEETKINKGHTSNYLLVTVLCEKNLHNHIQKV...................................................................................................... 417
88 0.000e+00UniRef50_A0A1F8N2S3 tRNA (N(6)-L-threonylcarbamoyladenosine(37)-C(2))-methylthiotransferase MtaB n=1 Tax=Chloroflexi bacterium RBG_13_56_8 TaxID=1797  ali  25  1...............................................................MRFYLTALGCKLNQAEIESLARKIAMCGHQVAARPQEGDWAIINTCSVTHIADRKSRQLIRRLHRPHMRIAVTGCYAELAPDALIEGVDLIIPNAAKDSILQ-----------QVLASSSVSAGQVSFTEPEVGRLPIGRTRAWVKIQDGCDNRCTYCIVRVARGAQQSRPPGEVIKEIQRRSAQGYQEIVLTGVHIGAYGRDRGWNLAHLVRTILEE-TGIPRLRLSSTEPWDFGEELLDLWEDA---RLCRHIHLPLQSGCDQTLQRMERKYTTQRYGKIVDAIRRRIPDVSLTTDVIVGFPGETDAEYRTTLSFVERMAFSRLHVFRYSRREGTLAINMPQIPSALAQARSGELIALGQRMAFHQKFVGKKVQVLFEGEGGKESIWQGLTDNYLRVYVRCEKHLANTPAEVLCLSADETGLRGELVSQ..................................................................................... 435
89 0.000e+00UniRef50_A0A1F3RLS1 tRNA-2-methylthio-N(6)-dimethylallyladenosine synthase n=3 Tax=Bdellovibrionales TaxID=213481 RepID=A0A1F3RLS1_9PROT  ali  27  2..............................................................NQKFYIKTFGCQMNVADSERMAALLAGLGMDPADEIEQAQVIIINGCSVREKAVHKAVSQLGELQLLKPIIGMGGCVGQLDQKELFPYLDFVFGTDTIDNLPEILHRVRSGERHVIYTD-----FDPSMDYSTETKIHTASAQAFVNIMKGCDKYCTYCIVPYTRGREKSRTIDEVVNDVARLVATGVREVTLLGQNVNSFGKEGEENFPQLLRAIDSRCSALKRIRFTSSHPLDFSEELIECYAPPEQTRLASQLHLPVQSGSNSVLQKMGRHHKVEQYLSQMEHLRKLRPDVGLSTDLIVGFPTETDEDFKATLELLDRLQYDGAYAFAYSPRPGTRAAKMDDVPDSLKRERLNILLSHQLKISRYAAFIGKRVEILVEGEAKNQNVWTGRTSCFRIVNFLVPEDLTGKFLEIEITGSTSLTLQGKL........................................................................................ 510
90 0.000e+00UniRef50_A0A1W1ZCI9 Threonylcarbamoyladenosine tRNA methylthiotransferase MtaB n=6 Tax=Clostridiales TaxID=186802 RepID=A0A1W1ZCI9_9FIRM  ali  26  1...............................................................MKVYFYTLGCRVNQYETDAARELFIKAGFGIADSAEDADVCVVNTCTVTGEADRKSRQQLRRMARINPIVVAMGCMTEMA--EAVIDADVVCGTKDKTLVVEYISRKSGGESSRGVMHHRPEVTKTDEYHEFGTVLSPEGTRAFIKVEDGCNKFCTYCIIPFARGRVASRAEDAVLKEAQDLASRGYSEVIVSGIHVCSYGKDRGEDLVRLLKKI-DAIEGISRIRLGSLEPMSLTDDFIEGLKGVT--KLCPHFHLSLQSGCDKILKKMNRDYTSDEFLERVSKLRSVYPTMSLTTDIICGFPEETEEDFKETCDFVIEAGFTKVHTFPYSEREGTVAAKMPQVPVNVRKDRASRLIAVSNELEFAAKKVGSAASVLIE--TFKDGYAEGYTPEYIRAKVRTDNSLKGKTVSVKAVRAEENTIICELMANG.................................................................................... 438
91 0.000e+00UniRef50_A0A0N0RF80 Ribosomal protein S12 methylthiotransferase RimO n=2 Tax=Chloroflexi TaxID=200795 RepID=A0A0N0RF80_9CHLR  ali  24  1...............................................................MKYHVVTLGCAKNIADSEGIGTLLRAAGYEP-GTPDEADVLIVNTCGFLQAARQESINALGERKKPGQLLVAAGCLSERYGAALADEVDGIIGTQQWTRIADFIQQ-LREREEEARWRAYAMPPDARNHVADSVSRRAEGHSAYLKIADGCSAPCAFCTIPSFKGPQRSKRPGTVIREAQELVAQGVQEIVLVAQDLTAYGRDWGETLPTLLEHLMQEVEGDVWFRLMYAYPGHATERLIEV--MARHERICNYLDMPLQHGDPNVLKRMRRPHKLERIYRFFEQMRDAMPDVSLRTTFIVGYPGETEEEFQNLLDFMSAVQFDKVGVFTFSPEPGTPAAELDQIPEEVKQERWERAMAHQQPIALARQQLGRTLEVVVDGYDAENGLTLARSEVDGYVLVRGQYD-PGERLTVRITGAMPYDLEGRVVKRKPRRTPPPHPAAISLDAIGVRES.............................................................. 465
92 0.000e+00UniRef50_G0VNX9 Ribosomal protein S12 methylthiotransferase RimO n=13 Tax=Veillonellaceae TaxID=31977 RepID=G0VNX9_MEGEL  ali  27  1..............................................................MEKIGFVSLGCSKNLIDTEVMLGILRDRHMEITEDLSQADIIIVNTCTFIEKAKQESIDTILQAARYKKILIVTGCLSQQYKQDLMPEIDALLGTGSWDRIWEAIDTVKKGRKACYMDDVSHLYNQNTSRLRTTP-----KYSAYVKIGEGCNNGCSFCIIPHVRGKLYSRPVDSVVAEVQQLAADGVKEINLIAQDTTSYGVDLAGHLPELLRQLV-KIDGIRWIRLFYLYPHYFTDELMDL--IVKEEKICPYVDLPLQHISQTVLQRMNRRDSEEDVRRLMKKLCSHGRKLTLRSTFIVGFPGETEEEFQELCKFVKETEFDDVGVFTYSQEDGTPAALMDQIPEEVKEERYHQLMAIQAKVSRNQELEGSVHTMLVEKVEEEKGQAVGRPDVDGLTYLEDAQGQPGDMIPVRIAQGFAYDLVAERID...................................................................................... 444
93 0.000e+00UniRef50_I0GIM5 tRNA-2-methylthio-N(6)-dimethylallyladenosine synthase n=5 Tax=Caldiserica TaxID=67814 RepID=I0GIM5_CALEA  ali  27  1..............................................................MRTFAIVNFGCQMNEYESEKFREVFYDFGLSEVSNIEEADIVLFNSCAVREKSEQKLISSVGYARSLRPYVIVTGCVASI-REKRIKEVSLLVLSKGYELIYERVEELRNELSKYLKQSSSERISE------------GGGVFAYVPVIFGCNSFCTYCIVPATKGREKSRPLEDIIEEVKNLVNSGVKEIVLLGQNINHYGYDFGNKFIELL-EAVSRVPNLKRLRYLTPHPAYFTKELIK--RMRQVEILMPHFHLPVQSGSNKILSLMKREYTQEQYLGIIETIKEEFPEAAITTDIIVGFPQETDRDFLETVELVKTVRFDKSFIAAYSKRPNTPAATMDQIDTKVKKERLNYLLKVQNEISLEKNYIGKTYDVLVENV--RENIAFGRIPQDKLVIFDSSEVRPGDLVNVLITDADFIHLKGK......................................................................................... 424
94 0.000e+00UniRef50_A0A0G1DX64 tRNA-2-methylthio-N(6)-dimethylallyladenosine synthase n=1 Tax=Candidatus Peregrinibacteria bacterium GW2011_GWF2_43_17 TaxID=161  ali  24  1...............................................................MKYYIETYGCQMNYSDTERLKTLLESYGFKESKKREAADFIIFNSCSVRQKAADRVYGEMAELRKKKKDLLVTGCMVHKGKEQKMEELDIAFRPEDMCHLAGRIRELR---------PKWRLCETDLDGYFEIAPKTSNKYQVSVPIMTGCDKFCTYCIVPYARGREKSRPLNGIVAECKKLVKAGAKEITLLGQTVNSY-----STFVKLLCEI-DKLKGLNRLRFMSAHPKDFSDDLIKTLS--RLKTICPYIHLPVQSGSNSCLRRMNRPYTREKYIEIIKKIRKAIPNCAISTDIIVGFCGETEKEFKDSCALYEELHFDMAYLSQYSTRKGTFAAKKDDVPKKIKAERWHYLNQVLKKHSLNKKYIGQTVEVLIEKQTAKE--LIGRSREYKEVHFDKKKKWIGEIIKVKVENVREWELYG.......................................................................................... 425
95 0.000e+00UniRef50_W2BYL4 Ribosomal protein S12 methylthiotransferase RimO n=12 Tax=Firmicutes TaxID=1239 RepID=W2BYL4_9FIRM  ali  28  1...............................................................MKVYFNTLGCPKNINDSEIAMGNLEEKGFTIVESPDEADAIIVNTCGFIEDAKKESIDEIFNMKEKNKKLVISGCLVQRYADELIPEANGFIGVNDYDKLPKLLEELEKSNERFLENSSCDLS----EVEVKIRHLTENPYTSYLKIAEGCDNICSYCIIPEIRGPYRSRTIENVIEEAEMLSKSGCKELILIAQDLTYYGIDNYGKLSTLLRKLC-KIEGIEWIRLLYCYEERIDDELIRT--IASEDKICNYIDIPIQHASDKILDNMNRATTNKSLYRTLSKLRSQIPDIHIRTTLIVGFPGETEEDFNILSDFVSDQKFSRLGVFTYSREEGTAAATMDQIPEDIKQERLDCIMMKQMEISLNRKKIGKTLDVIVDSM-EEEGVYSGRTRYDAPVVFTSNSHKPGDIVPVEILEAYDYDLEGREV....................................................................................... 438
96 0.000e+00UniRef50_A0A1W6WCN0 Ribosomal protein S12 methylthiotransferase RimO n=10 Tax=Clostridiales TaxID=186802 RepID=A0A1W6WCN0_9FIRM  ali  24  5.................................................................VGIISLGCAKNQVDGEVMLASLENAGWQIKDDAALADVAIVNTCGFIQSAKQESINEILELARLKKEIVVTGCLAERYREQILPECDAVCGIGANADIDAVCRAALAGSRPESFPEKEKLPLCGERRLLTP------SYYAYLKIAEGCDNRCSYCAIPFIRGRYRSRPMEEIVVEAEKLVKNGAKELTLIAQDTTKYGWDLYGHLPALLTRLC-KIDGLQWIRFLYCYPDYLTDDLLDV--MAKEPKVLPYIDLPLQHCSGRILKAMHRWGDREKLTQLIAHIREKLPDVTLRTTLITGFPGETEEDFTQLCEFVKEIQFDRLGCFPYSQEEGTEAAQLPQIDSDVKGHRAELIMEGQMEQAAGEAMVGSIQTVLCEGWDRYVNCWFGRTDIDGKVFFTVPQGTPGSFVPILITNCIDGDLVGEL........................................................................................ 445
97 0.000e+00UniRef50_A0A254W7Q2 tRNA-2-methylthio-N(6)-dimethylallyladenosine synthase n=6 Tax=Terrabacteria group TaxID=1783272 RepID=A0A254W7Q2_9CYAN  ali  25  4............................................................PDPRRYFVRTFGCQMNEHDSERIAGLLEADGLSPADAVEDADVVVLNTCCIRENADNKLYGTLGHLKNPDLQIVVGGCLAQKDRDEKAGHVDVVFGTHNVSRAAELIAEARE-RGPIVEILEAAVSDDADSFPSALPVTREVPWAGWVTIQIGCDNSCAFCIVPSVRGEEISRPFGDVVGEVQRLADDGAIEVTLLGQNVNSYGRDLATSFADLLRAAGA-VEGIERVRFTSPHPKDLRPDVI--AAMAEVPEVCEHLHLPLQSGSDAVLAAMHRGYSAERYLDRLAAARAAVDDLAVTTDIIVGFPGETEADFEQTLAVAAEAQYDAAYTFQFSPRPGTEAAEMQDVPADVVAERFARLMAVIERAAKAAARVGRTEEVVIEGPSKRDSVLTGRTRQNKLVHLADAPSLPGTRALAEVTRAGTHSLRGRLLEVVAPARHRTRIPVTAG...................................................................... 491
98 0.000e+00UniRef50_A9V6X7 Predicted protein n=1 Tax=Monosiga brevicollis TaxID=81824 RepID=A9V6X7_MONBE  ali  22  72...................AADGPGFEDFLRQSSTPLADKADPDKYRPRDAPYAPIDEQSLLGRKVHIEAYGCQMNVSDAEIAWSILKNAGCVRCDTAEEADVTLLVTCAIRENAENKIWSRLNQLKAHKRRIGVLGCMAERLKHKLLEQIDLVAGPDAYRDLPRMLMDSAQGQAQVNVLLSLDE----TYADITPVRTNPNSPAAFVSIQRGCANNCSYCIVPFTRGRERSRQIETIVEEVAHLSRQGVKEVTLLGQNVNSYGIDGGRGFGELL-RAVAEVDPTMRIRFTSPHPKDFPDDVLE--AIATTPNICKQIHIPAQSGSTRMLELMRRNHTREAYLDLVQHMRQVIPGVALSSDFIAGFCGETEADHEDTRSLIEMVDYDMAFLFAYSMRAKTHAYRMDDVPEDVKKRRLEEIRDQFYGGAKNQRRIGSLQLVLVEKRSRRNDEWSGRTDGNIRAVFTDAEVPVGEYVVVQIEGATAMTLRGRPLAIVEQPNLSVLESF......................................................................... 604
99 0.000e+00UniRef50_J9K0E8 Malate dehydrogenase n=34 Tax=Bilateria TaxID=33213 RepID=J9K0E8_ACYPI  ali  60  4.......DDVGDIEDLISSADVAEIGRVKPRNIVSLRPKVK-----VKPVREILHPPSQVPGTQTIFIKTWGCSHNSSDGEYMAGLLSNYGYKITEDKAIADLWILNSCTVKNPAEDHFRNEISTGKKSGKFVVVAGCVPQGDQKSPFIQNLSVIGVQQIDRVVEVVEETLKGHTIRLLGQKKINGKKDGGARLQLPKMRKNKLIEIIAISTGCLNQCTYCKTKHARGNLGSYPPDEIVQRAIESFNEGAVELWLTSEDTGAYGLDIQTNLPELLWRLVAIIPEGCMMRIGMTNPPYILNHLEEIAKILSHPRVYAFLHVPVQSGSNQVLADMKREYSIEEFETVVNFLRQRVPGVSIATDIICGFPTETEEDFSETMSVCEKYKFPSLFINQFYPRKGTPAARMPKIPTDMVKIRTKRLTELFHSYTTYDHRIGEIQEILITEEAKNGIEFIGHNKYYEQVLVAKDPELMGKCIEVIVKSAKKHCLIAEMVDKPR................................................................................... 488
100 0.000e+00UniRef50_A0A1G3WMB4 tRNA (N(6)-L-threonylcarbamoyladenosine(37)-C(2))-methylthiotransferase MtaB n=1 Tax=Tenericutes bacterium GWF2_57_13 TaxID=18023  ali  26  1...............................................................MKAAFLTLGCKVNSYETEAVAELFKTQGYEIVPAEASCEVVVINTCMVTNTGEAKSRQTIRGAIALHPIVVVMGCYSQLQSEKAIDGVCVVLGTKDRHLAPRYVDEYRRSKTTLVRVDPVGEGDAFEGM---TIQAFARHKRAFLKIEDGCDNFCSYCIIPYARGRVRSKDPAAVLSEAKYLAAHGFAEIVLTGIHTGGYGKDLKNRFADLLREL-AAIEGLLRIRISSIEISELSDDVIDIL--AAYPVFADHLHIPLQSGAERILKAMNRRYTKADYERKIAELRDRIPGISITTDVIAGFPGETEADFQEMLAFIREMRFSELHVFPFSKREGTMAAGLPQVEGPEKKRRVAALLALSDELAQAYENVGKTFVAIPE--SFDAGTLTGHTGNYLRVRFQGVESLLSKPVRIRLLGAS................................................................................................ 420
101 0.000e+00UniRef50_A0A151AQK4 Ribosomal protein S12 methylthiotransferase RimO n=14 Tax=Firmicutes TaxID=1239 RepID=A0A151AQK4_9CLOT  ali  24  1............................................................MAKYKVGLISLGCDKNRIDSELLLGKLNEKN-EIVNDPNKADILIVNTCGFIESAKQESIDAIIEMADYKKKLIATGCLTQRYSEELIPEIDIMLGVNEYANIQKYIDNFFNANKNKICVCDYSDISINEGKRILTTK----SHTAYIRISEGCDNLCTYCIIPKIRGKYRSRSIESIVSEANELVSMGVKEIILVGQDTSVYGVDLYKKLHELIRAI-SKIENLEWIRVLYTYPEEITDKFID--EIANNNKVCKYLDIPIQHISNSVLKRMNRKSSKELITNNINKMRSLINGLVLRTSLIVGFPGETEEEFNELKEFVKNIKFDNLGVFKYSQEEDTPAARMDQVSEEIKDNRLEEIMMIQQGISKEKNKIGKIYKVIVEGK-ENGDYWFGRSEIDGAIFFKCDKILIGDFIDVLITDALEYDLIGVV........................................................................................ 440
102 0.000e+00UniRef50_A0A1V4QJP4 Ribosomal protein S12 methylthiotransferase RimO n=4 Tax=Deltaproteobacteria TaxID=28221 RepID=A0A1V4QJP4_9DELT  ali  28  6..............................................................PQTIYPVTLGCAKNRVDTEIMLGLLSQAGWEVVETPTEATLLLVNTCGFIAPASQESIDTILELADYKKRLVVSGCLAQRYHQELIPEVDAWIGVNDFPRIVSILADLDRGPGPLTCCQA-----PLYNYPELLPRLRTTPFRAYLKIAEGCSHRCTYCTIPQIRGPFRSRSQEVILQEALKLTGQGVVELTLVAQDTTFYGLDRGCRLAELLRRLC-QVPGLRWLRLLYSHPARISSELLAV--MADHPQICPYLDIPIQHVNDRLLQRMGRGYGQKVICQTIARIRRVFPQAALRTSVIVGFPGETDAQFNELCQMVEQIGFDSLGVFAFQCEDRTPASHYDQVPSWVARQRLRKLMAVQARKQRLRALIGSVQEVLVEGPSPETELLSGRPEVDGQVYITAGTGQIGQIQPVRITAAHTYDLVGELIDPPQ................................................................................... 451
103 0.000e+00UniRef50_A0A2E6ML21 tRNA-2-methylthio-N(6)-dimethylallyladenosine synthase n=8 Tax=Gemmatimonadetes TaxID=219685 RepID=A0A2E6ML21_9BACT  ali  24  7...............................................................KRAYVETYGCQMNISDGELMEGILEHSGYLIVGSPEEADVVLVNTCAIREHAEKRVLGRVSQLNKPDLIIGVTGCMAQRIGSSLLPYVDIVMGPDGYRGLPETLRRLVXSESKKRGPQLAVLKLDIDENYQGLEQRRQDGPSAWVPIQRGCDHRCTYCIVPYVRGGEKNRPSDEVLDEVRRLADRGVTEVTLLGQTVNSYQW-GDLLFPELL-RLVAQVDGIRRVRFTSPHPRDVNELLVEV--MATEAAVCEQLHLPAQSGNNRTLKRMLRRYTVDMLLDKIDMVRNSIPDIALSTDIIVAFPGETEAEFRDTLDLMRTVRFDEAFTYKYSLRDGTPATRFPEIASEEAQARLAELIEVSRQIQINSSEVGRVEEVLIEHEGRDPGQVRGRTRRNKVVVFDGDVARVGDYAHALLERTTGATFSGSEVAYSKP.................................................................................. 474
104 0.000e+00UniRef50_A0A2H0T9W0 tRNA (N6-isopentenyl adenosine(37)-C2)-methylthiotransferase MiaB n=1 Tax=bacterium CG10_big_fil_rev_8_21_14_0_10_33_18 TaxID=197  ali  25  7................................................................KYYIWIIGCQMNKSDAERVVSVLNDLGFERTEDEKSADLIIALACSVRQTAIDRIYGKAKKWIKKNRKLILSGCVLDADKPKMGKIFDYLFNISDLSKLPLLLGESDSVRCQ---------------DYFKIKPIYESYFSAFIPIMTGCNNFCTYCAVPYTRGREKYRERQEIIKEILGLVKKGYKEITLLGQNVNSYGINNKNNFAELLRE-VNKIPGNFWIRFLTSNPHDMSDEIID--AVAESKKICEYIHLPVQVGNNEVLKNMNRKYTREHYLELIEKIKTRIPGVAISTDTIVGFPGETKEQFKDTIDIYQKVGYTMAYIAQYSPRSGTVSAKMDDVSREEKKRRDKELTSILEKTALNEKYINETIDVLVD--LKKKDYLYGRTRTYKLVQFKGEEDLIGNFVKVKISSVTPWAMKGDIIE...................................................................................... 445
105 0.000e+00UniRef50_A0A2H6F3C2 Threonylcarbamoyladenosine tRNA methylthiotransferase MtaB n=2 Tax=unclassified Bacteria (miscellaneous) TaxID=49928 RepID=A0A2H6  ali  26  7...............................................................MKVAIATLGCKVNQSESASIEGVLRNNNYEIVKHTDNPDVCIINTCTVTAKSDYQSRQMIRKIARSGAKVIATGCYAQLKPDELIEGLALIVGNSEKERLISYLEDIPDNGIRSNKSAKCRISVRPPAAHLSAQPYHSSRSRAFLKIQDGCSFSCSYCTVPLARGKSRSLNPQDILSSVEKLRSDGYKEIVLTGIHIGSYGLGLESSLLDIVKEIT-KIYPEVRIRLSSIEPQEFDEEFLSLIK---NRNVCPHLHIPLQSGSDTILKAMNRGYTTLYYKQFINRIVTAYPDISIGTDVITGFPGETDKDFNETVKFIDRLPLSYLHVFPYSKRPDTKASSFNQINDKLKKERVKLLIEIGESKAYIKRNLGCILDVIVEKKSAIDRYYTAISDNYLKLLVKSDNLTSGDNLKVRVISLTDTGLIAEPL....................................................................................... 438
106 0.000e+00UniRef50_A0A0U5NQ23 Threonylcarbamoyladenosine tRNA methylthiotransferase MtaB n=52 Tax=Clostridiales TaxID=186802 RepID=A0A0U5NQ23_9CLOT  ali  25  1..............................................................MKKVALHNLGCKVNAYETEAMQEMLETAGYKIVPFKEGADIYIINTCTVTNIADRKSRQMLHRARKMNPQVVAAGCYVQTQ-EEPDPCIDVVIGNNKKQDLLSILEEYDYDKDTIIDINHTKQYENLHL------SRTGEHTRAYIKVQDGCNQFCSYCIIPYARGRVRSRVKDDVIEEVKRLAQNGYQEVVLTGIHLSSYGIDFKDDEENLLIQAVHNVEGISRIRLGSLEPRIITEKFVQT--ISTLPKMCPHFHLSLQSGCDDTLKRMNRRYTSGEYYEKCTLLRKYFDNPALTTDVIVGFPGETDEEFEESKAFIEKVGFYETHVFKYSKRQGTKAAVMEQIPEQTKAGRSDILLALHERQAYEKSFVGEIMQI-------------GHTREYMKAALKTKENLQNHIVKVQIE................................................................................................... 418
107 0.000e+00UniRef50_A0A101HBH7 MiaB family protein n=1 Tax=Clostridiales bacterium 38_11 TaxID=1641393 RepID=A0A101HBH7_9FIRM  ali  30  1...............................................................MNVSFYTLGCKVNQFETEAMTQLFRDAGFDIIQPGEESDVFVINSCTVTAASDKKTRNMVSRFKRLNKIIVLAGCYAQSKQEDLKSNINIIIGTKYKDRVVEYVNEHLETQSVVFKVDDFKAGENYENL---TITHTEERTRANIKIQDGCRQFCTYCIIPYVRGPVRSREINDVLDEIIQLHRNGYLEIVLNGIHITSYGLDLYTNLIKLIKAINDNLKGV-RFRLGSLEPRVISEALIQAMKKGD---FCDHFHLSLQSGSDSVLERMNRRYTVRDYYNKVKLIRDHMPDVGITTDIIVGFPGETEKEFEETCSFVEKVKFSKVHVFPFSPREGTKAFHMDQIPGKIKKERTNRLIGLCDRVAFYETFKGRTVDVLYEQQYKKS-YYIGHATNYLTTHSVSADDLHNIRKNVLVSSIGNHTLITEEVT...................................................................................... 431
108 0.000e+00UniRef50_A0A1G3KPC1 tRNA-2-methylthio-N(6)-dimethylallyladenosine synthase n=1 Tax=Spirochaetes bacterium GWB1_36_13 TaxID=1802174 RepID=A0A1G3KPC1_9  ali  25  1...............................................................MQFFFETYGCQMNLSDSFEVEQELIKQGWKKTDNVNHADAVLINTCSVRKTAETRIIGRLGFYKKKNLTLLVMGCFAQKDGDKSYPFIDLIIGTQNKNKIPELLNAVKKHKPKKAVFNQFEDHFDFMEPSID----HQAFFRAFLPIIKGCNNYCSYCIVPYTRGREVSIQSSFLLDELKKLIDKGVSEVFLLGQNVNSYGKDIDINFSELLLKI-SKFKEIKRIKFMTSHPKDFSDELI--HAIETIPQVVKHVHLPLQTASNRILKLMNRKYTFEDYQLIIEKLRKKIPDISLSTDILSAFPGETEEEYLQTFEALRTLQFDKAFIFLYSPREGTAAYPLKELNQKEKKLRVHHMVELQNQISFEKRFLHTYQEVIPEKISRKNGFLMGNSHFDTKVIFQGDESDFGKMIQVKIKDVKGMSLIGE......................................................................................... 433
109 0.000e+00UniRef50_A0A2E9QSB4 Ribosomal protein S12 methylthiotransferase RimO n=1 Tax=Deltaproteobacteria bacterium TaxID=2026735 RepID=A0A2E9QSB4_9DELT  ali  27  131........................................RSRIPSEGRYRHLLNVQRKIMTSKKIHFVSLGCPKNRVDSEIMLGLARQEGYQLVEHPEEADLLVVNTCSFIEPARKESVDNILELAEIKKKLVVSGCLAQRYPNELLPEVDHFLGTGQIPRFAEILQEIQGTPK------DLASGAPGWLYTHDSPRMQSTPFTSYVKIAEGCDRTCAFCAIPSFRGKQKSRPIASIVEEVQELCSRGVREINLIAQELNGYGRDLPKDLADLLEALEQVEPGPKWIRLMYLYPYGFSERLVQ--QIASSSRVVPYIDMPLQHISDNVLRSMRRAGNGQDVRKLLASLKEAIPQLTVRTTFLVGFPGETEADFQELYDFLGEQSFDRVGIFRYSPEEGTAAYTYDQVPEDVAEERRRLLYERQAELSHKKRFMDQEIEVLVEGISDESDLLQGRPEIDGVVYINDGVASPGDIVKIKVEQTGEHDLVGGIIEHATPPSPVATSPQPADITSSVDTP.............................................................. 628
110 0.000e+00UniRef50_A0A173XQH2 (Dimethylallyl)adenosine tRNA methylthiotransferase MiaB n=67 Tax=Bacteroidetes TaxID=976 RepID=A0A173XQH2_9BACT  ali  24  1............................................................MQQRRVNFHTLGCKLNFSESSTLAREFEEGGFVRVAPDAEADICVVNSCSVTEHADKKCRNLIRKLHRRNPIIAVTGCYAQLKPQEIIEGVDIVLGNNDKGDLYKRVLELPGKGRAQVYSCDADSLTSFFAAFSS-----GDRTRAFLKVQDGCDYKCAYCTIHYARGGSRNMPVADLVAEARRIAAAGQKEIVLTGVNTGDFGRTTGEKFIDLL-RALDGVDGIERYRISSIEPNLLTDEIIAF--CATSPKFQHHFHIPLQSGSDKILGLMRRRYTTARFADRIAAVRALMPDAFIGIDVIVGFPGETEEDFRTTYDFLAGLEPAFLHIFPFSERPGTPAVEMPKVQASVATRRAAQLEALCAKLAFCARAVGSEDSVLFES-TRRGGMMFGFTGNYRRVKAPYDKARVNTVCRVRLGAMDEHDLMGEI........................................................................................ 430
111 0.000e+00UniRef50_A0A2E4F8Y5 tRNA-2-methylthio-N(6)-dimethylallyladenosine synthase n=3 Tax=Deltaproteobacteria TaxID=28221 RepID=A0A2E4F8Y5_9DELT  ali  26  1..........................................................................MNVYDTDRIFQALEPLNYTPTDDPARANLILLNTCSVRDKAEQKMMSQLGRLKEYNLVLGVAGCVAQQEGERLLKKVDLVFGPDHVQELPKLLERVRSDEGRV--SETTFFKRKNYEFIEAKPRESAEKVSEFVTIMKGCDKVCTFCIVPFTRGREVSKSRELIVKEVENLVEVGVKEVTLLGQNVNSYGKDREVHFDELL-RAVDEIEGLERVRFTTSHPMDCTDGLIDCF--GELRTLAEYFHLPVQSGSDRVLEAMRRHYTIDHYRDRVARLRERAPDIALSTDIIVGFPGETEEEFEETMALLREVRYDSIFAFKYSPRPGTKASEMEDVPEPDKTRRLDQVLKLQNQITAEKTYTGKTLEVLVEGPSRDKGQMMGRTRTNVIVNFRVPNRLKGELIKVRIDEAKAHSLYGQVVA...................................................................................... 440
112 0.000e+00UniRef50_A0A0S8GUA6 Uncharacterized protein n=5 Tax=Bacteria TaxID=2 RepID=A0A0S8GUA6_9BACT  ali  24  1...............................................................MKVALFTVGCKLNQYETQAIAEELEECGFERVDFSAPAEIYVINTCTVTKESDYSSRQAIYRARRRSPKIIVTGCYAQLEKEEKLPGVSLVVKQDQKGELVNLIADLFGNHTIKPKEKKMDDEFFGFRVC-----KHAKHTRALVKIQDGCDKRCSYCVVPLARGREKNREVDSILAEIGCLVKNGYKEVVLTGVHIGRYGKD-GLNLVHLSDKILNQTK-VQRLRLSSIDPKEFSDDLIDL--ISKSKRIARHLHIPLQSGDDYILSWMKRDYTTEEYRKLLEKIKRAIPEVMNGADVIVGFPGETDKQFENTCQFILSSPLSYLHVFSYSDRKGTIASQFPKVPPQTIHKRSEILHDLGRKKEYLDRFIGKTLDVLIEKRDKKTNKLSGLSGNYIRVLLDGEDSLMNKIIPVSILRREGNVLLGKM........................................................................................ 437
113 0.000e+00UniRef50_Q4FNN5 tRNA-2-methylthio-N(6)-dimethylallyladenosine synthase n=62 Tax=Bacteria TaxID=2 RepID=MIAB_PELUB  ali  26  3...............................................................KKIFIKTFGCQMNEYDSNRIFDTVKKIGFEKTEKYEDANCYLLNTCHIRDKAKEKVYHEIGRVKKKKPIVVVAGCVAQAENQEMLPYIDIVIGPQSYHKINEAILNHLKNKKKEEETEFDTISKFN---YLSQIKNKDSKVSSFLTIQEGCDKFCHFCVVPYTRGPEYSRPFDQIINEAKELVQSGAKEIILLGQNVNAYSYDKKYRLSDLLIKL-DSFDKLERIRYTTSHPKDMTDDLINVYK--TSSKLMPLVHLPVQSGSNKILNLMNRKHTIEEYLLVYEKLRKINPKIEFSSDFIIGYPEEDEQDFKMTMELIEKVKFINSYSFIFSPRPGTVAANLTLVDQKKSKQRLEIIQEFNNQIKKNKSLENKILNVLVENKMKDGIKLFGRTEYMTSVIFDGNIENIGKLVQVEIISSNQNSLFGKLTESSK................................................................................... 442
114 0.000e+00UniRef50_C6JP25 Ribosomal protein S12 methylthiotransferase RimO n=9 Tax=Bacteria TaxID=2 RepID=C6JP25_FUSVA  ali  25  1...............................................................MKFALISLGCSKNLVDSENFIGILNKRGFEVTSELGEADIIIVNTCGFIGDAKKESIETILEVSDLKKKIIVTGCLAQRYAGEILPEVDAVIGTGEIDKIEKVIEEVLADKRVVESTKMDFLADSETDRVLT-----TASHTAYLKIAEGCDRKCTYCIIPQLRGNLRSRTIEDILKEANKLVASGVRELNLLAQETTEYGIDLYKSLARLMKELV-KIDGLKWLRTYYMFPDSLTDELIDV--MKTEEKICKYFDIPVQHISDNILQQMGRAKSGNHIKGILNRIRKEIPDAVIRTAVIVGFPGETEENFEELKAFIEEYKFDYVGVFKYSREEDTKAYDMEQVPEEIKEKRWIEITNLQTKIAKNRNMLGKIVEVMIDGVSTESEYLEGRTEIDGKVLTNDGTAKPGEIVKVKLEQNFDYDFIGPIVENEQ................................................................................... 445
115 0.000e+00UniRef50_A0A1V5SG73 (Dimethylallyl)adenosine tRNA methylthiotransferase MiaB n=1 Tax=Candidatus Omnitrophica bacterium ADurb.Bin292 TaxID=1852854 Rep  ali  27  3............................................ENKRKDERTGDSGGKSPKKLRVLLRTFGCQMNVYDSQVAAGLLEREGFEVLQDSAEADIVIMNTCSVRDHAEQRVWGRLGRLKKERPELIVMGCMVEEHREKLFPYLDLILGTRNISELPALVRRIQATRERVSRISRDGISIEYSEF-----TKRDSPYHAWLPIMTGCDKECTFCIVPKTRGREVSMPAEDVIREAKRLVADGVKWITLLGQNVNSYGKERGVSFPQLL-ELLCAIDGLERLSFTTSHPGDATEELFQV--IAKNPKISRRFHLPLQSGSDKILRRMKRLHTFADYKARVDRLRELVPGISVTTDIIVGFPGETEEDYLATKRAIEEIRFDSAFIYKYSVRPGTPAERLDDVPFETKSRRNNELLAIQRSVTKAKNRVGREVSGFVEARAPKGEQFVARTDFDGRVIFACEKDLIGEFVRLTLDSVSHETFHGTLV....................................................................................... 491
116 0.000e+00UniRef50_A0A143XPJ7 Threonylcarbamoyladenosine tRNA methylthiotransferase MtaB n=12 Tax=Clostridiales TaxID=186802 RepID=A0A143XPJ7_9FIRM  ali  26  3...............................................................KKVAFHTLGCKVNTYETDAMEQMLLSHGYEIVSFEDQADIYIINTCSVTNMADRKSRQMLHKAKKKNPVVVAAGCYVQAAPKEVLAGVDLVIGNNRKQDLVQILEDYFKEHREEAVI-DINKEQEYEELELDFV---SDHTRAYIKVQDGCNQFCSYCIIPYTRGRIRSRAKQDVISEIKRIAKNGTKEVVLTGIHLSSYGKDFKTDLLDLI-KAVQEVNGIQRIRLGSLEPRIITLEFAQ--ELRKLDKFCPHFHLSLQSGCEATLKRMNRHYTPEEYYEKCQILREVFDHPAITTDVIVGFPGETEEEFEETRKFLEKVNFYEMHVFKYSKRKGTRAAEMEQVPEQTKTKRSNILLELARKRSEEYRWIGKEVTVLLEEKIVLDGYMVGHTKEYVKAAVKGEFS-SNTFVTGKINGFLNN----EIVN...................................................................................... 431
117 0.000e+00UniRef50_A0A2N2FJW1 tRNA-2-methylthio-N(6)-dimethylallyladenosine synthase n=1 Tax=Deltaproteobacteria bacterium HGW-Deltaproteobacteria-8 TaxID=2013  ali  25  1............................................................MTDKTFHIVTFGCQMNVGDSDWLARALVSRGWRQVP-EEDAWLFVVNTCSVRDKPEQKVYSELGRLVKPGLTAAVGGCVAQQIGRERFPFVRLVFGSDGIASAPDALDQLAEDPAARIALLDFLGAYPEREDVLTLSTQPGNQAQAFVNIMQGCDNFCTYCIVPYTRGRQKSRQPEAVLAECRTRVEQGAREITLLGQNVNSYGLDAGGTFAELLRQ-VAAIPGLLRLRFTTSHPKDIDPAVIR--AFGEIENLCPALHLPLQAGSDEVLRRMGRKVDRARYLGIVADLRQARPDIALTTDLIVGFPGESEEDFLQTLDMMERVRFESSFSFRYSDRPGVAAARMPKVPDEVGQERLLRLQSLQNGITKEKALEGCETDVLLEALSRRQDFWRGRDPGGRVVNVRSGASLCGRMVRVRILEAKNHSLLGEP........................................................................................ 476
118 0.000e+00UniRef50_A0A2D6JI11 Ribosomal protein S12 methylthiotransferase RimO n=3 Tax=Bdellovibrionaceae TaxID=213483 RepID=A0A2D6JI11_9PROT  ali  24  4.........................................................ENLSPKKKVHIVSLGCPKNLVDSEIMLGSLKNDGYEQTEDANEANTIIVNTCSFIEDSRKESVQTILEMANLKKKIVVAGCLPQRYKDELLPEADIVVGSGEFQNIANFLKESEQNPGKQL----RHFHLPTYLQSDETPRLNSGPFRAYLKISEGCKKRCAFCAIPAIRGNLQSRNIDAVVSEAKLLVASGVKEIIVISHDFTDYGWDLRRQNPEALLDALSKVPGLKWIRVLYLYPDGINQELIDLIK--GRDNLLPYFDIPLQHVNSAVLKRMNRKMTKEEIVEAISLIRKELPDAVIRTQFIVGFPGETDEEFEELLDFIEDTRFDRVGCFKYSPEEKTAGFRMDQIDEETKEDRYNQVMSLQKDISNEARFVGQTIPVMVEGYSQETELLEGRPEIDGVVYINDGTASPGEIVMVEITDSHDYDLVGKIIQEA.................................................................................... 459
119 0.000e+00UniRef50_Q1JYQ2 MiaB-like tRNA modifying enzyme n=21 Tax=Deltaproteobacteria TaxID=28221 RepID=Q1JYQ2_DESA6  ali  27  4.................................................................VSIVTLGCKANQFESAAMERMLREQGYQIVPFEQGAELVIVNTCTVTSATDAQSRKLVRRARRLNGRIVVTGCYAQIQPQQILPGVMYVIGNSEKQDLIDILCQ----EGPQVQVGDIASQQQCPDLKIA---SFSEHSRAFVQIQSGCNAFCSYCIIPYARGRSRSVNTSAVVDQVNQLVAGGYREVVLTGIHIGNYGQDLTPTLTDLLNALLTQTDG-CRIRLGSIEPQEVNEALIDCVQHSS--RICPHFHIPLQSGCDDVLQQMNRHYSIRQFHDTVELLCQKIPRVSIGIDVISGFPGETEAQHRHTCEFISSLPVHYLHVFPFSARPGTPAATMDQIPGDIAKQRAAELRVLAEEKAYREQFIGRLVDVVLESRTK-NNQWQGTSAEYLTVLVAGEQGAAGELVSVEIVGVSQNFLVGTL........................................................................................ 427
120 0.000e+00UniRef50_B9S747 Radical sam protein, putative n=167 Tax=Streptophyta TaxID=35493 RepID=B9S747_RICCO  ali  46  1.........MEDIEDLLIGSGSGGGAPPGFRLPVYPKKIIKKNKGYLNHGISLSQSSPKIPGTQTIYIKTFGCSHNQSDSEYMAGQLSSFGYALTDIPEDGDLWLINTCTVKSPSQSAMDTIIAKGKSAKKPLVVAGCVPQGSRNKELEGVSIV-GVQQIDRVVEVVEETLKGHEVRLLTRK-------TLPALDLPKVRKNKFVEILPINVGCLGACTYCKTKHARGHLGSYTIDSLVGRVRTVVGDGVKEIWLSSEDTGAYGRDIGVNLPRLLNAIVSELPADAMLRIGMTNPPFILEHLKEIAEVLRHPCVYSFLHVPVQSGSDNVLNAMNREYTVSNFRTVVDTLTELVPGMQIATDIICGFPGETDDDFAQTVSLINEYKLPQVHISQFYPRPGTPAARMKKVPSNIVKKRSRELTAVFEAFTPYNGMEGRVERIWITEIATDGIHLVGHTKGYVQVLVIAPETMLGTSAIVKITSVGRWSVFGEVIQ--------TLNQTNRGVASA--EKMPSGGKYSPCSDPCETCACSKEPESCACGPESCGGQNPLEESAIAQNDML............ 550
121 0.000e+00UniRef50_A0A1C7N655 CDK5 regulatory subunit-associated protein 1 (Fragment) n=3 Tax=Mucoromycota TaxID=1913637 RepID=A0A1C7N655_9FUNG  ali  22  37...................DNRSPSFQDFLASQ--PTKPIDPSMAQPDQVPYLHTLSQNLGQGRKFFIEVYGCQMNVNDTEILNAIMTQTGFERTDQLEEANIVFLVTCAIRDNAEARIWDRLKYLRHYKPIIGVLGCMAERLKTKLLEEVDIVCGPDGYRSIPHLI-SLAAEEEYTDGIANVMLSADETYADVMPMRLDTSNASGWVSIMRGCNNMCSFCIVPFTRGNERSRPIDSILDEVRYLNDQGVKEVTVLGQNVNSYRKDGGRRFTELLDK-VSLINPEMRIRFTSPHPKDFPTDLLHL--IASRPNLCNSIHLPIQSGSNTVLERMRRGYTREAYLDLVQEMRKIIPDVWISSDFITGFCGETEQEHQDTVSLMEQVKYDTAYMFAYSMREKTHAHRKDDVEESVKARRLQEIVTTFHQQAKHQALIGSRQLVLIDSDRPKTKHGIGRTDGGHKVFVASSLDLKGDYVEVEITHSTSASLVGRSLGLSSIQQFSSTVS.......................................................................... 566
122 0.000e+00UniRef50_F1NZV3 CDK5 regulatory subunit associated protein 1 n=124 Tax=Eukaryota TaxID=2759 RepID=F1NZV3_CHICK  ali  24  1..........................................................................MNVNDTEIAWAILQKSGYTRTKEADEADVILLVTCSVRDKAEQTIWNRLQHLKALKARIGILGCMAERLKEEILKLVDIVAGPDAYRDLPRLLAMAESGQQAANVLLSLDE----TYADILPVQTSAGGKTAFVSIMRGCDNMCSYCIVPFTRGRERSRPIASILQEVKMLSDQGVKEVTLLGQNVNSFRKPGGLRFAHLLDQ-VSRIDPEMRIRFTSPHPKDFPDEVLQL--IQERHNICKQLHLPAQSGSTRVLEAMRRGYTREAYLELVQHVRNTIPGVSLSSDFIAGFCGETEEDHQQTVSLLREVRYNIGFLFAYSMRQKTRAYHRDDVPADVKQRRLEELITVFREEAARANMVGQSQLVLVEGPSKRSSELCGRNDGNIKVIFPDADAQPGDYVLVKVTSASSQTLKGVLLCRTTLSRSAA............................................................................. 475
123 0.000e+00UniRef50_A0A2E6VVV4 tRNA-2-methylthio-N(6)-dimethylallyladenosine synthase n=2 Tax=Bacteria TaxID=2 RepID=A0A2E6VVV4_9DELT  ali  25  10...............................................................KKVFIETFGCQMNILDTELVRDKLAPLGYEFVSSPKNANVVLYNTCSVRDLSEQKVRSRLGRMRKEDVVVGVLGCMAERAGQELIPHIDLLAGPSQLDQVPALLENALSGFRKRQKGQETDRLEQIEALDQERMGEINQSRQAFVRITRGCNKFCSFCVVPMTRGPEVHRPPQGLIDEVKRLVDQGAREVTLLGQTINHYTYHEGTSFADLLHQIHEATPDLPRLRFLTSYPRDFTEEALDV--MAASERICNYLHIPAQSGSNAVLKKMNRGYTKEIYMDLIHMAREKMPDISIVGDMIVGFPNETEEDFVMSLEMLREVKYKNIFAFKYSPRPGTVSGKRDPIPQAEKKSRNARMLAVQQEISLHQNMLEKTYDVLVEGIAKENNRLTARTRGDHIVAFDGPANLIGSIVPVQITDAASLSLKGHLVQR..................................................................................... 497
124 0.000e+00UniRef50_A0A2E8YN87 tRNA-2-methylthio-N(6)-dimethylallyladenosine synthase n=4 Tax=Alphaproteobacteria TaxID=28211 RepID=A0A2E8YN87_9RHIZ  ali  23  12..................................................................YIXNFGCQMNVYDGDRMQEMMSSHNYDSVNSVEDADLVILNTCHIREKATEKIYSELGRIKKEKTIVAVAGCVAQAEGEELVPIIDLVFGPLTYHHLPDILQSFENDNLNKKKAIVDIEPPNEDKFTELPKRLKDNRISAFLSVXXGCDKFCTFCVVPYTRGVETSXSFLEIKDEANQLISTGVQEIILLGQNVNAWSNSNGKDFADLIYEL--SLLDLKRIRFTTSHPNDMNHKLISSFR--DVEKLQPYLHLPIQSGSNKVLKNMNRNYSSEEYVEIISELKSIRPDIAISGDFIVGFPGETEDDFNKTEEIIKKIGYAHAYSFKYSPRPGTPAGQMEQIDEKIKSERLQRLQDEIKRYKYNKRFLNENLQVLVEKETTQ-GYFSGRSPYLQSIHFQSDSSCIGNIVDIKVLKVNENSLSGEIL....................................................................................... 447
125 0.000e+00UniRef50_A0A1Y1RLI6 tRNA (N(6)-L-threonylcarbamoyladenosine(37)-C(2))-methylthiotransferase MtaB n=1 Tax=Candidatus Cloacimonetes bacterium 4572_55 T  ali  25  1..........................................................MRKSMNRIAFHTLGCKVNQYETEAMRQQFEAAGYVVVPFKQTADIYMINSCTVTERADQECRRLIRRALRQNSDALVTGCYAQLRSEEIISSIRGVIGNAERAKIVDYIETIQAGNSPSRPIIAVSDINRQKSYEPYRLDRFSGQTRAFLKIQDGCDLSCSFCAITQARGPNRSRPMADLIQEAERLSKNGYKEIILTGVRIESYGKDIKKTLSNVLQNL-SQLKDLERIRLSSVSPLALTDELINL--IAGQPKICNHIHLSLQSGDDKILREMRRPYQRQDVVDRIRRVAEAIPSVGIGSDMMVGFPGETAKNFDQSYGLIERLPIVYLHVFPYSPRPNTAAADMPQIPEETKAKQSRILRELQKKEQFYKQFLGRTLSVIVENRYDKSGRLTGLSDNYIRVSFPGSENRMNQLIYVRLTKFQQEGMVGEEV....................................................................................... 442
126 0.000e+00UniRef50_A0A1V5R366 (Dimethylallyl)adenosine tRNA methylthiotransferase MiaB n=1 Tax=Parcubacteria group bacterium ADurb.Bin326 TaxID=1852943 RepID=A  ali  26  1..........................................................MFPNDKKFYLWVLGCQMNESDAERIEALLEFYGWSRTKSEQEASLIVVVACSVRQKAIDRVYGKAKEWRRRRKKTVLTGCVLDSDKENMLRFFDLVIPVTEIFQLVGLIG---------------GEADPAQNDYLCLPAKYNCNFSAYVPIMNGCNNFCSYCAVPFTRGRERSRPAQEVIDECKKLIEGGCKEIILLGQNVNSY-HEGEYDFPKLLKEI-NGLQGDFWIRFLTSHPKDLSSDLIEV--MAEGGHITPYLHLALQSGDEKILQSMNRKYGPEHFLSLIEKVRQAIPEITISTDIIVGYPGEGEEEFQHTADLMRQAKFDMAYFGRFSPRPGTTAAKLDDVNAEEKARRENFLNDILIETANNQKYLGQNVEVLVDGW--KKGLCYGKTASFKIVAFVGEKSLIGQKVLVKIKEIGPWSLKGEKI....................................................................................... 420
127 0.000e+00UniRef50_A0A2A5BXN3 tRNA-2-methylthio-N(6)-dimethylallyladenosine synthase n=1 Tax=Alphaproteobacteria bacterium TaxID=1913988 RepID=A0A2A5BXN3_9PROT  ali  26  5..............................................................PKKLYIKTYGCQMNVYDTERMVDVMGHEGYEVTDAPDDADLVILNTCHIREKAAEKVYSDIGRLRSKKSILAVGGCVAQAEGAEIAPTVDMVFGPQTYHRLPEMTDQANKGGRPRIVDTDLVVSEKFESLSKKAIAPKK---TAFLTVQEGCDKFCTYCVVPYTRGGEFSRSFEDVMKDARKLNEAGVLEVTLLGQNVNAYRENVEWSLARLIRHLAD-VTDFKRIRYTTSHPHDMTDELIAIHEVAQC---MPYLHLPVQSGSDKIVKAMNRHHTIASYMKIIDSIRAVRPDIALSGDFIVGFPGETDADFQATMKLVREVDYAQAYSFMYSERPGTPAAGWDQVEEHVKSERLAELQQELNRQAFNDKSVGKVMSVLLERTGKQDSHLVGRSPYMQAVHVDTAESYFGQMVDMKIISAGPRSLKGE......................................................................................... 461
128 0.000e+00UniRef50_A0A2E0FQP2 tRNA-2-methylthio-N(6)-dimethylallyladenosine synthase n=8 Tax=cellular organisms TaxID=131567 RepID=A0A2E0FQP2_9BACT  ali  25  1..............................................................MKQVFLETFGCQMNVADTDRMELILFHSGYRRTQEKEDADLILVNTCSIREKAEQKTFSLFGGLKNPDLILGLTGCMGQQDGEKKMPYLDFVLGPDQVEGIEQAVNRVKESKKP-FVWTGFDIEKKYSIPEISGDLPKKPSPSSFVNIIKGCDKFCTFCIVPFTRGREKSREPEELYQEIRHLIDHGAKEIILLGQNVNSYGKKNPIPFHELLYKI-AEIPGLERLRFTTSHPNDFTRETIRAYR--DLDKLVNHLHLPIQSGNNDILKLMRRDHTVEEYQELIDELKSEVPDISLTTDIIVGFPGETDAQFRDTLKVMERIGYSSSFMFSYSPRPGTPASEFEDVPLETKSKRLQEIIKLQNRLTQXQSYKGKTVEVLIEGGSSKPGYFKGRXPQYWRVNLKGDEKKPGXIVQVNIEKTSGHSLSG.......................................................................................... 440
129 0.000e+00UniRef50_A0A2H0MX68 tRNA (N(6)-L-threonylcarbamoyladenosine(37)-C(2))-methylthiotransferase MtaB n=2 Tax=unclassified Nitrospinae TaxID=1449243 RepID  ali  24  1..........................................................MKRKKNKVAFATLGCRTNQNDTAEMQSLLEQDGFSIVSAEEKADIYVVNTCTVTQKSDQSSRMAIKKAINDKAIVVFTGCYAQLNPEAKLEGLDVVLGNANKLEIAEVIKKRLEENNSVAVEIVMSDIHAPRTFKALPVSTFQGRTKAFIKVQTGCDEKCSFCTVVRARGKSLSDSRSNILSNVVCAIEAGYKEITLTGINLGTWGMDFSTTFSSLVRDILA-IRGDFRVRLSSINPMEIDDDLIAM--IAENDKICPHFHIPLQSGDDSILEQMRRNYNVQQYLDIVGKACDRIPNLALGADVIVGFPGETDDRFENTRKLIEQLPFTYLHAFTYSAREGTEAYDFDNIPKNIKKERNRILNAIADQKAFNQNFLNQTVTVLTEMQRTRDGLLKGHTEHYIPVVFEGDDALKNQLVSVQITKVDE............................................................................................... 435
130 0.000e+00UniRef50_A0A1G1DEN3 tRNA (N(6)-L-threonylcarbamoyladenosine(37)-C(2))-methylthiotransferase MtaB n=3 Tax=unclassified Nitrospinae TaxID=1449243 RepID  ali  26  1..............................................................MIKAAFTTIGCRFNQFETAEMEDLFKAMNFDIVPFSDSANIYVINTCTVTNRSDYRCRQTIRRAIQTNKDIVVTGCYSQINPEEVIKGVDMILGNMEKLNIVNYLEEFNAFKNGKKEIKKLDDTRTAREFKSRKISNFSGRTSAYLKIQTGCDQTCSFCIVTIARGPSISEKPEIILNQAQELSDSGFKEIVLTGVNLGSYGDNLNPKLSDLV-EMLTGVKGIERIRLSSINPREVSDGLISLIK--KSEKVCRHLHIPLQSGDNEILKIMRRDYNSEFYRDLIIKLKSNIPDIGIGADVIVGFPGEDEGKFKNTYRLIEELPLSYLHVFTYSQREGTDAYNYEQITESTKKERGSVIKKLGEKKSFREGFIGKICKVLIENRDRETCLLKGYTDNYIPVMTGGGDELMNKLVNVRITEISDNVVIGEL........................................................................................ 443
131 0.000e+00UniRef50_A0A078AYZ5 Rna modification family n=4 Tax=Eukaryota TaxID=2759 RepID=A0A078AYZ5_STYLE  ali  24  34..........RSIEEIPHLKDFLKTQTNDFQQDEDGNEHKQSQLQEEIDESTLPSIQREDNKNKTYFIETHGCQMNVADTEIVQSILESAGFEASENINKADVVLVNTCAIREGAEKKIWNKIHGVKKNNKIIGVLGCMAERLKEKFLENVDLVAGPDSYRDLPRLI-KIIESKQNDEQAINVQLSFDETYADIIPVRKDKNKLHAWISIMRGCNNMCSFCIVPFTRGRERSRPVISIEDEVKLLRDQGIKEITLLGQNVNSY-HDLGIRFAELMDR-VSDIAPEVRFRFTSPHPKEFPDPLLEV--IGSKANVCKQLHLPAQSGNTNMLMRMRRNYSREAYLDLIYHAREKIPGVALSSDFICGFCDETEQEFEDTLTLLDQVKFDMGFLFAYSMREKTHAHRKDNVPEDVKKERLIRMIDTFKRNQLIKQKIGLTHLMLIDGHSKKGDQLSGLTDTNKRVVINNQKYKIGDYVAVKITNATQNALIAEPIE...................................................................................... 558
132 0.000e+00UniRef50_Q3ACX5 Ribosomal protein S12 methylthiotransferase RimO n=4 Tax=Carboxydothermus TaxID=129957 RepID=RIMO_CARHZ  ali  26  1...............................................................MKYFILSLGCTKNQADSEVIMGILESKGYVRSLNPEESDLLIVNTCGFIAAAIEESIEEILHLKKPGQKILVAGCLVQREGKELLPEVDLFFTPREINNLDKLLADLGENNKLVL-------SEPGFLNLEKKPRAKSNEVYRYIKIADGCDNRCTYCTIPAIRGKYTSRPLDDILEEIKDTLKQGIKEIILVAQDTTAYGIDLYGKLVELLRKIGS-IKGNFWVRLMYLYPDKITPELIN--EIKENPKVIKYVDVPLQHIHPEILKKMGRKGSSEEIISTLERLRKEIPDITIRTTFIVGFPGETEEQFNYLLDFVKKFKFNRLGAFPYYREKGTPAAKMKQIPKKVKEQRYEKLMEVQQEISLNKALVGKKIPVIVEKKIRGENLYLGRTEIDGIIEIKAEKRLKGQIINVLITDYDIYDLKGEFIND..................................................................................... 438
133 0.000e+00UniRef50_A0A1F7LFG4 tRNA-2-methylthio-N(6)-dimethylallyladenosine synthase n=1 Tax=Candidatus Rokubacteria bacterium GWA2_73_35 TaxID=1802096 RepID=A  ali  29  1..............................................................MAKLHVITYGCQMNEYDSERVAGLLREQRWELTEDERDADLILLNTCAIREKAEEKVFSKLGQLRHPGLVIGVMGCMAQLHQREIAPQVDLVFGAPAIARVGEL------VERVRRERRPVLETGEGSLVKLTARPPGASRLKAFVTVMEGCEKHCSFCVVPRTRGRERSHPPDAIVAEVRSLAAAGCREVTLLGQTVNAYGRDLPTDLAELFAR-VDEVPGIARIRFTTSNPYNLTPRLIR--ALADVPKVCEWFHLPLQSGSNRILERMNRGYTRERYLELVAEIRDAVPEMAFSTDLIVGFPGETEADFEQTLHVVERIGYDNAFVFRFSRRPGTPAATLDQVPEDVKAHRNARLLEXXXXXXXXXXLEGRTVEVLVDGADK.................................................................................................................................... 389
134 0.000e+00UniRef50_V5HW49 Putative fe-s oxidoreductase (Fragment) n=6 Tax=Bilateria TaxID=33213 RepID=V5HW49_IXORI  ali  58  1MPELCPSGFVEDIEDVV--KPGSNPVAVPTRNLVVPRIRRSNKDIP------EATGDSFLPGTHKIYVKTWGCAHNSSDSEYMAGQLAAKGYSIVEDASSADLWLLNSCTVKNPAEDHFRGAIDAGLRQGKKVVAAGCVSQATPNVEYLKGLSVVGVQQTDRVVEVVEETLKGNSVRLLGSKKDGRRKAGGAALTLPKIRRNPLVEIIAINTGCLNHCTYCKTKHARGDLGSYSIEELVARAKQAFQEGVREIWLTSEDTGAYGRDIGVTLPDLLREMVAVIPEGCMLRLGMTNPPYILDYLEDMAEILSHPRVYSFLHVPVQSGSDPVLAEMKREYTAAQFRTVVDFLRKAVPGITIATDIICGFPTETEEDFEETMALVREYRFPSLFINQFYPRPGTPAAKMKRIPTHVVKERTKRLSELFQSYQTYDGRVGQRQAVLVTEVAHDKKHLVGHNKFYEQVLLPMNEDYMGRSVDVVITSAGKHFMHCEVLGLGSSMDQTLPRPLPKGQVSGV----------------QPGAPTQHRLRDVRLVCRSWSGHWRWT--ASVFIALVSAFLAYV..... 580
135 0.000e+00UniRef50_UPI0003AD9CDD CDK5 regulatory subunit-associated protein 1 isoform X1 n=4 Tax=Bilateria TaxID=33213 RepID=UPI0003AD9CDD  ali  22  33LPSTACPSPEKQQEDFSSRLATGPTFQHFLRSASAP-----QEKPDMEDPPPYVTVEELLGRQRKVYLETYGCQMNVNDTEIAWSVLQKSGYLRTRNLQEADVILLVTCSIREKAEQTIWNRLQQLKALKLRIGILGCMAERLKEEILKMVDILAGPDAYRDLPRLLAVAESGQQAANVLLSLDE----TYADVMPVQTSPSATSAFVSIMRGCDNMCSYCIVPFTRGRERSRPVASILEEVRKLSEQGLKEVTLLGQNVNSFQKKGGLRFTYLLDQ-VSRVDPEMRIRFTSPHPKDFPDEVLQL--IHERDNICKQIHLPAQSGSSRVLEAMRRGYSREAYVELIHHIRESIPGVSLSSDFIAGFCGETEEDHLQTVSLLREVQYNMGFLFAYSMRQKTRAYHKDDVPEEVKLRRLEELITVFREEATKANMVGSTQLVLVEG....................................................................................................................................... 510
136 0.000e+00UniRef50_R7FME1 Ribosomal protein S12 methylthiotransferase RimO n=29 Tax=Firmicutes TaxID=1239 RepID=R7FME1_9CLOT  ali  25  1...............................................................MKVGFISLGCSKNLIDTEVAIGLFKDNHYEIVNNPNDAEILVVNTCGFIESAKEEAINTILEMAEYKKKLIAMGCLVQRYYDKLLPEVDLFIKIDEYNKLWDKIEDLIKRDKTSKKISEIKPLPMPTYNEFMERVVTTGKNYAYLKIGEGCSNKCTYCAIPYIRGPFVSRKMEDILDEAEMLAKKGIKELIVIAQDTTKYGVDIYGKLAELLEKI-SKVKGIEWIRFLYSYPEGITDKLINV--VATNGKIAKYFDIPIQHISNPILKKMNRRTSKEDVTKIIEKIRKEVPDVTLRTSLIVGFPGETKENFEELLEFVKNTKFDKLGTFMYSKEEGTPAAKLDQIHGNTKKARYNKIMEAQQEISKEINKIGKNYKVLVEDMSFDGKYFIGRTEEDGLVYIKNNKDLLNNFVNCKIIEVSNYDLIGEI........................................................................................ 454
137 0.000e+00UniRef50_A0A1W9SBX3 tRNA (N(6)-L-threonylcarbamoyladenosine(37)-C(2))-methylthiotransferase MtaB n=1 Tax=Tenericutes bacterium 4572_104 TaxID=1971635  ali  25  1...............................................................MKAAFYTLGCKVNSYETEALIEMFEKKSYEIVDFSEKSDVYVINTCMVTNTGERKSKKYIRRPIQLNKIVIVMGCLSQLKAEEIIDGVKIVVGTKDRDKILDYLEAYIKDNKIQNHVTKLENKVKFDNLFIS---DFKNHQRAFLKIQDGCNNFCSYCIIPYTRGRIRSKNPERVLEEAKYLVDSGHIEIVLTGINTGSYGIDLKDCFADLLRDL-ETIEGLKRIRISSIEITELTDEVISVLK--SSKKIVNHLHIPLQSGSNRILKLMNRKYKTEEYMDLINKLRDNIPNLAVTTDIIVGFPTETEADFEEEIEVIKKVNFQELHVFPYSIREGTVASKLK-----------------GLKVEHINKQINKHHFVITEQY--KDDYLQGHTRDYILVRIKADETLIGKEVEVIIESFDGKYCYGKLV....................................................................................... 409
138 0.000e+00UniRef50_A0A1G2F144 tRNA-2-methylthio-N(6)-dimethylallyladenosine synthase n=10 Tax=Parcubacteria group TaxID=1794811 RepID=A0A1G2F144_9BACT  ali  27  3...............................................................KTYHIITYGCDANRADSERIAGLLENCGYKETKNKEKTNLLIFNTCSVRQKAEDRVFGRNKEMKKPDLKIALAGCMNHYDKKDRLPYIDVFLPMKELSLLPQKLG-------------------IKKELFSQIKPSYQSKFRAYVLISYGCNNFCSYCVVPFARGKERSRPEKEIINEVCWLVNNGYKEIWLLGQNVNSY-KDI--PFAELLLKI-NEIPGKFWIRFASPHPKDFSDKLIQAMKKAN--KFPKYVNLPVQSGNDKILKKMNRPYVISQYKSLVKKIRKAMPEIALSTDVIVGFPGETKKQFQDTAKLFKEMKFDMAFISEYSPRPKTAAAIKDNVPNKEKRVRKNILTDILRKTALEKNLIGKTIEVLIDK--KNNGRIFGKTEGNKNIIIENKKIKIGEFDKIKIIEANSWHLKGEPI....................................................................................... 417
139 0.000e+00UniRef50_A0A2G6LQ35 tRNA-2-methylthio-N(6)-dimethylallyladenosine synthase n=63 Tax=Bacteria TaxID=2 RepID=A0A2G6LQ35_9FLAO  ali  24  11...............................................................................SEIVASILTEQGYNTTRNLEEADLILLNTCSIRDKAEQTVRQKLQHLKRKKPTVGVLGCMAERLKSKFLEEVDLVVGPDAYRELPHLLKETEDGRDAINVILS----KEETYADINPVRLGGNGVTAFVTITRGCDNMCTFCVVPFTRGRERSRDPHSIISECKELWEQGYKEITLLGQNVDSYKKDFKKHFAQLLELVAKEVPH-MRIRFSTSNPQDMSLDVFRM--MAQYPNICRYVHLPIQSGSNRMLKAMNRMHTREEYLDLIKKAKEIVPDISFSQDMIAGFCDETEEDHQDTLSLMEEVEYDYGYMFAYSDRPGTPAHKKDNIPLEVKKRRLNEIIKLQHKLSLQRSYVGRNHEVLIEGVSKKNNQWKGRNSQNAVCVFDKKEGKIGDFVEVFVHDCTQGTLLAK......................................................................................... 445
140 0.000e+00UniRef50_X5JUG4 tRNA-2-methylthio-N(6)-dimethylallyladenosine synthase n=7 Tax=cellular organisms TaxID=131567 RepID=X5JUG4_9NOST  ali  25  1..................................................................................MAGILEDMGFEWSEDPNQASLILYNTCTIRDNAEQKVYSYLGRQAKRKLTLVVAGCVAQQEGERRVPELDLVMGPQHANRLQDLLQQVFDGNQVVAT-------EPVHIMEDITKPRRDSKVTAWVNVIYGCNERCTYCVVPGVRGVEQSRTPEAIKEEIEVIARQGYKEITLLGQNIDAYGRDLKHTLTDLLYYI-HDVPGIERIRFATSHPRYFTERLIR--ACAELPKVCEHFHVPFQSGDNKVLKRMSRGYTHEKYRRIIHTIRDYMPDAAISADAIVGFPGETEEQFENTLKLVADIGFDLLNTAAYSPRPGTPASVWDQLSEEVKSERLQRLNHLVAIKAAERRYMGRIEEVLVEQNSKDKTQVMGRTRGNRLTFFTGDNQLKGELLKVKITEVRAFSLTSEAVGVSQIMT................................................................................ 429
141 0.000e+00UniRef50_A0A239Z0G1 (Dimethylallyl)adenosine tRNA methylthiotransferase MiaB n=60 Tax=root TaxID=1 RepID=A0A239Z0G1_9FIRM  ali  27  1..............................................................MKTVAFTTLGCRVNQYDTDAMKGLFLQNDYQAVDFDTKADIYVINTCSVTNMGEKKSRQLIRKAKRQNKDVIVTGCYAQLDPDAIIDGVNLVIGTNNRSKIVELVEQLESTERQINAVRDIMKESNFEEMPLYG--NESDKSRAFMKIQEGCNNYCAFCIIPYTRGQLKSRKIDDIVREANRLVEHGFHEIVLTGIHLGNYGVELPPTLADVVKALL-EIPNLYRIRFGSIESVEVSDELVEL--MATDKRVCPHLHLPLQAGSDHVLSLMKRHYTXXXXXXXXXXXXXXXXXXXXXTDIIAGFPQESDEDFEETLQTVREIGFTHIHAFPYSIREGTPATTMPQVPEAVKKTRVALLNSLSQSEAYAKSRIGKPGEILIEKE--ENGYYTGLTSEYVNGKIKSDGHKIGDLIGGIVTGLEDNYLI........................................................................................... 429
142 0.000e+00UniRef50_B1H0D2 tRNA-2-methylthio-N(6)-dimethylallyladenosine synthase n=7 Tax=Elusimicrobia TaxID=641853 RepID=MIAB_UNCTG  ali  28  1...............................................................MNYLIETIGCQMNVCDSDMLVSIFSAYGASKANNLSEADVVILNTCSVRSQAEQKAFSYLGRFKQKNPKIVVIGCMAERLGKKRFSSVDLIIGAKDIGN----------------AALKIMNLFRTDYSAKKVNSEIKSKIVRYITIMRGCDNYCSYCAVPFVRGREVSINCETIVNECSSMVKNGAREIILLGQNVNSYQYE-DVNFASLIKK-TAAIENLERIRFMTNHPKDLSDDLIKI--MATEPKVCPHIHIPMQSASDKILKAMNRKYSYEHYLGLIKKLRTAVPDVSVTTDIIVGFPGETDEDFEDTLKAVKTIRFGGLYVFRYSPRPDTKAAEMDDVPFEEKKRRHAVVLKESNKISIESEMLGSTQQVLAEEI--KNGIIKARTKNGRKVFAEGRKEYIGKHINVNIKEAKINSLFGDIV....................................................................................... 418
143 0.000e+00UniRef50_A0A2G6N6K7 tRNA (N(6)-L-threonylcarbamoyladenosine(37)-C(2))-methylthiotransferase MtaB n=2 Tax=Proteobacteria TaxID=1224 RepID=A0A2G6N6K7_9  ali  25  23.......................................SRPRNQYKEFSPLKPTNQQNQSTNKTFFIKTLGCKVNQCESEAIRNTLEASGFTD-GSEGDADVVIVNTCTVTGKAAMQSRQAVRRSIRANPRVLVTGCHAQTAPDELIDGVHLVVGTRDKHRIPEKVLESINGKDPDAPVVAVSDVTHATRFAPLPGVAHGSRTRPFLKIQDGCNAFCTYCIVPHARGRSRSLPVDQVLAQIQQLGQLGYREVVLTGIHIGCYGMDLAP--ATDLKQLLDRIRGIERIRISSIEPRELTEPIIELASTARCSRLCAHFHIPLQSGDDDVLKRMHRPYDAGYFRQLVLRIVKRIPHAAIGVDTLIGFPGETDRSFETTYRLIQELPVAYLHVFPFSARKGTPAFSFDPIPSEVIKARCSRMRQLGNRKRFYARHMGQTLTVLVEERNKPDGRLKGFSDNYISIRFDGPDEWFNTFQEVKVSRVSDEG............................................................................................. 480
144 0.000e+00UniRef50_A0A0S7Y9S5 tRNA-2-methylthio-N(6)-dimethylallyladenosine synthase n=4 Tax=Bacteria candidate phyla TaxID=1783234 RepID=A0A0S7Y9S5_9BACT  ali  24  2..............................................................NKKIFIKTFGCQMNKNDSSIMNFILEQNGCIAVDEPQDANVIIVNTCSVRSHAEKRALGYIATLKNWRKKLGVVGCMAERLADTLFPHVDLILGPDSYRNIGTYIDDVYSRETKIIETTLSEETYCGIYPE-------RSAVSCFVSIMRGCGNFCSYCVVPYVRGKARSRPTDDIIREIEMLVRSGVKDITLLGQNVNEYSF-NNVHFADLL-RMCANIPRVFRLRFLTSHPKDMNEALIKVVK--EHDTICEWFHLPLQSGNTRILKLMNRQYTKDEYLSLVDKIKKTIPEATITTDIIAGFPTETDEEFQETISVMEKVKFDDAYMYCYSPREGTRAYGYPSLPEHIIKARLEQLIDFQNSVTRAREMIGRKYEVLFEGKAKNNAT-RGKTKGNKNIIIE-KEITRGEVHQVVIREVRGRTPVGELIGIEKR.................................................................................. 432
145 0.000e+00UniRef50_A0A2E1CL14 tRNA-2-methylthio-N(6)-dimethylallyladenosine synthase n=4 Tax=Rhizobiales TaxID=356 RepID=A0A2E1CL14_9RHIZ  ali  25  7.............................................................KKRNLFIKSYGCQMNEYDSERMTEILEKHNYSSVDEPTQADXIILNTCHIREKAAEKIYSELGRLKKINLKVAVAGCVGQAEGHEIIPIVDLVFGPLTYHQLPEMLEEIESKGXPNKKLVNIDVPDEDKFLELKGPRKNLKSISSLLSIQEGCDKFCSFCVVPYTRGVEISRPAKQIISEAKELISIGAKEIILLGQNVNAWGSDIEMTFPQLIKEISEL--NIDRIRYITSHPRDMTEELMKSHKX--IPKLQPYLHLPXQSGSDKILXEMNRNYXSQEYXDIIYKTREYRPDXAISGDFIVGFPGETXDXFEATLXIXKKVKYAHAYSFKYSPRPGTPAAKXDQIDEEVKSDRLKTLQELIRQQTRNFNFLEXEIXVLIEKKGIGEXRLTGRSSYLQPVXMTGDTSXIGXILKVKIXKTRXNSLEGIIL....................................................................................... 450
146 0.000e+00UniRef50_UPI0009FCFF31 tRNA (N(6)-L-threonylcarbamoyladenosine(37)-C(2))- methylthiotransferase MtaB n=1 Tax=Proteocatella sphenisci TaxID=181070 Rep  ali  25  2.....................................................................TLGCKVNTYETEAVEELLKGNGYNIGKFEEYADVYIVNTCTVTAMSDKKSRQMIRRTRKLNPVVVVMGCYSQKAPNELIEEVNLVLGTSNRKAILKEIEDISSDDKRII-VEDIMKIRDFEELEISEVRDRA---RALVKIQDGCDRFCSYCIIPFTRGPIRSRKLENIIEEVKRIVENGYKEVVLTGIHVASYGKDTGGISLIDVIEGIAKIDGLERIRTSSVEPLIITEEFVK--RLGKIEEFCPHFHLSLQSGSDTVLSRMNRRYTSAEYKDAVQTIRKIFPFAAITTDVIVGFPEETDQEFQETYEFLQELKLYETHIFKYSPRNGTKAAEMDQVAPSVKSHRSELLIKLNEKKDFEVLYLGQNADVLIETW--ENGYSVGHTKNYVKTGIKTEENLVNQVVACKISAISKDFVIA.......................................................................................... 420
147 0.000e+00UniRef50_A0A1V5PZR2 tRNA-2-methylthio-N(6)-dimethylallyladenosine synthase n=7 Tax=Bacteria TaxID=2 RepID=A0A1V5PZR2_9CHLR  ali  27  1...............................................................MQYHVWTIGCQMNVADSQRVAAGLERLGYTATARAEDADIVVLNTCVVRQQPEDKVVGRLQQLRHPDRILALMGCMVGREKEQRFPWVDLFLPPSDPTELWAYLAQREMLDEAQTLIADAESRRALGRTDTVLPPSEESRTVAYVPIVLGCSHACTYCVIPYRRGAERSRPLETVVAEARQLAAQGVKEITLLGQIVDRYGYDLETPLVTLLRR-VHEIEGLIRIRFLTSHPNWMRDDLLD--AVAALPKVCEHIEVPIQAGDDEVLAQMRRGYTVDDYRRLVARLRERIPGVSIATDIIVGFPGETSAQFENTLALLEELRLDKAHIARYSSRPLTVATRMDELPYDEKERRRHQLDQAQTRIQLNARLEGQEVEVLVEG--QKKDRWFGRTRTDRLIFFSAEGDWLGRIARLKVTWTGPWSLIGEPI....................................................................................... 446
148 0.000e+00UniRef50_A0A174ZMQ2 MiaB family RNA modification protein n=27 Tax=Bacteria TaxID=2 RepID=A0A174ZMQ2_CLOIN  ali  26  1..............................................................MTTFAIATLGCKVNTYESQGYESALLEKGYEQVSFKEKADVYIINTCAVTNTAGSKSRQKIHAAIALNPEIAVVGCYAQTASEQLEQDIDILLGSDGKSRLADMIEEGLRKKRPQKLIHDVRKVNVFEALPIH---RFEHQTRAFLKIQDGCNQFCSYCIIPFARGAERSLPEDEVLAIARSLSESGHREIVLSGIHTGRYGNGINSSLCQLMKRMVKEIPKLQRIRISSIEMNEITDELLEFIK--GEEKIARHLHIPVQSANTTVLKNMNRPYTIAWFMERVDYIRSLIPDISISSDVITGFPQESEEQFQDTLDNIARMRLSFLHVFPYSRRDHTAAAQMGHLENKIKKERASRLANLSKQLAYKQNFIGKEVSVIFEKE--KDGKLIGHSSEYLEVAAAAPLAWLHTMHTVRITALDGDLLVGCPLKEESYEAVS.............................................................................. 439
149 0.000e+00UniRef50_A0A2I4GJY2 CDK5RAP1-like protein isoform X1 n=6 Tax=Eukaryota TaxID=2759 RepID=A0A2I4GJY2_9ROSI  ali  21  84..................SAHEGPSLRHFIAQAAL--------TASSETRPDQLPASEVSSRG-RIYHETYGCQMNINDMEVVLSIMKNAGYEVVGVPESAEIIFINTCAIRDNAEQRVWQRLRHWKQRPPKVVVLGCMAERLKDKILKMVDVVCGPDAYRDLPRLLEEVDYGQKGINTLLSL----EETYADISPVRISNNSVTAFVSVMRGCNNMCSFCIVPFTRGRERSRPVDSIVREVGELWNGGVKEVTLLGQNVNSYNRKMGLRFSDLLDRLSSEYPEI-RFRFTSPHPKDFPDDLLYL--MRDRPNICKCIHLPAQTGNTNVLERMRRGYTRDAYLDLVQKIRRIIPEVGITSDFICGFCGETEEEHEDTLSLIKAVGYDMAYMFAYSMREKTHAHRIDDVPEEVKQRRLAELIEAFRESTCYESQIGTVQLVLVEGPNKRDTELIGKSDRGHRVSFERRNPVVGDYVEVHILKSTRASLFGEALAVTKLSS................................................................................ 616
150 0.000e+00UniRef50_A0A1F7TKJ5 tRNA-2-methylthio-N(6)-dimethylallyladenosine synthase n=2 Tax=unclassified Candidatus Tectomicrobia TaxID=1802341 RepID=A0A1F7TK  ali  27  1..........................................................................MNRYDTETITGHLEQEGYERSEDFERSDLILLNTCSIRDKAEQKVFSQLGRLSRLKKKIAVCGCFATREGEKRQPAVDLIFGTQNISELPRLLGRMAKGRVVDVAPVEPD-------FTEVAPIQREGALSAWVSIARGCDNFCTFCVVPYTRGPEWSKPSALIVAEVEKAVAEGFKEVTLLGQNVNSYGRPGELSFGGLLRRL-DRLEGLRRVRFMTSHPKDCDEDM--VGAMSGGSKVCEHLHLPFQSGSDEVLRRMDRGYTAEEYLSKVGLFRQRVPGGVLTSDVIVGFPGETDRDFEETLGVLHQARFDSIFMFKYSPRPGTPAFSMDQVPEEAQAERFEKALRLQRQVTEELHLVGQVLEVMVEKPERRPAAFTGRTRGNHRVQFSGPAPRPGDLVDVRILRGGLHALGGVWPPDSAAMEESAP............................................................................ 453
151 0.000e+00UniRef50_A0A212KDU2 Threonylcarbamoyladenosine tRNA methylthiotransferase MtaB n=16 Tax=Clostridiales TaxID=186802 RepID=A0A212KDU2_9FIRM  ali  26  1...............................................................MRIAIYTLGCKVNQYETQALETELVKRGHTLVPFEGEAEAYVINTCTVTAVSDKKSRAMIRRARKSRPDVAVCGCYAQTDPEAVVLEVDLVMGTADRMAFLDEVEKLVE-HKAAAPEVRVDNIMTHRAFEHLPAGGLEGRTRAMLKVEDGCVNFCSYCIIPYARGPVRSLPLEAAVYEAKRLARDGYREIVLTGIEISSWGQELGTGLIDLIEAVCAAAPGL-RIRLGSLEPRTITEEF--CRRSAALPNLCPHFHLSMQSGSDAVLARMNRKYDTFWYYKSVELLREYYSDPAITTDLIVGFPGETEEEFMETLAFVEKCAFSSMHIFPYSRREGTPAAGMEQASNAIKEDRARRAGSLADRLEYLTRRVGETLPVLFEEE--KGGLWRGHAPNYVAVYAKG-EALHNVQRDVKITGLHADGLVGEIVTQG.................................................................................... 433
152 0.000e+00UniRef50_A0A191HUX7 Uncharacterized protein n=1 Tax=endosymbiont `TC1` of Trimyema compressum TaxID=243899 RepID=A0A191HUX7_9FIRM  ali  25  2..............................................................KKKVAMIALGCRVNQSEGEGLLACFSSDGYEIVNFQEKADVYIIHTCTVTSKADSKSRQLIRKAKKDNAIIVVTGCYAQTAPGDLLSEVNLVLGMKDRNQVVSLVEGLELGERKSVVSNVFKERD-----FEGLPFVSTEKTRAFIKIEEGCESFCTYCIIPIARGPIRSRKEKDIINEIMKLSQMGYQEVVLTGIHTGAYGKDFNNTLATLVNKII-EIKGIKRIRFGSLDPNEVSDEFLAVFASA---KVMPHLHLSLQSGDDTILKLMKRPYEKDLYEKVALKIRVIKKDVSLTTDIMVGFPYETELEHRNSMDFISKIGLDNLHIFKYSKRKGTKAAAFEQVDEVVKNKRASEMKVLKDRLMFLKKMVGKTLLVLVEENN--DGLATGYSENYLRVKFSSKQCKVNKIIPVKIINVNGNYLVGT......................................................................................... 427
153 0.000e+00UniRef50_E0NZV8 tRNA methylthiotransferase YqeV n=87 Tax=Firmicutes TaxID=1239 RepID=E0NZV8_9FIRM  ali  27  1...............................................................MRAAFMTLGCKVNQFETETMEGLFRARGYEIVPFEERADVYVINTCSVTHLSDRKSRQIIRRAARMNPTIAVAGCYAQVSPEEVLEGVRVVIGTEERARIVDYVEEALRADGVVEEITDVMQARAFEDIPLHGVPHR---TRAFLKIEDGCQNFCSFCIIPYARGPVKSRPLAAVAREMEKLAAAGFREVVLTGIHLGAYGIDLPPTLADACRTAL-RTKEVRRLRLGSLESVELSEDLLSLVR--TEPRFAPHLHLPLQAGSDNVLRAMNRRYDTAAFAQLLADVRRAVPGAAISTDIIVGFPGETEEDFTAGLDFVRAMGFARMHVFPYSARRGTPAARRDQIAPPVRRERAARMQALAEEMAEAYHRLGTVDEVLFE--TEQDGVADGLTGTYIRVYTDA-AVPRGELVPMRLVRLCRDGVWGERV....................................................................................... 429
154 0.000e+00UniRef50_A0A1V5RAE4 tRNA dimethylallyltransferase n=1 Tax=Parcubacteria group bacterium ADurb.Bin316 TaxID=1852942 RepID=A0A1V5RAE4_9BACT  ali  28  1..............................................................MKKYNIITIGCQMNKSDSERVAGYLQNYGLLMVGDRKKADLIIINTCGVRQSAEDRVYGLVPKIKKENKKIVITGCLSLREQKRLEKNVDIWLPIVDLPKLAEKLSLKMNTKRPAKCGTPLLRGDLKCGDYLNIRPEYKSKISAFVPIGNGCNNFCTYCVVPYARGREVYRPTDEIINEVKKLVENGYKEIVLIAQNVNSYKSPLEIDFSDLL-KMVNDIPGDFWIRFATSHPKDMSDELIKT--VAECEKVCHHIHLPAQAGDNRIIKAMNRHYTRGHYIGLIKKIRQAMPDASITTDIIVGFPGETKQAFNNTAKLFREIKYDMAYIAQYSPRSGTAAAKLDDVEKKEKKNREEELMKILRKTALNKNYIGQEVEVLIFGKSKD-GKYFGYTQTNKNVKIAKEKNAIGKIVKVKIISAQDFGLEGEIAEKKKVIVIVGTTS.......................................................................... 482
155 0.000e+00UniRef50_D0LST9 tRNA-2-methylthio-N(6)-dimethylallyladenosine synthase n=5 Tax=Myxococcales TaxID=29 RepID=D0LST9_HALO1  ali  23  2....................DAGP-PQIIPTSALTRKPPAEQSSGAAAAETASEAAAAAAATGPRVYLETYGCQMNVADSDMLTGILLDAGYRRAASADAADVILINTCAVRERAEDKVLARARQLQRPDMVLGIAGCMAEHLKDSLLPYVDIVAGPDSYRRMGELLARARDLAAPAAGERADSDADKGETYEGLSGALGGDGISGFVTIQRGCDKFCTFCVVPFTRGRERGSAPREILRQVRAYVEAGYREVVLLGQTVNSYRYE-DVGFAELL-RAVARVDGLERIRFTSPYPVDFTAEVID--AIASEDKVCKYVHLPLQSGSDEVLARMRRGYTVDDFRAIVAALRARMPDIAISTDILSSFSGETEADHQATLALMRELRFDSAFMFRYSERSLTYAAKPDDVSEADKKRRLAEIIALQERISAEAAQIGKRERVLLHNRSKRSDQLVGRTDGFKSVIVPAAGLAIGDIVEVEIERATMATLFGRPIGDAAAGNRDTRT........................................................................... 511
156 0.000e+00UniRef50_S0EVC1 Radical SAM methylthiotransferase, MiaB/RimO family n=2 Tax=Chthonomonas TaxID=1077265 RepID=S0EVC1_CHTCT  ali  23  1..............................................................MPTAAFMTLGCKVNQYETQRILDDFERHGFTITEFHRPADIYVVNTCSVTQAAERKSRNTLRRARRLNPIVVMTGCYAERIKGEAFEEVNLIVPNPHKMQLNRLLEAF----------PEIRASLQNSRPPSSTAPTLHRRTRATIKVQDGCDVFCTFCSIPYTRTQMVSRPMGEIVSEVERLADQGFTEIVITGVLVGAYGQEPGEGRSEGLPRGTAKVEGIRRIRLSSIEPTQITDRLLE--AFASEQKLCPHLHIPLQSGSDKILAAMNRPYNQRFYLERCAAAKARIPDLAITADIMVGFPGEDRKDFEQTLYVAREVGYARAHVFRYSPRPNTPAATMDQVSDAEKEARSQELIALCRETQKRQSYLGRTMEVLVEGKGEPSGLLGGYTGNYIRVQFTGGSHLIGKLVQVRLLETTLDGAIGEIGDDTLEPMPEPPASLPLATLSG.................................................................. 488
157 0.000e+00UniRef50_A0A212PD92 Threonylcarbamoyladenosine tRNA methylthiotransferase MtaB n=1 Tax=Geobacter sp. DSM 9736 TaxID=1277350 RepID=A0A212PD92_9DELT :_  ali  28  1..............................................................MQRVAITTLGCKTNQFESAGMGEILGKEGFVVVPFDEQADVYIINTCTVTARTDAESRRLIRRAQRPNARIVVTGCYAQVAPEELLPGVDLILGNTEKKDIVSFLREAPAEGRVLV----SDITGERHAAPLAL-ESFAEHTRAFLQVQNGCDAFCSYCIVPYARGRSRSVSTEEVLKGIASFAASGYQEVVLTGIHLSAYGLDLEPSLHGLLQE-VERRQLVPRLRLGSLEPAEIGDELIDL--VARSKVICPHIHIPLQSGADGVLHRMNRTYTARFFAELVGRLSAAVPGICIGLDMIAGFPGETEEEFLAGWSLVESLPIAYLHVFPYSLRPGTAAASMGHLPPRVITERARRLRELSERKRDEYHFVGKTIRVLV-QSSDGSGNLKGLSRHYVSVSFPGNRDTYNREVTVRILGSSGEGLVGEL........................................................................................ 429
158 0.000e+00UniRef50_UPI00094E9C18 tRNA (N6-isopentenyl adenosine(37)-C2)-methylthiotransferase MiaB n=2 Tax=Ezakiella TaxID=1582879 RepID=UPI00094E9C18  ali  27  1..........................................................................MNEHDSEILAHKLEDMGYSYTDELKDADLIIFNTCAIRKNAENKVYGNLGWLKGDNKIVCVCGCMMQSEILEKYKNVNIIFGTNNIDKIDSFIKEYLNTGKTVV-----EIKEENDYIDKTFNAVRPFKFKSFVNITYGCNNFCTYCIVPYTRGRETSRLQKDIVDEVKFLVNDGVKEVMLLGQNVNSYGKKDGTNFAGLLKEL-GQIRDLKRIRFMTPHPRDISEEFLDCYS--SVDNLMPQLHLPIQSGSDKVLKDMNRHYDTEKYLKIIDYAKKVRPDISFSTDIIVGYPTETEEDFERTLDIIKEVRYDSAFTFIFSPRPHTPAARLKPLDKDVVKDRFDRLTDLMNDIQLKNHEVGKRYEVLVESYNEDNATIEGRNEYGRTIVFEGSKDDIGRILTVEVDKVNTFTSYGKEV....................................................................................... 423
159 0.000e+00UniRef50_A0A1V6EG10 Threonylcarbamoyladenosine tRNA methylthiotransferase MtaB n=2 Tax=unclassified Firmicutes sensu stricto (miscellaneous) TaxID=84  ali  25  1..............................................................MKTYSIVTLGCKVNQYESATIASTLDAMGFQYKKFPDICDIYVINTCTVTAMSDRKSRQMIGKARASNSIIIATGCSAQADAQALHSGADIVLGNNEKSCIDTILSSYLKEKTGKLTV--VSDIFREKEYIHGCFPDKWERTRGYLKIQDGCDNFCSYCIIPYVRGRARSRDIDDIVAEARYMASKGIKEVVLTGIHLDSYGKDKGNSIIDVISKI-NDIEGIERIRLGSLEPKIITETFVE--EIKKYDKLCPHFHMSLQSGSDAVLSDMRRRYDSEMFLNAINMLRNNIPDVEFTTDIIAGYPTETEEDFNKSLEMVEKARFIKVHVFKFSKRPGTTAAKLKPVDGKILNGRSEKLINYASEISKSRGYLGKTLRILIEE--SEDGFITGHTANYIKVQAPSDDDCINTFCDVLICGLTDDGLMGEVVAKKTVR................................................................................. 439
160 0.000e+00UniRef50_A0A2E5AU33 tRNA-2-methylthio-N(6)-dimethylallyladenosine synthase n=9 Tax=Bacteria TaxID=2 RepID=A0A2E5AU33_9BACT  ali  24  1..............................................................MKKVFIETYGCQMNEYDSDRIINALNA---TPTNVAENADIIIINTCAIREKADHKAVSAVGRLKKNKPELIVGGCVAQLYGKKLLPYLDFVLGPRGIPQIPKIIKDIRSENNHRPIETSMDVQDVFDI----TPYHKKDKVAGFVSIQQGCNKKCAYCIVPTTRGSEINRPINEIISESKYLVELGAKEITYIGQTVNSWKHNR-LRFPSLLDNL-QEIDGLERIRFTTSFPKDITSKMI--SSMKKNSKVCKQLHLPVQSGSNKILREMSRTYSIEWYKQRIEMLRDEIPDIALSTDIIIGFGSESEKDFQETMDLINLIEFDTVYSFKYSVRPGTPGEKMKHVPDNKASKRLSILQERQKEITFKKNCLGKIIEVLIEGYSKQNNDLYGRTTYNKVVNVKNNDSNIGKLINVKITEATQNSLIGEQV....................................................................................... 434
161 0.000e+00UniRef50_A0A1W9S1S1 tRNA-2-methylthio-N(6)-dimethylallyladenosine synthase n=1 Tax=Candidatus Coatesbacteria bacterium 4484_99 TaxID=1970774 RepID=A0  ali  26  1..............................................................MKRFHIINYGCQMNLRDGEIIATMLEDRGLSISDTLSEADIIIVNTCAVRERAVERALGRIKQLARPGVIIAVGGCIAQTESDRILPFVDIVFGTRKITNLPDMIEKILTNCTERVL-----DIGEGDVYQEELVGYRFSPISAFISVMRGCNRFCSYCIVPYARGREVYRPEGDILKEAIVLTERGYKEITLIGQNVNAW-REGKRGFGNLLERVADE-TGVFFLRFITSHPANLTDEIIEQFSV--NKSLAPSIHLPLQAGSDRILKRMKRGYTIDYYKGLIDRLRKVCPHITITTDIMVGFPGEEEEDFELTLRAVEEIGFDGAYTFKYSPRVLTDASRMEQVPEEVRLERLRRLIEKVQEVGLERNRVGTLCKALIEGNAKRGG-LKGRLGSN-QVIVLAGDAKVGDIVEVRVKEASYWTLKGEIV....................................................................................... 431
162 0.000e+00UniRef50_A0A1I7AHJ0 Ribosomal protein S12 methylthiotransferase RimO n=6 Tax=Selenomonadaceae TaxID=1843491 RepID=A0A1I7AHJ0_SELRU  ali  25  1...............................................................MKAGFISLGCSKNLVDTEVMLGELTAHGIELTPDPAEADILIVNTCAFIQSAKEESITTVLNMADYKRSLIVAGCLGQRYKQELLPEADAILGTGAWSRIMEAVEETLKGHRVVIAGEDDTLYDEKTPRITTTP-----DYTAYVKIAEGCDNRCAFCAIPQIRGRFRSRRMEDICAEIERLTEKGVREVVLIAQDSTLYGKDIYGKLAELLRNIC-KVPKLKWVRTLYCYPKFFTDELIDVY--ANEPKVCKYVDLPLQHADNDVLRSMHRPDTREDMVALLDKLRARIPGVTIRSTFIVGFPGETDEQYQTLRKFLEEQRLDRVGVFTYSREEDTAAYDMPQVSEEVMQERYHDLMSLQSKISENQSFEGKELEVLVEGRDEEPNICVGRSEVDGQVYVENDDSKPGDIIKVKVLQGFTYDVVGEKLAD..................................................................................... 443
163 0.000e+00UniRef50_A0A1Q7Y703 tRNA-2-methylthio-N(6)-dimethylallyladenosine synthase n=10 Tax=unclassified Acidobacteria (miscellaneous) TaxID=305072 RepID=A0A  ali  27  5.................................................................VYIETLGCQMNVADTERAATKLRAAGYDLAESESEADVLIFNTCSVRAKAAQKVFHRIEYLKSVRPIIGIMGCVAQLEGEAVFDHIDFVAGTRATDRLGSLIERARDGEGRVIDLGERSEGEGWNV----SPVERHSPHVAFVPIIEGCNKFCTYCIVPYSRGRERSRVASDIVREIHGLLESGFKEVHLIGQNVNSYGIKGATPFSKLLRAVAR--TGIERIKFTTSFPRDFHEDI--VAAIDEHDNLCNWVHLPVQSGSDRILRRMRRGYSSSDYLSRVQCIKRAGRPLSLTTDIIVGFPGESTSDFEDTLRLVENCQYHGLYIFKYSERPGTPASRLDDVSREEKRARFLSLESLQRNIQIYSGYIGEKVKVLVEGESAKSNDLTGHTTCHKVLNFPGDSSLVGKIVEVIVTEAKVNSLYGRVVDGSPAL................................................................................. 451
164 0.000e+00UniRef50_X8K434 Ribosomal protein S12 methylthiotransferase RimO n=13 Tax=Clostridiales TaxID=186802 RepID=X8K434_9FIRM  ali  27  1............................................................MSNKKVFIDTLGCPKNFNDSEFAAGILEENGYEIIDSPEDADIIMVNTCGFINDAKKESIEHIFDMNERRKKLVVSGCLSQRYSEELIPEADCIIGVNQYNKLPEILSDIDNNHVAANSC-------DLDYLEKTVRKLSDNPYTATLKIAEGCNNTCTYCIIPMIRGKFRSKKMEDIITEAKELANAGCKELILIAQDVTYYGKDLYGKFPELLRELC-KIDGIEWIRLMYCYDERITDELIQV--MAEEDKICKYIDIPLQHASDNILRLMRRQTTRKSIKETLAKLKAAMPDIHVRTTLIVGFPGETEDDYDQLLELVESERFSRLGVFTYSQEENTVAAEMDQIDEDIKQIRFDGVMRRQMLISLNQEKIGKVFDVIVDSMD-EDGSFIGRTRFDAPVIFTSKNELPGDIVKVKINDAFDYDIIGE......................................................................................... 436
165 0.000e+00UniRef50_A0A1F2WUI4 tRNA-2-methylthio-N(6)-dimethylallyladenosine synthase n=3 Tax=Bacteria TaxID=2 RepID=A0A1F2WUI4_9ACTN  ali  26  15................................................................TYYLRSFGCQMNDHDSERIAGLLEEMGLSRRKSPEEAGLLVYNTCSIREKADSRLAGHLGAASRLKKEVVVAGCLAQSRRDEFFPFVDVLVGPQSLHELPGLVRRRANEGGPV-----GAFQEQTTRWSADLPRTRVTGPSAWVQITAGCSNYCSYCIVPYVRGPEASRPAAEVLEEVTRLAGSGIREVTLLGQNVNAYGNEGKETFAGLLGQAC-QVRGIERVRFMTSHPKDVSDALVHLL--GGHNQVCEHLHLPVQSGSDGILHAMRRGYDRAAYLGLARRLREAVPGLALTTDLIVAFPGETEADFAETLSLVEECRFDGAFTFVYSPRRRTAAAELPRVAPEAAQSRMERLVEVVQRIGRERNLVGQISEVMVERASRERGEVMGRTRTHKPVNFVSTAG-PGDFVLVELLEATSTSFRGRQVS...................................................................................... 450
166 0.000e+00UniRef50_A0A1V4VR44 Ribosomal protein S12 methylthiotransferase RimO n=14 Tax=Clostridiales TaxID=186802 RepID=A0A1V4VR44_9FIRM  ali  28  4................................................................KVGLVSLGCPKNLVDSETMLGLLKGAGFTITNQEQEADVLIVNTCSFINESKEESIGTILDLARYKRAIVVAGCLAQRYPQELMPEIDCLLGTGAVPEVVRAVQAALAGEKLCLAGAPGYLQETSLPRMQSTP-----PYTAYLKIAEGCDNRCSYCVIPSIRGPYRSRTIEDVEEEAQQLASGMVKEVVLVAQDTTRYGFDRGKPALAALLKRLAAIDGLIWLRVLYTYPSLISDELVEI--IASENKVCRYLDLPLQHASQSVLAQMNRRGSKEETLRFVEKLRSAIPGITLRTTFITGFPGETEADLMELMDFMKAVRFDRVGIFAYSQEENTPAAGMPQIPEAVKLERREHLMALQQEISLERNKTGSVLPVLIEGIHHKPGVFVGRSEIDGKVFVRSELQLPGDFVQVLVSGASEYDLTGELI....................................................................................... 443
167 0.000e+00UniRef50_R6HDD6 tRNA methylthiotransferase YqeV n=2 Tax=Clostridiales TaxID=186802 RepID=R6HDD6_9CLOT  ali  24  1...............................................................MKIFIITFGCKVNQYESQSILEKFYSDGCTKAESVKDADVVVVNSCTVTAESDKKVKKALHKIRKENAVIVLTGCMPQAFPAESINEVDIILGNNNKNNILKYVLDFINNRSKII---KIENFVEKSNLKSTPINDFDERTRAFLKIEDGCNRFCSYCIIPYARGRVRSKPLEDILFETKNLAQKGYKEIVLVGINLSAYGTDIGINLCDAIEKVCS-VEGIKRVRLGSLEPEQMDE--ITIKRLSKQKKLCPQFHLSLQSGCNETLKRMNRHYTAEEYFTIVQNLRKHFKNASITTDVMVGFAGETEEEFEKSLNFVKKVEFSKVHVFAYSVRSGTRAAEFEQVEPNKKKRRSQIMIDEAAEIKFLNSQVGKIEPVLYERRDK-NGFFEGYTSNYTPVKINVNEDLHSKIILTELMQAESDYCLGRIADE..................................................................................... 433
168 0.000e+00UniRef50_A0A2G9HE86 CDK5 activator-binding protein n=9 Tax=Mesangiospermae TaxID=1437183 RepID=A0A2G9HE86_9LAMI  ali  23  79................PSLASNSSKFSDIPLHHFMPKATAAVTDASLSDTQLDFSSSTSVPDRGRIFHETYGCQMNVNDMEIVLSIMKKAGYEVVDVPENAEIIFINTCAIRDNAEQKVWQRLKRHWKSNPKVVVLGCMAERLKDKILKMVDVVCGPDAYRDLPRLLEEVDSGQKGMNTLLSL----EETYADINPVRISKNSISAFVSIMRGCNNMCSFCIVPFTRGRERSRPVESIVREVGELWKEGVKEVTLLGQNVNSYNRNMGLRFADLLDRLASEFPE-MRFRYTSPHPKDFPDELLYV--MRDRYNICKNIHLPAQSGSSTVLERMCRGYTRQAYLDLVKKIRTIIPDLGISSDFICGFCGETEEDHQETLSLIRAVGYDMAYMFAYSMREKTHAHRVDDVPDGVKQRRLTELIEAFRESTGQDSKVGSVQLVLVEGPNKRDTELIGKSDRGHRVSFTSRNPKVGDYVEVHIVKSTRASLHGDALAITKMSS................................................................................ 623
169 0.000e+00UniRef50_A0A2S8SNW8 tRNA-2-methylthio-N(6)-dimethylallyladenosine synthase n=1 Tax=Abditibacterium utsteinense TaxID=1960156 RepID=A0A2S8SNW8_9BACT :  ali  29  2..............................................................KPRYFIQTYGCQMNVHDSERMAGMLDGLGYDPTDAPEGADVILLNTCAVRERPEHKLYSELGQIRNPNLILGVAGCMAQREAQRRVPEVDILLGPRNLHHLSTLVRRAQN---RVEGAPHADGLDLECDPTPATPVRRTSAISAYVDIIFGCNFNCTYCAVPSARGPEISRRPSEILDEIRQLDELGYREITLLGQTVNAYGHDLGIDFSWLLTRI-NEINPKLRIRFTSPHPMYFNSRLVET--IAALPSVCEHLHLPVQSGDNEVLKRMKRTYSTEKYRRVIEEIRDKVPDVTVTTDTITGFCGETDAEFENTMQLYREIEFDQAYLFAYSPRHSTQAFDWDDVPIAVKKERLARLIDLQQIISRNRRQVGQSFDVLVEGVSHDSAKLAGRTRGNKLVIFPGTPAPAGSLVEVRADEAFLWGFKGEVTAFDTASAPRVLLELA........................................................................ 461
170 0.000e+00UniRef50_A0A1G5RUN3 Threonylcarbamoyladenosine tRNA methylthiotransferase MtaB n=4 Tax=Clostridiales TaxID=186802 RepID=A0A1G5RUN3_9FIRM  ali  26  3...............................................................RTVAFSTLGCKVNQYESDAMAKLFRDKGYEIVQENAPADVYVINTCTVTNLGDRKSRSIARRARRQNPVIAVVGCYAQVASAEVIEGVNLVLGTNERMKIVDYVEDLGPWDKVSAVGDIMEVA----EFEELQIDEHGDRTRAFIKIQEGCNQYCSYCIIPYARGRIRSRKIDHIESEVARLVGHGFREFVLTGIHIASYGKELENSPPEDVIERVDAIPGVKRLRLGSIEPMLMTQAFVE--RLSQLKSICPHFHLSLQSGSDRILKRMNRKYTAAEFLEVVDRLNRHFDRPSLTTDIIVGFPGETEDMFEETMTLAAKVGFAKIHVFQYSAKTGTPAAAMDQVEPSVRHDRSERLIALQNESAYNEKWLGSIKEVLFEGVPELGKEIEGLTPDYLRVKVEAGPGCIGKIAKVRLEALTEHGFKGTLIEEA.................................................................................... 443
171 0.000e+00UniRef50_A0A0F2R0H3 Uncharacterized protein n=2 Tax=Desulfatitalea TaxID=1303912 RepID=A0A0F2R0H3_9DELT  ali  26  1..............................................................MKTYRIITLGCKVNQCESAAMGHLLEAHGWTRTSDAELPDVLVVNTCTVTSKAGMQSRQAIRQAIRNNPKVVVTGCYAQTAADEVIEGVDQIIGHRDKMRIADLLSVSAPGS---CLTGSTGSPHDQAIFPAMPAVADQARTRAFLKIQDGCDTRCTYCIVPYARGRSRSMPPEDVRAHLSRLGAAGLREVVLTGIHLGAYGMDLDPSLTALLASLVDA-PSVDRIRISSIEPTEIDSRMIQLINHPDR-LICRHFHIPLQSGANELLQRMGRPYDRDFFKQTIEKIHHHIRDVAIGVDVIAGFPGESEEAFMQTYGLIESLPISYLHVFPFSPRKGTPAAAFEKVPQKITKERSKRLRELGEKKAFHRSMIGRTLTVLIEKADQSTGYASGLSDNYVQVFISGINVKENSLVTVHIERIDDGTVYGHRV....................................................................................... 435
172 0.000e+00UniRef50_A0A1F9KUY5 Ribosomal protein S12 methylthiotransferase RimO n=5 Tax=Bacteria TaxID=2 RepID=A0A1F9KUY5_9DELT  ali  27  4................................................................KINIVSLGCARNLVDTEVMAGLLREARYEVTPEPREADIILVNTCGFIDAAKEESVESILEMARLKRTLVVAGCLSQRYSDKLLPEVDLFIGTGEVPRIVEILKRHTETKNRLYV------GLPSYLYDHTTPRLRTASHTAFLKVSEGCDHKCAFCIIPQLRGPHRSRSIESVVAEATQLGRAGVKEINLIAQDLTAYGRERGTTLYGLLNEMASARE-IEWIRLLYAYPNYLDDALLDL--IRESDKICKYVDIPFQHASRRILTRMRRGKSGSAVREAAAKLRAAIPGLTLRTSLIVGFPGETEEDFQALLDLVEEAEFDRLGVFKYSQEDGTAAAAMGQVEEQEKERRWQEVMELQAEISRRKNRIGTIEKVIIDGLDGETGRLIGRTEVDGVVYVTGAKPKPGEIVETKITEALDYDLIGEML....................................................................................... 444
173 0.000e+00UniRef50_Q1D5V7 tRNA-2-methylthio-N(6)-dimethylallyladenosine synthase n=32 Tax=Bacteria TaxID=2 RepID=MIAB_MYXXD  ali  25  1..............................................................MKRYFIHTFGCQMNVNDSLRMSEVLSQMSYAPTPVPDNADLIILNTCSIREKAEDKMLSALGRYKSRGALIGVGGCVAQQEKDKLLKKVDFVFGPDNIARLPDIIGRVSAERERVV--ETAFVNSEEYVFPRADPETSRGKVTEFVTVMKGCDNVCSFCIVPHTRGREVSRAFPDVLVEVADLAKVGVREVTLIGQNVNSYA--GGISFAQLLLR-TAEVPGIERVRFTTSHPHDLSDELIEAFRV--QPKITPHFHLPVQCGSDRILKMMRRDYTVVQYLERLAKLREARPGIAVTTDIIVGFPGETEEEFEMTMQLTEQVRYDNQFSFVYSPRPKTGAALREKVPHEVKIARLERLQKLQRRISGEAALVGSEVEVMVEGHSRDATKRFGRTPENRTVNFDGD-APAGSFVTVKVERATPNQLAGKQVALLKPPTVEPPVPMAEAPFHVVAE............................................................... 461
174 0.000e+00UniRef50_A0A1F8ZVC4 Ribosomal protein S12 methylthiotransferase RimO n=1 Tax=Deltaproteobacteria bacterium RBG_13_43_22 TaxID=1797825 RepID=A0A1F8ZVC  ali  25  1...............................................................MKIYFISLGCAKNQVDSEMMLHQLERQGFTLTREPDEAEVVVVNTCSFIESATQESIETILEAARLKKELVVTGCFPQRYKSRLLPEVDLFLGTESFLGLADHISTLLAGRKTPKMILNSDPELWMEPYHRLLT---TSPGTAYLKIAEGCSNCCAYCTIPSIRGPFRSREPKVLIREAQVLAEQRIKEIILVAQDTTAYGSDLPVSFVDLIKEIL-KIDSFEWLRLLYLRPERITRELLTL--MAQENRISPYLDIPIQHVSDRILKAMDRLYGQKGIRDLIQKIRKTLPQAALRTTVMVGFPGETDKDFQELFRFVSEVEFDHLGVFKYSPEEGTKAARYDQVPEEISYRRMELLMARQKEISLKKNQIGSVEPVLISGVSPESELLIGRTEVDGVVFITDGEPQVGEIVKVKITEAHAYDLVGETIE...................................................................................... 443
175 0.000e+00UniRef50_A0A2N7PTD5 tRNA-2-methylthio-N(6)-dimethylallyladenosine synthase n=2 Tax=Mesoaciditoga TaxID=1495038 RepID=A0A2N7PTD5_9BACT  ali  27  1...............................................................MKVFFKTYGCQMNIHDSEIMKGLLKEAGHEIVDKIEDSDLVVVNTCAVRRKSENKVYSLIGRLKKGGHKVGVTGCVAQGMSEKLSNGVEFILGTRAIGSIVSAVEGLKK----------IDLEDRISEIDSQTPVLRNQKKHAWVNIIAGCDKFCTYCIVPYTRGRELSRPLSDVINEVIMLAKNGYKQVTFLGQNVDSYGKDLGTSLAKLL-ELSQAIDGIERFWFLTSYPSDISSDLIKV--VGKYPKISKNFHIPAQSGSNRILKKMNRRYTREEYLEIVEKIKKEVENSSIGGDIIVGFPDENDDDFEETLDLVKRVRYIRLNVAPYSPRPGTVAAKYDNVPFNVKKTRMSRLNEIQHSIELNEALINKEVEIMIENTARKVSY--GRTIDNRMVAVD-EIIPEGEMIRVRIEDFKFGTLYA.......................................................................................... 417
176 0.000e+00UniRef50_A0A1F9BFH4 tRNA (N(6)-L-threonylcarbamoyladenosine(37)-C(2))-methylthiotransferase MtaB n=4 Tax=Deltaproteobacteria TaxID=28221 RepID=A0A1F9  ali  26  8................................................................KVGLVTLGCKVNQCETAALAEDLRKKGFLSVSFNSFADIYIINTCTVTAFSDFQSRQLIRRAKRANPKIIVTGCYAQIASAAIIDGVNMVVGNSQKNTIPELLQNRNNDSPFVLA----DNILSQRYFCDMPLSEFSGRTRAFLKIQDGCNSFCSYCIVPFARGKSRSLPPDNLLATVKKFAEKGYREIVLTGIHLGVYGYDLNPNLTAILKQIISSRPE-MRFRLSSIEPREITDDLLHLF--IKRDNLCPHLHIPLQSGDDKILGLMKRNYNVAFYREQIKKITASIKNISIGVDVMVGFPGEGDVEFNNTYRLLHDLPFSYFHVFPYSERPGTAAEKLPKVPQKIKKERAAILRDLGAEKQFASRFLGKNIDVLVEKKDNKTGLMKGFSQNYLPILLEINESRANTIVKVCANKLENGKLYGKIVT...................................................................................... 440
177 0.000e+00UniRef50_A0A1G1A040 tRNA-2-methylthio-N(6)-dimethylallyladenosine synthase n=2 Tax=unclassified Lentisphaerae (miscellaneous) TaxID=641407 RepID=A0A1  ali  28  1...............................................................MIFHLHTYGCQMNQRDSEALAEQLIKAGYQRSITGESADIVIVNSCSVRGKAEDKALGKLAMLAANRRYLGVVGCMVQRMQKQLFDRVDFAVGPQRIHRLPAILDQVIAGQGPVLDVSLSDN-------PEMLTGHQSGTISAFVTILLGCNRRCAYCIVPTVRGPEWSRPASGILEEIRILSAAGVREVTLLGQSVMSYGRSNPEPLPRLL-EAVCGIPSIVRLRFTSGHPSGCTEELARV--MGACAPLCEHLHLPVQSGSDAVLHRMRRGYSSDDYRRAVERLRRSVPALSLTTDVIVGFPGETNDDFEQTRSFLDEIGFDNAFIFKYSPRPGTPAASWDDVPETEKNRRNQVLLEDQDRLQRHQNRIGCDMEILVEGPSRDPTRWAGRTRSNIVTIFDPRPGLPGSLVTVRIDRVRPQTLYGTI........................................................................................ 445
178 0.000e+00UniRef50_A0A1G9JWA5 Threonylcarbamoyladenosine tRNA methylthiotransferase MtaB n=3 Tax=Halanaerobiales TaxID=53433 RepID=A0A1G9JWA5_9FIRM  ali  27  10...............................................................PRIAVYNLGCKVNEYEAEALIDQFRRAGYKPVDFSEAAEIYVINSCAVTTSAASKSRKMARRASRRNSIVIVAGCYSQSTPGEEIDEVDYLVGSSDKDRLVELIEEISADRS---WLAPRKNYEKIDEYPELEVREVERRTRANIKIQDGCDQFCSYCIIPLARGKKRSREPESVLEEFERLKTQNVKEFILTGIHLGAYGDDFSDDLQELLQQILGK-KGDFRIRLSSLEALEVSRELVEL--IGESEKFCRHLHLPLQSGSNRVLSRMNRPYRVEDFTQKINMIRDIVPEIAITSDVMVGFPGETEEDFERTVKTVEKLEFSDIHVFSYSSRPGTKAASMDEVDSRIKKERSKILRQLGKKLSYKKRFLKKTLRVLFERE-KDGGSFSGYSDNYLRIRVESEKTLKNKFSKVKLKKSDEGELKGALIENP.................................................................................... 447
179 0.000e+00UniRef50_A0A2H0A952 tRNA-2-methylthio-N(6)-dimethylallyladenosine synthase n=4 Tax=Candidatus Desantisbacteria TaxID=1819803 RepID=A0A2H0A952_9BACT :  ali  28  12........................................................ERGLKQKKKAHIITYGCQMNRYDSVVISRILEAEGYELTTDEDCASFILINTCSIRKHAEDKVLSKLGRLAVRKKIIAVCGCMAQRLGNKLFPEIDFVLGTSMITELPNILK--VEGRKRIYTGESS---------CLYPSTIPEKGLKSYLAVILGCDNYCSYCIVPFVRGKPRSRGKIEIIREIEELIKSGCKEITLLGQNILAYGRDIDESFRALL-KGVHAIDGLMRIRFLTSHPRDITADLVDIFS--ELPKVCEHFHLPVQSGSDRILGLMKRGYTIDHYKRIVDKIRQKCSCPSITTDLIVGFPGETMNDFDDTMRLVGELRFDTAFCFKYSPREGTPACKFDQVPEEEKIRRLKELLDMQKDITLNQDMVGGVQEILLDEKNKDDDSLLGRTRGDKVVVVSTKIHKIGDIGIVRIVKADNYCLQGEFVDE..................................................................................... 447
180 0.000e+00UniRef50_A0A2P2I1K8 Threonylcarbamoyladenosine tRNA methylthiotransferase-like n=1 Tax=Hirondellea gigas TaxID=1518452 RepID=A0A2P2I1K8_9CRUS  ali  62  138................................SVLANGFVSAASEALSKEETNGSSISNIPGLARIFVRTWGCAHNSSDSEYMAGQLAAYGYDIVDSSESADLWLLNSCTVKSPAEHHLRNEIKAALGLGKKVVVAGCVSEGAPKSEFLAGLSIVGVQQIDRVVEVVEETLRGNSVRMLGTKKLGKKKLGGASLQLPKIRRNPLIEILSINTGCLNQCTYCKTKHARGQLASYPIDELVARAEQSFKEGVVEIWLTSEDTGAYGRDIGVTLPELLQKLVQVIPEGCKLRLGMTNPPYILDHLTEMGRILQHPRVYKFLHVPVQSGSTNVLYDMKREYTREEFCTVVDTLRDSVPGITIATDIICGYPTETEEDFQETMSLCRHYLFPSLFINQYFPRPGTPAAALTKIHPKQVKRRTKELSDLFQSYRPYDHKLGEVQSILVTEESHDKLHWVGHNQYYDQVLVPKEQDYLGKTLQVVISETGKHHLKGRVLDPAAIVSPALATPLPQGAVSGNTSPSKASSPE....................................................... 629
181 0.000e+00UniRef50_A0A2H5X5K8 Threonylcarbamoyladenosine tRNA methylthiotransferase MtaB n=1 Tax=bacterium HR16 TaxID=2035411 RepID=A0A2H5X5K8_9BACT  ali  25  1..............................................................MVRVAFATLGCKVNQYETQRIIDTFEEQGFAVVGFDEPAELYVVNSCSVTQLAEKKSLQIVRRVARQNPRVVLTGCFAQILRGETVAEAALLVPNTDKMRTVHYVLEAFPDVRERVSREPAPPVLRNPY----------ERTRAVVKIQDGCNVCCSFCSIPYTRPRMFSRPYTEVLDEIRRLVDEGFKEVVLTGVLIGSYGREGGPDLAGLLQRM-ARIEGLERIRISSIELTQVTDRLIEV--CAGERKVCPHLHIPLQSGDDRILQAMNRPYRQQDVLSLAEKLYSKIPDLAITTDIMVGFPGEDEAAFGETCKVVEAVQYARAHIFRFSPRPGTPAERMEQVPEPEKERRSHELADLCRKHRERAARLGRTMRVLVEGKQGKGGLMKGLTDNYIPVEFAGGAHLAGQLVWVRLLELTDEGALGELVTTSSGGHEDGRLHLLPNRTEA.................................................................. 448
182 0.000e+00UniRef50_A0A2H0P578 tRNA-2-methylthio-N(6)-dimethylallyladenosine synthase n=1 Tax=Deltaproteobacteria bacterium CG11_big_fil_rev_8_21_14_0_20_49_13  ali  28  13...............................................................PRVYIRTFGCQMNVHDSERISEILSGMGLGPAGDDKDADIILFNTCTVRDHAHHKAISEIGRARKKDLIVGVCGCVAQEEKERIYPELDIVFGPDQITRLPELLNEVIEARKTIATELIDDPDEYKWLFHDSQTPAIDQSISKFVTIMKGCNNKCSFCIVPFVRGSEVSKPSDDIVSEIKGLVAKGVKEVTLLGQNVNSYNRSEGSPFVLLLQKISSETD-ILRIRYTSPHPKDLCDDLIN--EHAANPKLCSHMHLPLQAGSDRVLRMMKRSYNKKQFIERSLKLRERAVGIDITTDIIVGFPGETHEDFLKTLEVVKEVSFDGMFAFKYSPRHGTVAAEIDDVPQKEKEGRLARLLELNADIWKQKRLVGTTQQVLVEGASKKSTYMSGRTFGSKIVNFAGNLEQVGSIVPVTIVSAGPNSLKGEL........................................................................................ 514
183 0.000e+00UniRef50_A0A2M7SZV6 tRNA-2-methylthio-N(6)-dimethylallyladenosine synthase n=1 Tax=Alphaproteobacteria bacterium CG_4_10_14_0_8_um_filter_53_9 TaxID=  ali  24  20................................................................RLFIKNYGCQMNVYDGDRIADMLAPLGYTPVDDVAGANVVVLNTCHIREKADDKLFSDIGRFRRPDAVIAVGGCIGQAMGAKVMPAVSVVFGPQTYHRLPALIGKVLDGRTARAPVRAVDTDFPELEKFDSLPRPGMRGPSAFVTIQEGCDKFCTYCVVPYTRGAEISRPHAQVLEEIRAMAAQGVREVTLLGQNVNAYMDDDGVSMAGL-CELVGEVDGIERIRFTTSHPNNTTDDLIN--AFATNSKLMPYFHLPVQAGSNRILTAMNRNHTAESYLATLEKIKAVTPDMAICGDFIVGFPGETEDDFLETLKIAHAVGYMGAYSFAYSPRPGTPAADLDQVDERTKKARLAALQAVLDATHFLSRFVGDEVEILVEQVGEDSGQLHGRSRHNISVNLDVPEALVGTLVHGRVEVMTGRSLRGVL........................................................................................ 474
184 0.000e+00UniRef50_A0A0A0E359 Uncharacterized protein n=5 Tax=Bacteria TaxID=2 RepID=A0A0A0E359_9SPIO  ali  26  1..............................................................MSKFSITTLGCKVNQAESEAIAQELLTSEWSTASSCEKAEVCIVNTCTVTQKASMQSRQAIRKAIRANPKIVVTGCYAQTAPQEIIEGVDYVIGQDQKLTISRMIQEP-GNADFDNQETGSGEVPANRQFQAMPAAISAPRTRPFLKIQDGCDAYCTYCIVPYARGRSRSMPPENVLQGIQQLVDADFHEVVLTGIHLGAYGQDLGGNLAALLRRIRD-LASVDRVRLSSIEPLELTTDVIEL--VAGSPKFCRHFHIPLQSGDDRILAKMGRPYTRQAFIDLVATIKKLMPDAAIGADTLIGFPGESDDSFESTYNLISDLPLSYLHVFPFSARPGTPAAGYDKIPRAVIKDRCERMRRLGKRTLFYRQFVGQTMPLLIEKRNDASGLLKGIPSNYLPVLIAGGDELKNKIIDVRIERMEGNRLFG.......................................................................................... 433
185 0.000e+00UniRef50_A0A1Z8STD0 tRNA-2-methylthio-N(6)-dimethylallyladenosine synthase n=1 Tax=Verrucomicrobia bacterium TMED44 TaxID=1986791 RepID=A0A1Z8STD0_9B  ali  27  1..............................................................MKRVFIKTYGCQMNERDSESVAHDLETNGYALVSDEKLADIVLLNTCSVREKAELKAIGKANQLKRKNITLGILGCMAQNRGSELVKGVDLIVGTQKFHRVSEYLDRISSDQSKETQPLISLDEEKGSQNKINQHLISDQKVSSFVSIMQGCNMNCTFCIVPKTRGKERYREIHDICDEIKLLRDKGVREITLLGQIVNAYGRDEKSPFVQLLEKI-HEIDGIERIRFTSPHPTSFGSDLIE--AFVRLPKLCDYAHLPMQSGSNKVLKSMNRPYSIEKFLSIVQSLRSKNKNMRLSTDVIVGYPGESETDFQETLSAFKESAFEMAFIFKYSERSGTRAANLDKIPQSIKEERNQILLKTLDKQSLESNLISSKLDVLVESRAKKGGEYMGRTSCFRKVIFPAESHSIGKILPVEILEVSSTILKGKIV....................................................................................... 446
186 0.000e+00UniRef50_A0A2G6Q0Q3 tRNA-2-methylthio-N(6)-dimethylallyladenosine synthase n=2 Tax=Acidobacteria bacterium TaxID=1978231 RepID=A0A2G6Q0Q3_9BACT  ali  28  2..............................................................KKKYYIETWGCQMNVHDSEKIAGTLSSLGYSKAETIEQADVYLMNTCTIREKAKEKIFSRIGVVKELKKKIGVAGCVAQQEGRQIFPQVDFVMGTQALQDLPELLLE--------KHACSIEKHPDNHLFPTDQI-VRKEGLKAQVTIMEGCDNFCSYCIVPYTRGRERSRNIPDILYEIRNLVSSGFVEIELLGQNVNSYNSE--VNFATLLRE-VSAIRGVEMLRFISPHPKDFNIEVIDI--IRDNNNIGTGLHLPAQSGNTRILKRMGRGHTREHYLQLTAMIQEKLPECSLTSDFIVGFPGETEAEFLETVSLIEEVGYDRIFSFMYSPRPGTRAVQYDPIPKHEKAKRLQYLQTKQAEIQKKRDRIGKRDRILVDRLKPEDQHLAGRNRENLLVHVQSEDRFIGRWIDVDIVGAGMHTLRGKLL....................................................................................... 432
187 0.000e+00UniRef50_A0A2D6F5N9 tRNA (N(6)-L-threonylcarbamoyladenosine(37)-C(2))-methylthiotransferase MtaB n=6 Tax=Chloroflexi TaxID=200795 RepID=A0A2D6F5N9_9C  ali  28  1...............................................................MKVALDTLGCKLNQAETERLSRQLLEAGHCLVPSTTKADIYILNTCTVTHSADSKSRHWLRLAHRRNARLVVTGCYAQRKPDELIAGVSLVVGNNEKPRLLSLLQDT------------GCLVSPTSTNGHLLTPIKPRRTRTFIKIQDGCSHFCAYCIVPRVRRQEKSQPADHTVAEIKQRVSEGYQEIVLTGTKIGDY-RDNGLNLKGLLERILTETD-VPRLRLSSLQPQEISPELLKVW---QNSRLCPHFHLSLQSGSDQILQRMRRSYSTVDYHRVVRLIRDVVPDAAITTDIIVGFPGETEKQFAESNEFCHKLRFARIHIFSFSPRPGTEANQMDQLGAEVKRERSQKMLALAQEESFQKQFLGQLIPVLWEMKS--DGIWSGLTSNYIKVYGKSNEDLTNKLLSVKLIKTKGDGMWGENIGFSRSLANTPNKE.......................................................................... 430
188 0.000e+00UniRef50_A0A1F4TLZ5 tRNA-2-methylthio-N(6)-dimethylallyladenosine synthase n=3 Tax=Candidatus Saganbacteria TaxID=1703751 RepID=A0A1F4TLZ5_9BACT  ali  28  5............................................................GKNRRYFIKTYGCQMNIVDSEKLAAIFEAAGYQPAKSRKEADFLLVNTCVVRQGAEDRAVGYLRE-HKPNLKIGLCGCIPGRDIKKQFPHIDVFVPPHS----PEVLADFLK----------LENPSPSGRGGVCSSVGRGEGITKYITIMHGCDNYCSYCVVPYVRGREHSRPIADVLEDVRQSGSPAVKEIFLLGQNVNSY----KYGLAKLLKEIEILITPITRIRFMTNHPKDMSDEIIQ--AVADLPRVCEFFHLPIQHGSDRILKLMNRGYTVDYYRKLVEKIRAKVPGAAITGDIIVGFPGETDEDFRLTLRIVEQIGFDACNTLMYSQRPGTAASKLDDVPQKVKKERLHQLMKLVDSIKNNKKLVGTVQEVLVDNLSEREGSYTGRTRTNKIVKFPSEKDLLGHTVSVKITSALSWLLKGELVNEE.................................................................................... 448
189 0.000e+00UniRef50_C7GYJ0 tRNA-2-methylthio-N(6)-dimethylallyladenosine synthase n=2 Tax=Clostridiales Family XIII. Incertae Sedis TaxID=543314 RepID=C7GYJ0_9F  ali  23  8................................................................KYNIITFGCQMNERDSESIAGILKSHGLTSA-SIEEADIVVINTCSIRENANNKFYGTLGIVKNIDLVVCVCGCMMQEDLKARFPFVDVIFGTHNIDRVYDLIIKTIETKRREIEILENAEIKE-------MPVDRVNKHKAFVNITFGCNNFCTYCIVPYTRGREKSRSLDKILGETADAVSLGAKEVTFLGQNVNSYRGENGENFRDVLVEA-SKIQGLERIRFMTSHPKDLTDELIDVM---SLDKIMPHIHLPVQSGSSEILKRMNRHYDRERYLEIIDKIYSLNEDIAITTDIIVGFPTETEEDFSKTLDLVRRARFDAAFTFMYSKRRNTKAANFDQVDRVEMGRRFDMLSELLKDISFEKNFIGRRIKVMVDKI--EGDNAEGRSPEFKLVKFYGKNIKKGDILDVVVDRASPFSLSGK......................................................................................... 436
190 0.000e+00UniRef50_J4K927 Radical SAM methylthiotransferase, MiaB/RimO family n=6 Tax=Clostridiales TaxID=186802 RepID=J4K927_9FIRM  ali  24  1..............................................................MKTVAFHTLGCKVNTYETEAMQQLMESAGYRCVDFTERADVYIINTCSVTNIADRKSRQMLHRARKMNAIVVAAGCYVESAKNKIDEDIDIIVGNNNKNDIVNIINEYLQDKIKNKFIIDINKETEYEEFNI---RKINDHTRAFIKVQDGCNQFCSYCIIPFTRGRVRSRKMENILDEVKNLSASGYKEIVLTGIHLSSYGVDFKNELLCLIENIAN-VEGIERVRIGSLEPRIIQENFIK--SLSNIDKFCPHFHLSLQSGCDKTLKSMNRKYTADEFYEGVKLIRKYFDSPAITTDIIVGFPGETKTDFEESKAFVEKVKFYETHIFPYSIREGTKAANMPQVDGNEKAQRANILNELKNQREFRASRIGKEDELLCEEIFIKDGYFTGYTKEYVKVAVLNSDLKTNDIVSGKIVDFLTDD............................................................................................. 450
191 0.000e+00UniRef50_A0A139DTC3 tRNA-2-methylthio-N(6)-dimethylallyladenosine synthase n=1 Tax=Candidatus Adiutrix intracellularis TaxID=1705730 RepID=A0A139DTC3  ali  26  5...............................................................RRAHLVTFGCQMNEYDSGRLRDLLCAHGWQLTEIREEADFIFFNTCSIRAKAAQRALRRLRPLKKNNPIIGLGGCLAEQEGRALFPWLDLVAGPQHLPRLPDILDEILTDRSQIALIGPGETPAEAQGAKPDTFNSTAGPLLDYVTIMQGCNNYCAYCVVPYLRGPELSRPAGEIVSEIKGRVAAGSRDITLLGQNVNAYGRDGEPDFPGLLRLIAD--TGLDRLRFITSHPRDFSPELVNLFGDLSSLSESLHL--PVQSGSDAVLKAMGRGYTRRVYLDLIEALRVRCPNLTLTTDLIVGFPGETEADFDESLSLIETVGFDAMFSFKYSDRSNTVASSLDKVLEEEKSRRLIELQTRQKVITLAKNLLGTVLEVLVERVSSRPGQLTGRARNYKLVHFDGPPELIGQLVSVRVIEAFSTSLRGERVEASR................................................................................... 454
192 0.000e+00UniRef50_A0A1Z8MGI7 tRNA (N(6)-L-threonylcarbamoyladenosine(37)-C(2))-methylthiotransferase MtaB n=3 Tax=unclassified Bacteria TaxID=2323 RepID=A0A1Z  ali  25  13...............................................................PTAAILTFGCKVNQYDSNAMRSTLIHKGYRIVSETQSADXYIVNTCTVTNVADQKARQIIRRVATKNPKVLVTGCYAESDREEEIDGVSLVFGNREKANLDQYLEKIQPNQGLLQIEPVQHDAIREHANFSLSVADTGDRTRGIIKVQDGCSAFCTYCIIPYVRGRMTSRPISEIVAEAEVLSSSGAKEIVLTGVHLGSXGKSNRETVADIL-EGVHSINGIERIRLSSIEPMNFPFEL--VSRMANLPKXMPHFHLPLQAGSDQTLERMRRRYTTDEFIRLVDHIRSVFPEVGLTTDIMVGFPGETNQDFEESLRFVNKIGFSQLHVFRYSPRNGTPAAEFEQIPSHVSSERSKRMIEIGRKTAFRKKMIGRNTKILVESVTA-NYQGSGFTDNYLRTEINGYSGQINQIIPAVLTGIKGDIMQAEIIDXS.................................................................................... 461
193 0.000e+00UniRef50_I4B843 tRNA-2-methylthio-N(6)-dimethylallyladenosine synthase n=2 Tax=Turneriella TaxID=338321 RepID=I4B843_TURPD  ali  22  10.......................................KAAVSARVSKTETEMPTAPKAPA-RQFYIETYGCQMNEYDS-LLAGKILESNATQTASPAEADIILLNTCAIRENAHQKVYNRLRELSRFHKKVGILGCMAQNLREDLLYEVDFIMGPDALRNLAQLVDSTADTGRSFLNLSRIETYDDIVPTFEHHMRYRDSKITASVTIQRGCDNFCAFCVVPYTRGRERSRPIDSIVAEVQALAESGVKTVILLGQNVNSYHHE-KARFIDLIEALLARTT-IARIYFSSPHPKDFPVELIDL--MAAEPRFCNQVHMPLQAGANNTLRRMKRNYTREEFLEIVERVRARVHDVAISTDVIAGFPGESDADFEETLEMMRLADFDSAFMFAYSERKGTIAQRLDDVPEAVKKERLARMIDLQRSHTNNLRYVGQVVEAMAEQPSRRDASWIARMSNGRKVVFQVADALPGSLVQLQITGASSQVLHGKEI....................................................................................... 471
194 0.000e+00UniRef50_A0A088T257 Threonylcarbamoyladenosine tRNA methylthiotransferase MtaB n=2 Tax=Candidatus Izimaplasma TaxID=1912503 RepID=A0A088T257_9BACT :_  ali  26  1...............................................................MKIAFYTLGCKVNTYETESIWEIFKSHGYNRVKSDEYADVYIVNTCTVTNSGDSKSRKAIRKLIKNNPEIAVMGCYSQMDPEKEIDGVDIVIGTKHREQIYPLVEKVLRERTRIKNVTDV---SKYRVFDETHVTNFTENTRAFLKIQDGCNNFCSYCIIPFARGPVRSRDKDSILEEARDLVKNKYHEIVLTGIHTGGYGTDLGYSFYDLLEDL-SSIDNLDRIRLSSIEINELTEDILNL--IASNKKFAKHLHIPLQSGSERVLSEMRRKYTKDEFRNMIVNIRNIIPNIAITTDVIVGYPSETDEEYLEMFDFIKEMKFSELHVFPYSRRSGTIAAKMDQINGIIKSYRVNQLLVLSEELA--NNYIDNTLSVIFE--TSDSEFTYGHSDNYLYVKTDKDLTLHNKLIDTKIIKGTHRNLY........................................................................................... 423
195 0.000e+00UniRef50_A0A0V0X149 Threonylcarbamoyladenosine tRNA methylthiotransferase n=19 Tax=Eukaryota TaxID=2759 RepID=A0A0V0X149_9BILA  ali  55  2...SPVTHLPDDIEDVFSD----------LASRERKDVKVNNGYKKKYLWPGKACADSFIPGAFSVYVKTWGCTHNSSDSEYMAGLMSSAGYGIVDDPSMADIWLLNSCTVKTPSEQHVQNELEKARRLNKPVIVSGCVPQAEPS--IPGVSLV-GIQQIDRIVEVVEETLKGNTVQLLNYKKVQGKRTAGARLDLPKVRRNPLIEIIAINTGCLNNCTYCKTKKARGNLASYSIEEIIERAESCISEGVKEIWLTSEDLGAYGRDIDCTLPELLKALTAKLPDGVMLRLGMTNPPHIPISVQEIGEILNHPCVYSFLHIPVQSGSDAVLRDMRREYNVDDFCAVVEFMRKKVPGITIATDVICGFPTETEQDFNDTLDLVEKYRFASLFINQFYPRPGTPAAKLKRLDTAVVKDRTRRMTQLFNSYEPYRNRVGLKYQVLITERSFRDDYLVGHNKFYEQILVANQPNLLGKKVWVKIVSCSKHSMVGELIPQPA................................................................................... 486
196 0.000e+00UniRef50_A0A1V5U0J9 Threonylcarbamoyladenosine tRNA methylthiotransferase MtaB n=4 Tax=Firmicutes TaxID=1239 RepID=A0A1V5U0J9_9FIRM  ali  25  1...............................................................MRVAFCTLGCKVNQYDTDAMRALFVKAGHEVVDFEQKADVYVVNTCTVTSVGDKKSRQMVSRAHARNPEIVVAGCFAQGAPGEALPGVAALAGTAERADIVRIAEDALAGVRRTEV-----RAYRGRAAFEELDVSREGRTRAYLKIQDGCDRYCAYCIIPYVRGPVRSRTLEDVRRQLELLEAEGYKEIVLTGIHLMSYGKDLSG--AALLDAVADGLPGIRRIRLGSLEPQMFSEEFVR--ALADDPRACRQFHLSLQSGSAGVLARMGRRYGPQEYAACVRMLREAMPESAVTTDVIVGFPGETDAEFEETLAFARRVALSRIHVFPFSARKGTRAYDMDRVGAEVKKERAARLLALGKELEFAQGHVGRVEEVLFEE--RKGAYLLGHTGTYVAARVKTEAALEGEIAKIKIVLARGNALEGEI........................................................................................ 426
197 0.000e+00UniRef50_A0A2A5DRT4 tRNA-2-methylthio-N(6)-dimethylallyladenosine synthase n=1 Tax=Planctomycetes bacterium TaxID=2026780 RepID=A0A2A5DRT4_9BACT  ali  26  13................................................................RVHLITYGCQMNKSDSEDVINLLLDDGFEVTENIDDAGIVIFNTCTVRDKAEQRVISNIGHLAKRNKIIGMMGCVAQRDGERILKKVSFCVGTRQFPKIPSIIKEVRSTKRKVCNLE-----ENEEVIIEKNSIKREKPYQGWITVTRGCSKYCSYCIVPAVRGHEVSIKPNDIEDQVKRIVDDGVTEVTLLGQIVERYGKDLSTSLAELLTRL-DKINGLKRLRFITSYPKDFTEEL--LYAMKELPKVCEHLHMPIQHGNDEMLKQMNRGYTRQEYLELVKKAYEIMPNLNLLSDFICGFPGETEEQHLMSESVISEADFQSSYVFAYSPRPGTQSDKWDKIPEELKKERVRKLLKIQNEVSLKRNLIDTVDEVLVERYDEKKNNWLGRNRGNQIVVFHAEKELVGQYLNVKIREVTNLTLIGDLV....................................................................................... 446
198 0.000e+00UniRef50_A0A1E3YPI6 tRNA-2-methylthio-N(6)-dimethylallyladenosine synthase n=37 Tax=cellular organisms TaxID=131567 RepID=A0A1E3YPI6_9BACT  ali  26  1..........................................................................MNYHDSERLSGLLESEGYERIEDEGHADLVVINTCSVREKAEEKLYSRLGEVREAHPTIAVTGCVAQQEGDKLLKAIDVVVGTQSLKRLPALVDEARSRHERRVDINPYEDVS-----FPLGLVRHSDPVRAWVTIIEGCNEFCAFCVVPYTRGHERMRPAADILAEVRQAVDAGRSEIQLLGQIVNHYQDDPACDFAALLER-VAAIPGVVRIRFASPHPRHVTPRLI--AAIRDIPAVCRHLHLPVQSGSTRMLQAMRRRHTREFYLDLIDRLRAEIPAIALSTDLIVGFPGETAQDFEDTLSLVDAADYHYAFSFKYSPRPSTLASKPDDVPEAEKTRRIVALQALQRDKQFARRTVGTVETVLVDSVSRRRATLAGRTEGSVVVNFAGPSEWIGRLLRVQITEAAPNSLRGQALD...................................................................................... 427
199 0.000e+00UniRef50_A0A1Q2HSS5 tRNA-2-methylthio-N(6)-dimethylallyladenosine synthase n=4 Tax=unclassified Phycisphaerae TaxID=1546154 RepID=A0A1Q2HSS5_9BACT :_  ali  25  1............................................................MNKNKLYIVSFGCQMNKLDTSLVEAEFTKEGFELTNNQNEADVILMNTCSVREHAEQRVLSRLGHLKRSGRKVVVGGCMAQRLGSSLLEEVDIVCGPGQIPELKAMVLKKLEDRKGGILNVSAHIRKSDEFELENSPNLTEHKNKAFVRVMRGCNNFCSYCIVPFVRGPEISRSPEKILQQIRRLADSGVRQITLLGQTVNSYRHKENGRLHNLLEK-TAEIDGIEWISFVTNYPMDYTAPL--FKAVADIDKVCPYLHLPAQSGSERILKAMNRKYSAEDYIRLIDEAREYVPDIAVAGDFIVGFPGETDEDFRDTEKLVERIRYKNIFAFKYSPRPGTSTEKRDNVPDKVKRERNIKLLALQESISSNKKFEGEVFRVFVEGKSSKGHQLIGRTAGDYIVVFNGPEELAGKFADVSIEKTSALTLFGTLLERRS................................................................................... 467
200 0.000e+00UniRef50_A0A2K9P2C6 tRNA (N6-isopentenyladenosine(37)-C2)-methylthiotransferase MiaB n=2 Tax=Monoglobus pectinilyticus TaxID=1981510 RepID=A0A2K9P2C6  ali  25  1............................................................MTKITVKFITLGCKTNIYESESMAELFRESGYEITDDNAPADVCVVNTCTVTGMGARKSRQQIRRAKRQNPNIAVTGCFSQTSPEEVREGADIIIGNKGRSKIVELVKAAEQGKKADIV----DNILTEHEYEELPVTHTQSRVRANIKIEDGCNNFCTYCIIPYARGPVRSRNIEKIVSEAETLAENGYKEVVLTGIHIGSYGKDLNNGLLIDVIESVNNVKGIERIRLGSIEPVIITQDF--VSRAKNLTKLCPQFHLSLQSGSNATLKRMNRHYTSEEFKKAVELLRENIPDTSITTDLMVGFSGETQDEFLESYEFCKSIGFMQMHIFKYSIREGTAAEKLDRIRGEIKEDRSRQMIELAEKEKFYRKYEGKIVSILAEQE-KEAGIYHGTTPNHMDVLFNCPSHNIGETLKAKLTEYKNGFIHGELL....................................................................................... 434
201 0.000e+00UniRef50_A0A1G5IS75 Ribosomal protein S12 methylthiotransferase RimO n=2 Tax=unclassified Lachnospiraceae TaxID=186928 RepID=A0A1G5IS75_9FIRM  ali  27  3...............................................................KSVIFISLGCDKNLVDSEIMLGELAQGGYSFTDDIDEAECAVINTCCFIGDAKEESIDTILEIAERKRFIVVTGCLSQRYISEIIPEVDALIGTASIGKIRECLDDLYAGAGMSVFCDPLDT----PPYSSRHRAHSSGLFYAYLKIAEGCDKHCTYCIIPSLRGPYRSYPMEHLVEEAERLAEAGVNELILVAQETTLYGTDLYGHLPELIRRL-SGIDGIHWIRIQYCYPEEIDDALIE--EMASNPKLCHYLDMPVQHASDAVLKRMGRRTSEEELRTIVGRLRERIPDIVLRTTLISGFPGETEEDHQELYRFVNEIEFDRLGVFTYSQEEGTPAGEMDQIPEEIKNLRRDELMELQQAICFADRRIGEIMEVVIEGCIPEEDVYVGRTEVDGRVFIPADRERMGEYAHVRITEARDYDLIGEFIDEPA................................................................................... 447
202 0.000e+00UniRef50_A0A1X1Q925 Ribosomal protein S12 methylthiotransferase RimO n=1 Tax=Anaerovibrio sp. JC8 TaxID=1240085 RepID=A0A1X1Q925_9FIRM  ali  27  1...............................................................MKAGFVSLGCSKNLVDTEVMLGLIKERNIELVNAPSDADILIVNTCAFIQSAKEESINTILNMAEYKRSLIIAGCLGQRYGQELLPEADGIIGTEAWDRITEVIDETLKGNRVVVKGEDEIIYDASVPRIPTTP-----KYTAYVKIAEGCNNRCAFCAIPLIRGKFRSRKLEDIVAEVKQLAENGVKEIVLIAQDTTNYGHDIYPRLAQLLKELC-QVEGIKWIRTLYSYPRFFNDELIDL--MAQEEKIVKYVDIPLQHASNEVLRRMRRPDTKEQITELLQKLRDRVPGVVIRSTFIVGFPGETDQQFQELKAFVEEQRFDHAGFFTYSKEEDTPAADMDQVPEEVMQDRYHEIKAVQSLISQEINLTGQVLEVIVEGHT-DEGMPYGRSDVDDLVYIEDDESQVGDVVKVRILQGFTEDLVGELVD...................................................................................... 442
203 0.000e+00UniRef50_A0A1C5YPL6 (Dimethylallyl)adenosine tRNA methylthiotransferase MiaB n=28 Tax=Firmicutes TaxID=1239 RepID=A0A1C5YPL6_9FIRM  ali  25  1...............................................................MNAHFISFGCKVNQYETESIKEIFISENYDISDTPADADVIIINSCTVTSSGDSKTIHTLKRIRKLNPDIVLTGCLPQASPDDKLPEADIVTGTRNRNKIPELVKRHIEKKEQIIHITSYEKCDDFENIKCS---EFKNKTRAFVKIQDGCNQFCSYCIIPYARGRCRSKPIETLKEEIKELAANGHKEIVLVGINLAFYGKEFDLCLADAV-EVCCKIKGVERVRLGSLEPEIITDS--DLERLSKLPQFCPHFHLSLQSGCDKTLKNMNRHYNCEQYYDLVCRIRKYFSNASFTTDIMVGFPDETDKDFEESLKFAEKIGFSKIHVFPYSVRPGTKAAEMKQVSENIKAQRAKIMKSAGSQLTFMKTQVGMTVPVLFERESS-PEFHQGFTPNYTLIKIPSEKSLRRMIFYVKIVESKKDCCIGELV....................................................................................... 432
204 0.000e+00UniRef50_G4EMX2 tRNA-2-methylthio-N(6)-dimethylallyladenosine synthase n=83 Tax=Terrabacteria group TaxID=1783272 RepID=G4EMX2_MYCIO  ali  25  3........................KPKRDTSKYFLPNARKRIEESKIVRDSFNIPENLVNGVGKKFHIKTFGCQSNVRDSETLMGILEMIGYTHTDSINDADLVLLNTCAVREHAEQKVFADIGKIKKTNPIFGMCGCMAQEESNKILKNIDFIFGTHNIHRVLNILEQVIFEKNLIIEVWSKE-----GDIIENLPSFRNSNIKAFVNVMYGCDKFCTYCIVPFTRGKIRSRSKEDILDEVKSLIKEGYKEVTLIGQNVNSYGIDFKNDFHDLLKDVAE--TGIKRLRFTTSNPWNFTKEIVDV--MKSHPNIMPHIHLPIQSGDELILKRMNRPMRIEDYIGLVNYIKESIPNCSITTDIIVGFPNESREQFEKTLSLYNTIQFDNAFTFVYSKRDGTVAA---QLPDSIXXXXXXXXXXXXXXXXNNMKFVGSTLDVLVEGPSKKDETLSGYSPQWKIVNFKGEAN-PGDIVKVKITSASRFTLNGEMVN...................................................................................... 483
205 0.000e+00UniRef50_R5EE40 tRNA-2-methylthio-N(6)-dimethylallyladenosine synthase n=9 Tax=Succinivibrionaceae TaxID=83763 RepID=R5EE40_9GAMM  ali  29  9........................................................DNFKMQLGSFYVEVWGCQMNVYDGGRIKDLLTAAGFAQVNAPKDADIVVLVTCAVRAKAEDKVFNQIASWRNEDTIIALGGCVGSELAEQILESVNIIFGPRTIHRLPQMIGQFTATGKPVVDVT-ADAIDKFDYMPESGPV----GPSAFVTIMEGCSNKCTYCIVPYTRGEEQSRPVQDILDECVNHIANGVLEIHLLGQNVNSY-HGLNPNFSSLLYEI-AAIPGVERIRFTTSNPMDFTDDIIK--AVHDLEVISDSIHVPIQSGSDRILQAMHRRYTAKQYINLVKKLREARPTVHISSDFIVGFPGETDEDFEETMKVVNEVKFDQSFSFVYSIRPGTPAAKLEDVPKEVKMQRLYRLQNRLEELASEQSFLGTTQKCLVEGTSRKDEELKSRSSSGRIVVFKGPLSLVGKMVDVKITSVIAHTLKGELV....................................................................................... 452
206 0.000e+00UniRef50_A0A146KQN1 CDK5RAP1-like protein n=3 Tax=Lygus hesperus TaxID=30085 RepID=A0A146KQN1_LYGHE  ali  23  40.................SLMNFGPLKPGPSLKDFLSSQKPQEAFDVDPTVPPYIHLNEIHGQSRYVFFEVYGCQMNVNDTEIVWSILKTSGYLKTDNIRQADVVLLMTCSIRDNAEKKIWHRLNELKALRRKVGILGCMAERLKQKLIEEIDVVAGPDSYKDLPRLLSVSSSNQAAINVMLSLDE----TYADITPVRLNENAVSAFVSIMRGCNNMCTYCIVPFTRGRERSRPADSILREIEVLSKNGVKEVTLLGQNVNSYRDKGGMRFAELLDK-VASVDPEMRIRYTSPHPKDFPDEVLQV--IADRKNVCASMHLPAQSGNSQVLERMRRGYTREAYLELAHHIKDILPGVALSSDFICGFCGETDLEFSDTLTLFDEVGYNVAYLFAYSMREKTTAHRRDDVPEEVKKERLIEMSKTFRRTALNQSFVGKDEIILVEGTSKRSEFLAGRNDGNIKVIIPSRPIQVGDYVKVRITEANSQVLKGNPIYHCKLSS................................................................................ 564
207 0.000e+00UniRef50_K1ZI42 Uncharacterized protein n=1 Tax=groundwater metagenome TaxID=717931 RepID=K1ZI42_9ZZZZ  ali  28  1...............................................................MKYYIKTYGCQMNKSDSERVAQVLEQCGFKPAGSEAESDLVVLNTCTVRQSAENRAVGKVKSL--SNKKIILTGCLAQKDFYKKFPEIDL---------LLDIKDLSKLPKKLKSSKQELNDGEKRQKNYLSITPKYESSFSAYIPISTGCDNYCAYCVVPYVRGPETSRKAEEILAEAKDLIKKDYKEITLVGQNVNSY-KDGKTDFTKLLKKI-ARYEGNFRIFFITSHPKDFDEKLIDVVK--KHPKLCRYFHIPFQSGSNKILEKMNRKYSREDYLQIISQIRKEIPDAAISTDVIVGFPEETNKEFGETANLMREVKFDMAYIAQYSPRPQTEAFKLKDVPKTEKKRREAFLTNIKTSLKKNKKLIGKTVRVLVNNIKPEKNKLSGKTDNYKTVVFGSDKNLIGEFVNVKIIDAMAWGVRG.......................................................................................... 423
208 0.000e+00UniRef50_A1ATL9 Ribosomal protein S12 methylthiotransferase RimO n=10 Tax=Bacteria TaxID=2 RepID=RIMO_PELPD  ali  29  5.............................................................EKQKVSMVSLGCSKNLVDAEVMLGLLARQEYEITTDEREADIIIVNTCSFIKEAKQESIDAILDLAERKNDLIVSGCLPQRYQEELLPEVDIFIGTGDYPRIAEILAEKSGTDEQLCYIGDPDFVFDETLPRLNSSPA----WFSYLKIGEGCSNRCSYCIIPKLRGPYRSRPLEALVAEAEQLASRGVKELNIISQDITRYGSDMGTTLETLLRRLV-QIDGIQWIRLLYAYPDGISDALIAL--IRDEPKICKYLDIPLQHISDPVLKLMRRRSNEQQIRELLAKLRREIPTLALRTSLIVGFPGETMEDFTSLMQFVEQARFDRLGVFCYSREEGTPAATMDQVSERVKRERHRKLMRIQARLSFKRNRIGTTEQVIVEGYSEETELLKGRSDIDGQVYITAGTADVGDIVALRITDSSDYDLIGEI........................................................................................ 446
209 0.000e+00UniRef50_UPI00038CA197 30S ribosomal protein S12 methylthiotransferase RimO n=3 Tax=Clostridioides difficile TaxID=1496 RepID=UPI00038CA197  ali  26  1..............................................................MLKIALESLGCSKNLVDAEIMMGILNNKGYKLIGDFEEADVIIVNTCGFIESAKQESIDTIINFAELKKTLIVTGCLAQRYSEELIPEIDAIVGTGSYQNIDKILKELSEMHQIVSLNDIEFVFNEDLPRYISTPSYM-----AYLKIGEGCSNNCTYCIIPKLRGKYRSRKFEDIIKEAKKLAESGVKELVVIAQDTTKYGFDLGKERLSELLEELAKIDGFKWIRVMYSYPESITEELIQVIK--KYDNICSYFDMPIQHASNNILKLMNRKTTKEDILNKINLIRSNIPDAILRTTIIVGFPGETEDDFKQLVDFVEEVKFDRLGAFAYSREEDTPADRLPHIDEEVKIQRRDTLMMIQQKISLNDKKIGKTYEVLIEEQI-EDNVYTGRTEIDSIVYVKSVDNLVGEFVSVQINDAMEYDLMGDVL....................................................................................... 440
210 0.000e+00UniRef50_A0A2G6FZA2 tRNA-2-methylthio-N(6)-dimethylallyladenosine synthase n=2 Tax=unclassified Bacteria (miscellaneous) TaxID=49928 RepID=A0A2G6FZA2  ali  23  3.....................PAPANCAVRSPASSAKPKESPPLADFHSELKPLPAPSERGDGCKVYIETYGCQMNVYDTQAIGGLLERDGFVSARDFFEADVVLLNTCSVRELAEHKIISRVGEIRRQRRTIGICGCMAERLGPELRKGVDLVVGVDSYDKLPGMLLELETRNGTRR--HRVATGHRSDAHYVAPPESYPVNNSHLVTIHKGCDYKCTYCIVPYTRGPQSEKSPDDIMAEIRMLVDAGGEEVTLLGQNVTAYNWRGGLDFAALLEQ-VATIEGLRRIRFLTGHPRDMHPHTMD--AIGALEKVCPWLHLPIQAGSNRILKRMKRLYKREEYLQMVRYARRVIPDVTFSTDIIVGFPGETEEDFQATLEVIREVKYDQIFSFKYSERPGVPAAKLDDVPLEVKKRRLAEVIALQEEIGMARELVGKTFRGIVEGPARQDGFWRVRTANNRKFVVDGSDHKIGDAVSSVITGCRNTTLTG.......................................................................................... 484
211 0.000e+00UniRef50_A6DMH4 tRNA-2-methylthio-N(6)-dimethylallyladenosine synthase n=4 Tax=Lentisphaerae TaxID=256845 RepID=A6DMH4_9BACT  ali  25  1............................................................MSKEKVLIKTYGCQMNDRDSEAVEMDLLKSGYEITTEEKDADVIILNTCSVRDQAERKALGKVGKLRRKNPKVGVIGCMAQSRADDIVEHVNFVAGTDQLHKIPELIEKSKDTEDALIETGLSRDIMERLDNHP------EGQMNASVAIMRGCNEYCTYCIVPFTRGQEKSRTIASIIAEVKALSEKGVREIMYLGQNITAYGRDRTFNFAALLRE-TAKIEGIKRIRFTSPHARYFNDDLIDT--IAAEPKICRAIHFPLQSGSNRLLKVMRRRHTAEEFLSWINKMKERIDGITFTTDLIVGFPGETEEDFKATRDMCNEIDFDQQFIFRYSTRKNTPAAQMPQLDEETKIERNQILLDLEERLTKNEQRVGTIEEIMVEGVSKRNDKWTGRTTNYKIVIFPQEDVKVGDLINIKIERATQHALYGSYVEHTS................................................................................... 450
212 0.000e+00UniRef50_A0A1V6E0S8 (Dimethylallyl)adenosine tRNA methylthiotransferase MiaB n=3 Tax=unclassified Spirochaetes TaxID=1130380 RepID=A0A1V6E0S8_9SPIR :  ali  25  1..............................................................MKNYHIETYGCEMNKAESAAMEVTLKEHGWGRSG-EEEAQLILLNTCTVRATAENRVWNRIHQLKEHNFVLAVVGCMAEQYKRKKAPGVDYVFGTFQKQSFSLMLDTIANGQK-------IEALEESPRYVFSEFHHEGGAFRSFIPIMHGCNNFCTYCIVPYVRGREISRSPVDILQEIDKLEDLGIREITLLGQNVNSYSWEKDGTFLDLLKMICADAPGIGWIRFLTSHPKDLSKELIAV--MAEDPFFCHHLHLPLQSGSNTILSAMNRKYTREYYLSVIDALKKAIPDLTLSTDIMVGFPGETEEDLEQTLRLMRSVHFSYAFMYHFNEREGTFAAGLPKVPEKIKKDRLARVIALQKEISLMRERIGQVDKVLIENRSKQSSRLLARTSRDEMVVFPGSPTRIGQFAQVRFISVAGNTLRGEEV....................................................................................... 455
213 0.000e+00UniRef50_C9RLB8 tRNA-2-methylthio-N(6)-dimethylallyladenosine synthase n=9 Tax=Fibrobacter TaxID=832 RepID=C9RLB8_FIBSS  ali  26  1..............................................................MKKYHLATYGCQMNEYDSAMIAQELDMCGCVETNNQEDADIIIVNTCSVREKAEETAISKLKYLRKKNPKVVVCGCMAKNRGPELLKRVNYIVGPDQYRKIPELLFG-DAQSPLHKTHHKMFIDEDRDENYLGEYAKLQNDVSAFVAIQRGCNKRCSYCIVPYLRGPEKYRDMDDVLTEVKRAADKGITEVMLLGQTVNAY-KTPNADFTTLLTK-VSEIGGIKRIRFTSPHPRHYTNELIDVL--LNNPKVCHYAHIPLQSGSDAILKKMRRQHNMEQYMTVIEQLRSKDPYYAISTDVICGFVGETDEDFEQTIKAFEACQFDTAYMFIYSPRKGTESFEAEILTPEEKSARHSRLVELQNAITLKRNMIGRTEEILVEGSTRDKTELVGKTDNFKKVIFKPEEGRIGDYVKVKIDDIRGWTLRGTLV....................................................................................... 440
214 0.000e+00UniRef50_A0A1Y4CUQ1 tRNA-2-methylthio-N(6)-dimethylallyladenosine synthase n=2 Tax=Desulfovibrionaceae TaxID=194924 RepID=A0A1Y4CUQ1_9DELT  ali  27  1...............................................................MNYHIVTFGCQMNVADSEWIARSLQDMGGVET-NVREADVILVNTCSVREKPEHKLRTALGRIARKNVLVVVTGCVAQQLKETIFPQVRLVAGTDTVAAIPANIAWLLEHPERHMCTAGFEKDMAERPA----PRTGHTGPTALVNIMQGCDNFCTYCIVPFTRGRQKSRASKAILDECKALLDQGVREITLLGQNVNAYGKDKGTSFAELLH-MVAELDPDLRLRYVTPHPKDMGPE--DVAAFADIPNLCPRLHLPMQAGADRVLKRMNRRYDSAGYLALVESLKRARPDIALSTDIIVGFPGETEEEFLATMDMVKRCNFMSSFSFCYSDRPGTRASTFDKIPQDIQLDRLQRLQALQEDLSQANNRQGCETTVLVEDTSPRQNEWQGRDPYGALVHVAKDPNPVGKYVRVRVTHAFKHSLQGMPV....................................................................................... 442
215 0.000e+00UniRef50_Q18BJ2 Ribosomal protein S12 methylthiotransferase RimO n=54 Tax=Clostridia TaxID=186801 RepID=RIMO_PEPD6  ali  26  1..............................................................MLKIALESLGCSKNLVDAEIMMGILNNKGYKLIGDFEEADVIIVNTCGFIESAKQESIDTIINFAELKKTLIVTGCLAQRYSEELIPEIDAIVGTGSYQNIDKILKELSEIHQIVSLNDIEFVFNEDLPRYISTPSYM-----AYLKIGEGCSNNCTYCIIPKLRGKYRSRKFEDIIKEAKKLAESGVKELVVIAQDTTKYGFDLGKERLSELLEELAKIDGFKWIRVMYSYPESITEELIQVIK--KYDNICSYFDMPIQHASNNILKLMNRKTTKEDILNKINLIRSNIPDAILRTTIIVGFPGETEDDFKQLVDFVEEVKFDRLGAFAYSREEDTPADRLPHIDEEVKIQRRDTLMMIQQKISLNDKKIGKTYEVLIEEQI-EDNVYTGRTEIDSIVYVKSVDNLVGEFVSVQINDAMEYDLMGDVL....................................................................................... 440
216 0.000e+00UniRef50_A0A1V6BD95 Threonylcarbamoyladenosine tRNA methylthiotransferase MtaB n=1 Tax=Tenericutes bacterium ADurb.Bin140 TaxID=1852919 RepID=A0A1V6B  ali  25  12................................................................KFKIHTLGCKVNLYESEAVSSQLVEAGWLWTDNDEEADVQIINTCTVTRTSDAKSRKLIRSLVRKNPILVVMGCYSQIAPDEAIEGVDIVLGSSGKSKIIDYVTDFRKTGIKRQYLKSAEEYQTFEELKMG---RLQKHTRGFIKIQDGCENFCSYCLIPYARGPIRSRDKQSVLAEIKNLVDSGVKEIILSGINTGTYGKDLGVTLAELVDEILSTYPQLDRLRLSSIELKEVTDELLVLFAKYP-DRMAKHLHIPLQAGSNTVLQRMNRRYTTEEYENRINEIRSLVPDIAITTDCLAGFVGETEAEHQEALDFINRIGFAQMHIFPYSRRKGTKADSLNHLPPETIEARTRTLLKLSSKQEYQERFIGSIQTVLFE--NQKQGLWRGYTSNYIEVFVRDENDLNNLLVPVKLEKIVNGQVIGQV........................................................................................ 440
217 0.000e+00UniRef50_F4LPX9 tRNA-2-methylthio-N(6)-dimethylallyladenosine synthase n=16 Tax=Treponema TaxID=157 RepID=F4LPX9_TREBD  ali  23  1...............................................................MTYFFETYGCQMNKAESASLEQLLIARGWTASDTPESADMAIINTCSVRATAENRIFGRLGKAVRSGSKLVVTGCMAERLLDSLYPVIDYVVGNFQKQHFQDIIDAVEQQRAPFVV-------DEEPVYSFAPVSWEPGAFTAFVPIMHGCNNFCTYCIVPYVRGREVSRSPADILSELDQLSAHNVREITLLGQNVNSYRWDCNVDFPALVQLIADHLSPIGWVRFMSSHPKDLSDRLIDV--IAREPVLCRHIHLPVQHGSSDVLRRMNRRYTREQYLDLVSRIRTKLPDASLTTDILIGFPGENDADFEQTVSLMESVRYQAAYMYYYNPREGTPAAEYDQIPLETKKSRLKRIIDMQLEITRAEKRLGSTVKVLAESVSRDNGELLGKTEQDERVVFAAPRSCIGTFVQVLLVELTGNTIRGIV........................................................................................ 469
218 0.000e+00UniRef50_A0A0J1I4F8 Threonylcarbamoyladenosine tRNA methylthiotransferase MtaB n=24 Tax=Clostridiales TaxID=186802 RepID=A0A0J1I4F8_9FIRM  ali  29  26.................................................................VRLVTLGCKVNQTESEAVAQVFRAAGYRVLREDGPADVVVINTCTVTDSGDSKSRQMIRRMIKAHPFVIVMGCYAQTSPGEKIEGVDLVVGTQDRRRIPELMETVRAARGPRSAVHDIGSAKDFEELPLL---EGESRTRATLKIEDGCNQFCTYCIIPYARGPVRSRRPENVLAEARKLVAAGYKEIVLTGIHTGAYGRDLAEDLARLVGEL-GEIRELKRLRLSSIEPVEFTPGLIKT--IRESKVVCRHLHIPLQNGSAAVLRRMHRPYTPTDYKRLLERLREVMPDLAITTDVIAGFPGESEEEWQETLTFVASCDFAGVHVFPYSRREGTPAARYPQVSHRVKQRRTREMLALARRERYKRAFIGKTVEVLLETVD-EDGSAFGHSGNYLGVRVPGGDSRRGMLVEVTLDE.................................................................................................. 448
219 0.000e+00UniRef50_B3LVY6 Uncharacterized protein n=82 Tax=Bilateria TaxID=33213 RepID=B3LVY6_DROAN  ali  24  47...............FMQRIQQGPGLQDFFAAKPVSRFKPEEGELVDTSVPYLKPID-FHGQGRKVHFEVFGCQMNTNDTEVVWSVLRENGYARCQDPEDADIIMLVTCAVRDGAEQRIWNRLKHLRAMKSKLSVLGCMAERLKEKLLEKVDVIAGPDSYKDLPRLLAISRHGNSAINVLLSLDE----TYADVMPVRLNSESPTAYVSIMRGCDNMCTYCIVPFTRGRERSRPLESILTEVRALQEQGVKEVTLLGQNVNSYRKSGGITFSRLLRSVAEAVPE-MRIRFTSPHPKDFSDDVLRV--IRDYPNVCKQLHLPAQSGNTKVLERMRRGYSREAYLHLVDRIRLFLPNVGLSSDFICGFCGETEEEFQDTVSLIQQVQYNVAYLFAYSMREKTTAHRKDDVPLLVKNERLKRMVEVFRATELHKKMEGHEQLILIEGKSKRSSHWFGRNDANIKVIVPAGKPLIGDFVVAHIEESNSQVLKGKPLAITSI.................................................................................. 569
220 0.000e+00UniRef50_A4SCW6 tRNA-2-methylthio-N(6)-dimethylallyladenosine synthase n=14 Tax=Chlorobiaceae TaxID=191412 RepID=MIAB_CHLPM  ali  25  5.............................................................KGRSFYIHTFGCQMNQADSAIITAILMDGGFRVAGSQEDADIVILNTCAVRENAVERILQFLRGAKRRKKLVGVAGCVPQHLKREMFPVIDFLAGPDTYRNLPALIGDAEEGKRPAAL------EFRIEETYAGIDPLREVGVGAFVPVTRGCNNMCAFCVVPFTRGRERSQPFSAVMDEVRRVVEKGYGEITLLGQNVNSYADEEGRDFASLLRAVSREAPG-CRIRFTTSHPKDISPDLVD--AIADSPNICNHVHLPVQSGSSRMLHRMNRGHGIDEYLETVALLRRRIPGVSLTTDLIAGFCGEEDEDHEATLALLREVRYDNAFMFYYSPRFGTAAWKADTVPLAVKKQRLQEIIDLQLSISAEQEAVGSVVDVLAESESRRSEQLMGRTGTNRAVVFDRGGARPGDRVSVLISKASSATLTGV......................................................................................... 438
221 0.000e+00UniRef50_A0A226BW34 tRNA (N(6)-L-threonylcarbamoyladenosine(37)-C(2))-methylthiotransferase MtaB n=1 Tax=Natranaerobius trueperi TaxID=759412 RepID=A  ali  28  1............................................................MTALKVTFVTLGCKVNQYDTEAIKDQFFKKGFEIVTDQNSADVFVINTCTVTNLADKKSRQYIRRVKRNNPESVVAGCYVQANPEKEIQDIDIVLGTDNRKSLVKMVEDVLANKTGKKLELLAPTRKREGFEELSITSFKEKRSRHFLKVQEGCDRFCSYCIVPYARGELRSRAPKEVIKEVERAIEAGFKEIVLTGINLGAYGRETYPDLSGLVETII-GIDKEFRIRLSSCEPQEITPELIDL--VTESSKVCSHLHIPLQNGDDEILSKMNRSYTTDDYYNLITDIKKKNPLIALSTDVMVGFPGEKEYHFENTKDFLDKVGFSSLHVFQYSPRKYTKAAKLEQVQNKVKKQRSDSLIKISKQLSYQRNFVGEVVDVLVERVERD--YSEGLSGNYLNVKFPTTNNIEREFIKVLIDCVDDDYVYG.......................................................................................... 435
222 0.000e+00UniRef50_A0A2M7RNS2 tRNA (N6-isopentenyl adenosine(37)-C2)-methylthiotransferase MiaB n=1 Tax=bacterium (Candidatus Howlettbacteria) CG_4_10_14_0_8_u  ali  27  1............................................................MNKKKYYLLPLGCAQNISDAERVSTVLEENRFVITSDESEADLICVIACSVRQSAIDRIYGRIGKYKKKSLKI-LSGCVLPKDRKKMEEIFDVVFGIESLEELPSLIAGIQSSNGKRLDPRCGEDDKKNYFNYLSIQPKHGNTFQALVPISNGCNNFCSYCAVPYTRGREVSRSFDEIVNEVKDLVKNGYKEITLLGQNVNSYGNDIGKSFLDLLEEL-DKIPGKFWIRFISNHPKDFPNELIE--NLPKLEKVTPYIHLPLQSGSTKILKGMNRKYTRKDYLTLVEKIRKNIPDVAIGTDTIVGFPGETEKDFEKSIEVFEKSKFDMAYIAQYSPRQGTVSARMDDISKEIKKQRDKKLNEVLKKTALNKKYVGKEVEVLVEKEYK--GFLWGRTGTYKLVKIDKGPEIIGRFIKIKIKSATPWTLSGSLLTANS................................................................................... 465
223 0.000e+00UniRef50_R7QB29 Uncharacterized protein n=3 Tax=Rhodymeniophycidae TaxID=2045261 RepID=R7QB29_CHOCR  ali  26  183..........................RHVIRTKHERTPSRRKADK---KDFKNTSAEALVPVAKTYAMQTLGCQMNRSDSERMAGELARIGYKEIDDPFKASVLVLNTCNIRDHAEKKVYSYIGRHAARKRKLAVAGCVAQQEGERRIPELDLVFGPQYANRLGDLLKDVETNQCQVAATDPIHIQEDISK------PKRESTVTAWVNVMYGCGENCTFCTVGVVRSVEQSRTISSIRAEMEDIARSGIREVVLLGQNIDAYGRDMYPTFAELLRN-VHDVDGIDRIRFTTSHPRYISRNL--VTTCAELPNVMPYFHIPPQSGNDDVLKEMKRGYTVKAFKAVVNRIREATPDAAICGDMIVGFPGETEEQFQDSLKLMEDVKFDVMNTAAYSPRPNTPAAEYNQISDAMKADRLARMNELVTRHALERRYVGRVEHVLVEQESKTPGEVVGRTPTNRTVRFSGSRELRGKIVPVKIVEALPFTLLGEIAGSP.................................................................................... 655
224 0.000e+00UniRef50_F9MS36 MiaB-like protein n=4 Tax=Tissierellia TaxID=1737404 RepID=F9MS36_9FIRM  ali  24  1..........................................................................MNAYESEAMLELFEKAGYQVHNNPEESDIYIINTCTVTNLSDRKSRQFIRRSKRANPQAVVAGCYAQTSPDEAMEDVDLVLGTKDRNKIVDYIEEILIKRQKIVRVTDSSMHREFESFFIE---NQEDHTRAYVKIQDGCNQFCSYCIIPYARGPIRSRDPQETLEEIQSLVDRGYQEVILTGIHVASYGVDLGERLIDLIERI-ARIPGLKRIRLSSVDPRLVTEDFIQRLQATG--KVCDHFHLSMQHASNKILKAMNRKYSQEDFFEKTEIIRKYMPYAGLTTDCIVGFPGEEEEDFEILKDFVKKVGFSRIHVFPYSPREGTKAASMKQLDGKIKQARSKALLEVGEELSFIDQNRNRDLEVLFEKEER--GLYHGYTTNYIRVVASSQENLTNKICHGTIKD.................................................................................................. 407
225 0.000e+00UniRef50_A0A0T6AEH5 tRNA 2-methylthioadenosine synthase-like protein n=50 Tax=Candidatus Rokubacteria TaxID=1752708 RepID=A0A0T6AEH5_9BACT  ali  27  31........................................................AKPPSEGKTIAFATVGCKLNQAETQEMEELLASRGYRPVPFDEPAQVYVINTCTVTGRADFSDRQMIRRAIARNPQVVVAGCYAQTDPAAIISGVDLIVGNQEKYELAGLLDSLTKRATPLVRVGDI---RKAVNVPVAPVTHFRGRSRAFVKIQDGCQHRCAFCIVPLARGGSRSQEPKVVVDQVHRLVEGGYGEVVLTGVDMGHYGWDLQTTLATLLRQILD-VPGLGRLRLSSILPPYFTDELIEV--IAGSPRIAPHLHIPLQSGSNRVLGLMRRPYNTRIYGSLVERLSRAIPDLGLGADVIVGFPGETDADFEATRALIGALPVSYLHVFSYSDRQGTEAARLPHLPARTITERSKVLRRLGREKSFRRRQVGRTWEVLVEERDKSTGRLSSLTGNYVEILFDGTDEWMGRFLNVSVTDATSDRTLGKVAEPSSE.................................................................................. 475
226 0.000e+00UniRef50_A0A2M7QAM2 tRNA-2-methylthio-N(6)-dimethylallyladenosine synthase n=23 Tax=Bacteria TaxID=2 RepID=A0A2M7QAM2_9BACT  ali  26  1............................................................MQQAKYHIVTLGCQMNKSDSERLASLLDSLGLQEVDRLKEADLVILNSCSVRQTAEDRVFGKVRELKRTNPRVGVTGCMAGRDTDGRIPDVDLFFSTADMVHLPQWLAE---------RGLIEADVSERPEEYLKIAPRYSSPHQAFVSIQTGCNNFCTYCVVPYARGLEKNRPAADILAEVRALAAAGVSEVTLLGQTVNSYGNPYTDHFAALLWEI-NQFDGFGRIHYTAPHPNSMTEQVIDALA---LPKQANYLHLPVQSGSDEMLRKMNRKYGRADYLDVIRRIRERKPEICLGTDIIVGFCGETEEMFDETVSLFREVDFDIAYLAMYSPRTGTPAWRKDDVTRDEKKRRWRQLHDLMEETRRNQKYVGQSVPVLVE-ACRRDGVCSGNSWDMKAVRFPGSSDLIGRTVMVRIDTARDWVLNGQIV....................................................................................... 441
227 0.000e+00UniRef50_A0A1U7M7T6 Threonylcarbamoyladenosine tRNA methylthiotransferase MtaB n=3 Tax=Terrabacteria group TaxID=1783272 RepID=A0A1U7M7T6_TISCR  ali  24  1..............................................................MKKVAFHTLGCKVNQYETGAMEKLFEDRDYSIVSDTEVADIYIINTCTVTNLSDRKSRQFIRRVKKLNAIIAVVGCYAQVSPEEILPFVDVIMGTTERNRVVDLCEMAKQENKKFNIVKDISTNTEFEKLEIDNI---NSKTRAYIKIQDGCNQYCSYCIIPYARGPIRSRDLEDIIEEAKTLSEAGFKELVLTGIHVASYGKDLKDLALIDVIEKISQIDGIERIRLSSVEPNLIDKEFME--RIVKTKKVCDHFHLSLQSGSNTVLKRMNRKYTSEEFEEKTSLIRKFMPYAGLTTDIIVGFPEETEEEFNETLEFVKKIGFSKIHVFKYSPRKGTPAARSKQINGIIKNERSKSLIELGEKLTFNSKFIGQSLEVLFEESSQEN-ILEGYTTNYIRAKVHSDYDIIGDIKKINIVDTDGEILVG.......................................................................................... 428
228 0.000e+00UniRef50_A0A257VFV3 tRNA-2-methylthio-N(6)-dimethylallyladenosine synthase n=1 Tax=Solibacteres bacterium 12-62-4 TaxID=1970571 RepID=A0A257VFV3_9BAC  ali  25  3...............................................................RSFYIETFGCQMNVHDSEKVIGTLRERGYLQVPTAEEAGLVLYNTCSIRDKAEQKVFNKLQNAKKGNQVFGVLGCVAQQEGEKIFPHVSLVVGSASYTKFPELLVQIEQGGRRV-----TGLSLDTDEAFDTPYTRRDNPYRAFVTIIEGCDKACAYCVVPFTRGPERSRTAGSVIDEVRRLADLGYTEITLLGQNVNSYRDPKGWDFADCLEQ-VGLVNGIRRVRFTTSHPRDFTKSIVE--AIDATPSLCNHIHLPVQSGSNRILDGMQRLYTREQYLERIGWMKAAKRPMAITTDIIVGFPGETDQDIADTLALLDEVQYDAIFNFKYSPRPNTPALVLDQIAEEEKGRRHMQVQERQRQIQNNANYVGETYEVHVEFFNLATGQWVGKTTQHKTVNFPGGQALQGQYLDVLVTRSGPVSLVGEAVGEAA................................................................................... 443
229 0.000e+00UniRef50_Q0IC70 tRNA-2-methylthio-N(6)-dimethylallyladenosine synthase n=334 Tax=cellular organisms TaxID=131567 RepID=MIAB_SYNS3  ali  27  4..........................................SSPVSPSLAKTNPASSTLDEGQRYWITTFGCQMNKADSERMAGILETMGYQEANAELDADLVLYNTCTIRDNAEQKVRQAIRKRTNPNLTLVVAGCVAQQEGESLLPELDLVMGPQHANRLETLLTQVQAGQQVVAT-------EDHHILEDLTTARRDSSTCAWVNVIYGCNERCTYCVVPSVRGKEQSRLPESILLEMEGLAARGFKEITLLGQNIDAYGRDLPGTLTDLLHQ-VHDVEGIERLRFATSHPRYFTERLID--ACADLPKVCEHFHIPFQSGDNELLKAMARGYTVERYRRIIDRIRKRMPDAAISADVIVAFPGETDAQYRRTLALIEEIGFDQVNTAAYSPRPNTPAADWNQLSEEVKVARLQEINALVESTAKERNYAGRIEQVLAEGMNKDPSQLMGRTRTNRLTFFSAETHRAGDLVDVRIDQVRSFSLTGTPV....................................................................................... 471
230 0.000e+00UniRef50_UPI000A0053C5 tRNA (N6-isopentenyl adenosine(37)-C2)-methylthiotransferase MiaB n=1 Tax=Candidatus Azobacteroides pseudotrichonymphae TaxID=  ali  25  7................................................................KVILETYGCQMNISDSETIIAIIQTAGYRFTKNIMEASIILINTCSIRENAEKKIFSRLQYFQSFKKKIGLLGCMAQRMKETLIKEVDLVVGPGSYLMLPTLIELAINGEKTINTNLSYD---ELYRTIVSLKSQKTNIFR-FVPIMSGCNNFCSYCIVPYTRGKEKSRDLKNIINEIQILKKIGCKEITLLGQNVNSFNKKDSIYFHNLLELIALMVPDI-RIRFTTSHPKDMSDKTLEI--IAKYDNICKHIHLPVQSGSSKILRAMNRKYTREWYLQLISSIRNIIPEISISTDLLCGFPSETELDHQKTISLMREIKFDSAFTFKYSERPGTYAAKYDNIPEIIKIKRLNEIVDLQLRTSRNKEHIGKTTEILIEGFSKRSKELFGRTSQNKLVFFKKNDQQIGNKIMIKIEKASATALFGK......................................................................................... 439
231 0.000e+00UniRef50_A0A0F9LMV2 Uncharacterized protein n=1 Tax=marine sediment metagenome TaxID=412755 RepID=A0A0F9LMV2_9ZZZZ  ali  24  3.....................................................................TLGCKVNQYETELIREQLEKSGFNPVSFGEKAGLYIINTCSVTEKAAQKSIELIKKARNRSSLLVVTGCYAEAEKEKLFPWIDLVVGNKEKS----------------NIGNIINGNGKNHQEKQTYIGNFNAHNRAFVKVEDGCNQFCTYCIIPYVRGKERSRSLSEVLREMENLAEQGFKEIVLTGVNLGLYGTDLNPKLVNLLKKAECLKEKI-RIRLSSLEPHLLSVELIDF--MAQSSWICPHLHLPLQSGDAEILKRMGRRYTLEEYRRLLKKVREKIPSVAITSDVMVGFPGEEEPHFDNTYRFLEEMKFSRLHVFRFSPRKGTRAYSKPRIEEKVKKERSKLLRDLGNKLSFASQFLGKTLTVLAEQPDTESGLLFGYTENYIPLLFNGKEESKNKLIRIRLTETKEGKVLGKV........................................................................................ 415
232 0.000e+00UniRef50_A0A1V6GYB6 tRNA-2-methylthio-N(6)-dimethylallyladenosine synthase n=2 Tax=Bacteria TaxID=2 RepID=A0A1V6GYB6_9BACT  ali  27  1...............................................................MRFILHTYGCQMNVRDSEAVTALLEAAGHTPVQREDDADLVVVNSCSVRAKAEDKALGKLGLLCRPDRLVGLMGCMAQRLGADIFPGLDFAVGTRRAGAIPRLVARALAGETGLLETADPDEIPDVVDAHTD------SGHSAFVTILLGCNRRCAYCIVPDVRGSEYSRPAREILAEINALVRNGVREVTLLGQSVMNFGRGFTEPFSRLL-EAVAAVPGLTRLRFTSGHPSGVTGQLVRACSV--LPAVCHHLHLPVQSGSDRVLARMRRGYSRTDYLNAVRRLRAAMPDFALTTDVIVGFPGETADDFEATRALMNEADFDNAFIFKYSPRPGTPAAAWDDVPETEKMRRNQVLLEDQRGAAANSRLVGTVQDVLVEGPSLRNARWSGRSPGNKIVIFEPHPGLPGTLARVRITRAAPQTLYGDVV....................................................................................... 447
233 0.000e+00UniRef50_A0A1H3YW31 Threonylcarbamoyladenosine tRNA methylthiotransferase MtaB n=1 Tax=Desulfuromusa kysingii TaxID=37625 RepID=A0A1H3YW31_9DELT  ali  26  1..............................................................MKTVSIVTLGCKTNQFESAAMIEKLQQAGYRQVSFEAGADLVIVNTCTVTAATDAQSRKLIRRARRSNTRIVVTGCYAQIDPHSLMPGVSLVVGNNEKGQLLDYL--VANNDTGQIQVSDIRASSVIEPLVLT---GFEQRSRAFVQIQNGCDAFCSYCIIPYARGRSRSVPVAAVISQIERLCANGYPEIVLTGIHIGRYGQDFCTDLLTLLQKI-EKSDFSGRLRLGSIEPTELSEEL--SHYIAQADWICPHFHIPLQAGDDEILRRMNRHYTTTFFADLLDRLRQIKPDAAIGLDVITGFPGETDVQFQATCQLLRQLPFSHLHVFPYSKRAGTLAAEMDQVPGDVMKARAAQLRQIGREKNRNQQFVGSELEIVIEG-GEDDDLRKGLSRNYLPVWVPATSVEPGELLKVRVSGMHKDGLLG.......................................................................................... 428
234 0.000e+00UniRef50_A3PED9 tRNA-2-methylthio-N(6)-dimethylallyladenosine synthase n=78 Tax=cellular organisms TaxID=131567 RepID=MIAB_PROM0  ali  25  21.................................................................YWITTFGCQMNKADSERMAGTLEKMGYTRADNELNADLVLYNTCTIRDNAEQKVYSFLGRAKRKHKKLVVAGCLAQQEGESLLPELDLVMGPQHVNNLENLLGKVDLGNQVVAT-------EETFISEDITSARRESSICGWVNIIYGCNERCSYCVVPSVRGKEQSRYPNAIKSEIQKLADDNFKEITLLGQNIDAYGRDLENTLTDLLYYI-HDVKGIRRIRFATSHPRYFSKRLIQ--ACYELDKVCEHFHIPFQSGNDEILKQMSRGYSIKKYKNIIENIRSLMPDASITADAIVAFPGETEKQYQDTLKLISEIGFDQVNTAAYSARPNTPAAVWNQLSEEVKKARLQEINDLVEKTSRNQRYIDNIESVLIEGLNPKNSQIMGRTRTNRLTFVEIPKNILGDEINVRINEARPFSLTGEL........................................................................................ 462
235 0.000e+00UniRef50_A0A2D5EWU2 tRNA-2-methylthio-N(6)-dimethylallyladenosine synthase n=3 Tax=Proteobacteria TaxID=1224 RepID=A0A2D5EWU2_9DELT  ali  27  44............................PLRANAPPRGPIPGRIQAAVEVFRRRSGAKAAPVARRYIVQTFGCQMNVHDSRRIEEVLHGEGYAPTEDAALADLIVVNTCSVREKAEHKLMSLLGTLRPYKERIAVAGCVAQQEGERLLPLIDLVLGPDNIPELPRLLRELDGGAPPAVRT----EFDLADPQFLVARPRGGGEVTSFVTVMKGCDERCTFCIVPTTRGSERYRPADAIVGEVAEMAAGGVREVTLLGQTVNSW-FDSGSQFADLLRRIAREVPELARLRYTSPHPRHLTDALI--AAHAELPLLPRHVHLPVQSGSDRVLKRMSRRYTRRLYAERTAKLKEAAPGLTLSTDIIVGFPGETEEDFEETLSLVREVGFVSAFCFKYSPRPSTPALKLDDVPEAVKDERLQRLFEVVEGQQRLKSLVGTRQEVLVEGPNDASNRYSGRSGRHEIVHLEAPEDPTGQLVEVTIEKAFRHSLLGRMLPERPVRRPRKKLPLLGADA.................................................................... 551
236 0.000e+00UniRef50_A0A1X7C4Q9 tRNA-2-methylthio-N(6)-dimethylallyladenosine synthase n=3 Tax=Desulfovibrionales TaxID=213115 RepID=A0A1X7C4Q9_9DELT  ali  26  1...............................................................MKFNVLTFGCQMNVHDSDWLIRAMESRGWKAVD-ESEANIFIVNTCSVRDKPEQKVYNILRRLGHPGDFVAVGGCVAQQIGEEKFPYVRLVFGSDGIAKAPQYLEELAVDHEKRLVVNDFLAQYPEREEELLPPGIGTIPGQAFVNIMQGCDNFCAYCIVPYTRGRQKSRLSSAIIDECRALVKAGIREITLLGQNVNSFGLDKNGSFSQLLYKI-SEIEGMERIRFTTSHPKDIAPEVVK--AFGELPNLCPQLHLPVQSGSDNILKKMGRKYDRARYLGIVERLKEACPDIVLTTDIIVGFPGETDEDFEQTMDIMERVRYESSFSFKYSDRPGVAAVKMPKVSEEVAQKRLTHLQERQKQITREEELTGKDMVVLLERPSKRQESWRGKDSGGRVVFFEGSDELGGKLIKVKITQSKNHSLVGSKVGDP.................................................................................... 457
237 0.000e+00UniRef50_A0A1C6DLH3 (Dimethylallyl)adenosine tRNA methylthiotransferase MiaB n=2 Tax=Clostridiales TaxID=186802 RepID=A0A1C6DLH3_9CLOT  ali  27  3...............................................................KTMALATLGCKVNQYDTQAMRELLAQAGYREVPFEEKADVYVVNTCTVTATGDQKSRQMIGRAHHTNPEIVVAGCYAQRAAEEAIPGVGLVLGTQDRGKIAQLVEQAAAQKGGPRLAVDT-LEKKGLPYEGLRVTQSQAHTRANLKIQEGCRQFCTYCIIPYVRGPLRSRAVEDAAQEAERLVAAGHREIVLTGIHLTSYGLDGGEQLLELLDRL-EAIPGLARVRMGSVEPQLLHSRFIEGLRPF--KKLCPHWHVSLQSGSAGVLARMRRTYGPEEYLEALERLRAAFPGVAITTDVMCGFPGETEQEHRESLAFVERAAFSRIHVFTYSPRAGTQAAQMPQVPRAEKKRRTHEMLRLGERLSYMEGMLDTTQEVLFETPVEGADTSAGYTPSY--VHVRCTGIAPGELAKVKIISRQGEYLTGQVV....................................................................................... 440
238 0.000e+00UniRef50_A0A1V5FKL2 tRNA-2-methylthio-N(6)-dimethylallyladenosine synthase n=1 Tax=candidate division BRC1 bacterium ADurb.BinA292 TaxID=1852824 RepI  ali  25  2..............................................................TRTYHITTFGCQMNAYDSDVMEGIMTAKGWTRADREEEADVILYNTCVVRDHAEQRALARLDQLARLKRIIGVTGCMAQKEAEERLPHVDLVLGTRAIARLSPLLDRVIATGTPQACTEILDDG-----YPADVVPVRQRPLKALVNIIFGCNKNCSYCIVPRTRGREVSRPWRDIVEEARRLRAHQYREITLVGQNVNSYRQEGTRSFGNLLRRVGEAAGGADWIRYITSHPRDCNAAHIR--AVAETPNVCENFHLPVQAGANRVLRRMRRSYTRERYLELIDEVRAAVPDATLTTDIIVGFPGETPDEFDQTLDLVRRVRFDSAYMYMYSTRPGTPAAEKDHIPLAEKKARLAALIALQEQISLELNRIGRRFAVLIEDVAPRPGDLLARTRGDKMVILPGPREWVGRFAEVEVHDANGHTLF........................................................................................... 439
239 0.000e+00UniRef50_A0A0S7WS69 tRNA-2-methylthio-N(6)-dimethylallyladenosine synthase n=3 Tax=candidate division TA06 TaxID=1156500 RepID=A0A0S7WS69_9BACT  ali  26  1...........................................................MDERPSFCIHTYGCQMNVYDSDLIAGILSDRGYPRAGSLEEADLILVNTCAVREHAERRAIGRLNELKRVRPDLVVCGCVAQRLGREVVPSIDLVVGPSCYRMLPGLIEDVLRDRMPRYALDLGE-----GESYDGILTAAGRGVTAFLAIMRGCDNRCSYCIVPYVRGPERSRSRDDILAELRTLAEGGVREITLLGQNVVAY-RDGEHRFADLLQAIDDS-RLIQRIRFTTSHPRDLDETVIR--AVAELESVCEHIHLPMQSGSTSVLERMNRQYTAEHYRALIEELREQVPGIAITTDIIVGFPGETDDDFRKTLEMVNETRFDYAYMFRYSPRPGTPAASFEEVPERVRGERLKQLIELQNGIIRQRNAELVGEEVEVLVEHQSDEELIGRTRTNKVVVFGGSRDLIGNFVDVRVAELRGWTPWG.......................................................................................... 433
240 0.000e+00UniRef50_A0A1W1YY87 Threonylcarbamoyladenosine tRNA methylthiotransferase MtaB n=4 Tax=Clostridiales TaxID=186802 RepID=A0A1W1YY87_9FIRM  ali  24  1..............................................................MKTIAAHTLGCKVNQYDTEAMLELFRHSGYSIVPMDGDADVYLVNTCTVTGTGDKKSLQLIRRIRREHPALIVCGCMAQQRGEDLLLGADLVLGTQRRNEVVKLYDQVSRSCHPLCAVEPLKKGQPFENL---TITEQMEHTRAVLKIQEGCDNHCSYCIIPSVRGPIRSRTLDDIQAEVNRLAEAGYREIVLTGIHLCSYGRDLDPSFTLLVIRLIQETDGILRIRLGSLEPVIATPEFASELKKA--DKICPQFHLALQAGCDTVLARMRRRYNTTQYLRGVENLRREFPHAAFTTDILTGFPGETEEEFAETKAFIEKIGFARIHVFPYSSRPGTPAADMPQLSSAEKEKRARELIALGGRVAYLSSWIGLETDLLPEEMV--DGCWEGYTPEYIRVRLEHGDCRSGVPVRVRLLNAGSRVMCGELIKESE................................................................................... 434
241 0.000e+00UniRef50_A0A2H0L246 tRNA-2-methylthio-N(6)-dimethylallyladenosine synthase n=5 Tax=unclassified Candidatus Peregrinibacteria TaxID=1801912 RepID=A0A2  ali  24  24................................................................KYHVKTFGCQFNYSDSERVASLLEEIGYAPTENEVEADFIILNTCAIRQKAEDRVYGLFQELKQKNLKIGITGCMVRKSSSKNYEEIDITFRINELQKLPDLLRELDPELDLNEAADEFDAGTLQNYFKIN--PKYSNTVQAFVPIAYGCDKFCAFCIVPFSRGREKSRLMQEILDECEQLVARGCKEITLLGQTVDSYGLSFDDRFTRLLEELDRKFRGLKRVRWTSPHPKDMTDDLIE--AVARLETQMPYIHLPIQSGSTAMLKRMNRPYTRERYLDRIAKIREHIPDCAISTDIIVGFCGETEEMFEDTLSLYEEIRWDMAFIAQYSMRKFTAAHRKDDVPSKIKQKRWHELNEILKQCSREERFVGKTVEVLVERVL-EDGRLEGRSEHYKRTQFKGTEKMIGELVQIKVEEAGDWYLTGAVI....................................................................................... 481
242 0.000e+00UniRef50_Q5HBR5 tRNA-2-methylthio-N(6)-dimethylallyladenosine synthase n=9 Tax=Alphaproteobacteria TaxID=28211 RepID=MIAB_EHRRW  ali  25  1..............................................................MQGLYIKSYGCQMNVYDSLIIENIIKPLGFSIVNEPSEADIVILNTCHIREKAAEKLYSELGRIRKKNLTIVVAGCVAQAEGTEIFPFVDIVVGPQSIHTLPELIVKARKIKKQIINIDFPVISKFDAIAVEEYTKN--QKVSAFISVQEGCNKFCSFCVVPYTRGEEYSRTVEAIFKEALILADSGIKEITLIGQNVNAYHGTYKGNEWDLLIQHIAKISSIERIYYTTSHPRDMHESLYEAHGI--EKKLIPFIHLPVQSGSNKILRKMNRKHTAEEYINIIKTLRKHRSDIAYSSDFIVGFPGETDEDFENTIQLIEEVKFSQAYSFKYSPRPGTPSAEYSQIPDEIKSQRLTKLQELVQQLEFNKKMIGETHPVLFYKKGKFDNQIIGKTPYMQSCYIENPDLYYNKIVPIKITDAHKNHLTGII........................................................................................ 439
243 0.000e+00UniRef50_W8U6R7 Ribosomal protein S12 methylthiotransferase RimO n=3 Tax=Firmicutes TaxID=1239 RepID=W8U6R7_PEPAC  ali  25  1..............................................................MYKIAIESLGCSKNLNDSEIMAGILEKNGYKLITEFEAADIIIVNTCGFIESAKEESVDVILEMAGYKKYLIVTGCMAQRYSQELIPEIDLILGTTSFPQIAKAIEGLDSQGKLSIIEDIDKDIAENLPKKKLTPDYM-----AYVKIAEGCDNKCTYCIIPKLRGKYRSRKIEDIVAEVEELAKSGVKEVILIAQDTSRYGIDIYKTLPTLLRRL-SQIEAIEWIRVLYTYPEEIDSELID--AVKNSKKVCSYFDMPVQHSSNRILKLMNRKTTREDMLNKISLIRKAIPDAVIRTTLIVGFPQESAEDFEDLKDFVRTARFDRLGAFTYSKEEGTAAANLPQVDEAVKLARKEEVMLLQQEISLQNNMVGESCRVILEEKLEE-GLYSGRSEIDGLIYVKAKGELPGGFVDVRIVEATEYDVKGETI....................................................................................... 440
244 0.000e+00UniRef50_A0A1V5KDC2 tRNA-2-methylthio-N(6)-dimethylallyladenosine synthase n=2 Tax=Bacteria candidate phyla TaxID=1783234 RepID=A0A1V5KDC2_9BACT  ali  24  1...............................................................MKVYIHTFGCQMNEYDSERMAGILEIAGHELVYSEAEADAIIINTCTVRNLAEEKAYSYAGRFV-TDKKVIITGCLAEIKKEELIPTLHAVLGTYNFANIGKII-----------TARKGKVLSGAAEEDYGKNVKRPGGVSGYLAIMQGCDNFCSYCIVPYARGRERSRSIKDIISELNRMASQGFVEVIFLGQNVNSYKDETGVNFAGLLKETV-KTAGIERIRFMTPHPKDISRELAET--VAANKKICSHIHLPVQAGSDNILKAMNRKYTREQYLEKLAMIREVIPGVCVTTDVMVGFPGETEKDFNDTVSLLETARFDSAYMFKYSARQGTAAFKLDDVDKEEKARRINYVLELQKHISENINEIGTTAAALIAPADRYEGEIEAALESGKKVFCRGDLSLIGKIFEVKLTQVRGMSFSGEVI....................................................................................... 422
245 0.000e+00UniRef50_Q2GJJ5 tRNA-2-methylthio-N(6)-dimethylallyladenosine synthase n=43 Tax=Bacteria TaxID=2 RepID=MIAB_ANAPZ  ali  26  6..................................................................YIESYGCQMNVYDALMMEDLLRPVGYAAVSRPEDADIILINTCHIREKASEKLYSTLGRMRVIKKILIVAGCVAQAEGEERAPYVNVVVGPQGLHTLPELIMKVKRDKKQINIEFPVVSKFDA----ISIDRKANGGVSAYVSIQEGCDKFCTFCVVPYTRGPEYSRDVEAILEEVKQLTDRGTKEIVLIGQNVNAYHKGNEWDLGKLIQK-VSLIDGVERIRYTTSHPRDMHPSLYE--AHRDEKKLAPFVHLPVQSGSDAILRKMNRKHTAEEYLRVVEQLKDSNKNMALSSDFIVGFPGETEKDFEETMKLVESVGFALSYSFKYSPRPGTPGAEYNQVPEEEKSARLAALQGLLQQLQFNKSMEGRVMDVLVGDPSSRSDRIFGKSEYTQSIHISGSEDCFNRMVRVEILHGRQNSLEGTVLSNA.................................................................................... 443
246 0.000e+00UniRef50_A0A2D8S5V4 tRNA-2-methylthio-N(6)-dimethylallyladenosine synthase n=30 Tax=Bacteria TaxID=2 RepID=A0A2D8S5V4_9CHLR  ali  25  1..........................................................................MNVADSELVKGILNNEGFLAAATPDSADALFVNTCAIREHAEEKVHSLLGRFKKNRPEIGVLGCMAQSMKHDLLPYVDFVLGPDSYRRLPGILKRHEKDQNSQV-----DTTLSRFEVYEDLFPNRKKGVNAWISIMRGCDKFCSFCIVPFTRGRERSRSLEGIIAEVEQAVFDGFVEITLLGQNVNSYNY-KDIRFHQLLEE-VAKTQGLKRIRYTSPHPQDITYDL--LITMAIHDNICNHVHLPLQAGSDRILKRMNRTYSRGQFIQLAKMIREVVPNCGISTDIIVGFPGETDGEFKKTLDVMEEIKFDSAFTFKYSPRRGTKAAEYDQIIDKVKQMRLEMIIAAQKTLERNQHYVGRVESVIAEKESKRSNQLAGRTDSNKWVIFDKEDVQIKDMVPVHILEAKGISLHGQLL....................................................................................... 421
247 0.000e+00UniRef50_A9FST8 tRNA-2-methylthio-N(6)-dimethylallyladenosine synthase n=11 Tax=Deltaproteobacteria TaxID=28221 RepID=MIAB_SORC5  ali  27  1..............................................................MPRYSITTFGCQMNVHDSERMHDVLRCAGYTEAGSADEADVLVLNTCSVREKAEQKLRSEVGRLARWKRELVVAGCVAQQEGERLLKQIDVVVGPDNIPELPGLLGDLAIGGLPIARTVFDLDAPRFXXXXXXXXXXXXAAPTAFVTVMKGCDERCSFCIVPHTRGPERYRPSDEIVAEIAALVAAGTREVTLLGQTVNSYRDPLGSEFAALLRRVAADVPGLARLRYTSPHPRHLTPSL--VLAHAELPVLPRHVHMPVQSGSDRVLRRMIRRYTRAEYVARTRALVEAVPGLTLSTDIIVGFPGETEDDFAATLSLVREVGFKGLFGFKYSRRPHTPALKLDDVPEGVKGERLARLFEESELAAHLSALVGTTQEVLVEGRDKERGHWSGRTGRHEIAHIDGELDLLGEVVEVSIARANKHSLQAELTE...................................................................................... 467
248 0.000e+00UniRef50_A0A1M5JXP9 tRNA-2-methylthio-N(6)-dimethylallyladenosine synthase n=27 Tax=Fibrobacteres TaxID=65842 RepID=A0A1M5JXP9_9BACT  ali  26  1..............................................................MKKYHLATYGCQMNEYDSAMIAQELDMCGCVETSNQEDADFIIVNTCSVREKAEETAISKLKYLRKKNPKVVVCGCMAKNRGPELLPNVSYIVGPDQYKKIPELLLG-DAKSPLHQTHHKMFIDEDLSENYLGEYAKLQNDFTTFVAIQRGCNKRCSYCIVPYLRGPEKYRDMEDVLAEVRKAADRGITEVTLLGQTVNAYKTEGG-NFADLLTK-VSEIGGIRRIRFTSPHPRHYTNELIDVL--LNNPKVCHYAHIPIQSGSDAMLKKMRRQHNMEQYLSIIEQLRSKDPFYGISTDVICGFVGETEEDFEQTLKAFETCQFDSAFMFIYSPRKGTESYKAETLTEQEKQERHMRLVELQNAITLKRNMLGRTEELLVEKNSRDETELRGRTDNFKKVVFKGQIVKPGDYVKVKLDDIRGWTIRGKLV....................................................................................... 440
249 0.000e+00UniRef50_A0A2A9HH62 tRNA-2-methylthio-N(6)-dimethylallyladenosine synthase n=9 Tax=Chloroflexi TaxID=200795 RepID=A0A2A9HH62_9CHLR  ali  26  2..............................................................TQRFYLWTVGCQMNKADSEKLAAGFLRLGLRQVDRMERADIIVLNTCSVRQHAEDRAYSKLGRIRRPGIKVAVMGCMVGLELEKRFPQVDVFARPQQFDPIMALVEE-----------PAEDLGGEFWPRTYAVP----EGPTAYVPVVHGCNKFCTYCIVPYRRGRERSRPIDEIVREVAYLTAHGVREVTLLGQTVEAYGHDLPPDLGDLMREL-SKLERLDRIRFLTSYPKDMTRPILE--AVAELPKVMECFSLPVQAGSNAVLESMRRGYTREEYLEKIREVRELMPGAGITTDVIVGYPGETEADFEQTLSLLEEVRFDKVHVAAYSPRPGTIAWRPDDVPADVKSERLHRVEALEARISLNRAYVGTEQEILVEGI--RNGQPFGRTRTGKLTHLDAP-ARIGELVRVRIDHAGPFSLRGTPVD...................................................................................... 425
250 0.000e+00UniRef50_Q3A8J5 Ribosomal protein S12 methylthiotransferase RimO n=30 Tax=Bacteria TaxID=2 RepID=RIMO_PELCD  ali  27  3........................................................ESDSVEKRKVSMISLGCAKNLVDAEVMLGYLPQDRFEITTDEAQADIIIVNTCGFISDAKEESVETLLEAIEYKKLLVVTGCLSQRYAEKELPEVDILLGTGDVPRILELIEAHDRGEDVRQSV-----GLPQYLYDHTTPRVASSPFYSYVKIAEGCNNLCSYCIIPQLRGPLRSRSIASVVAEVERLVAAGAQEVNLIAQDITAFGADRGASLEGLLRELV-KISELRWLRLLYAYPDGISDELIEL--VATEEKICSYFDVPLQHIDDRVLARMNRRVGEDTIRDLIHRMRQRIPDLTLRTSFIVGFPGETDAEFAKLLAFVEEGHFDRVGVFRYSREEDTPAASLDQVPEGVKKSRYNKLMKAQQRVSFRRNRIGRVEPVLVEGYSEETELLSGRSDVDGQVYITAGQADVGQIVPLRITDSSEYDLIGEIVDES.................................................................................... 453
251 0.000e+00UniRef50_A0A1F4XZY0 tRNA (N(6)-L-threonylcarbamoyladenosine(37)-C(2))-methylthiotransferase MtaB n=1 Tax=candidate division Zixibacteria bacterium RB  ali  25  9...............................................................KRVALTTLGCKLNQYETEAIASGLEKRGWQRVNFGEPADLCLIDTCTVTQQADYSSRQAIYKAHRLSPKIVVTGCYAQVAKEQLLPGVGLVLGSDYKERLPELIERWFSGQELSLDGKAFNEQEDFRVFAL------SGHTRAFVKIQNGCQEWCSFCVIPLTRGPERSRPAPWIIDEIRTLVDCGYKEVVITGVHIGKYGWE-KVRLADLLKLILAQTE-LPRLRLSSIKPKEVTAELIDL--IASEPRICRHLHLPLQSGDRGVLARMKRKYTLEEFDQMVNSFAQKIPGVTLGTDVIVGFPGETEEEFESSCRYIENSPLNFLHVFSYSDRPNTEASGLPKFDPQVINKRSAVLRELGNRKAFLDTFPGETLSVLFESRREKHNYLTGLADNYIRVNLEGPDSLFNQVVPVRITRREAKLLIGEL........................................................................................ 434
252 0.000e+00UniRef50_A0A257TJ06 tRNA-2-methylthio-N(6)-dimethylallyladenosine synthase n=1 Tax=Planctomycetia bacterium 21-64-5 TaxID=1970542 RepID=A0A257TJ06_9B  ali  26  1..........................................................................MNMLDSELVVASLRKQGYELVATPKEADTILFNTCSVRQHAEDKIYSALGRLKHAKKIIGVLGCMAQKDQRERAPYVDLVVGPGQLHQVPTLIKEIAAGGGPRMEVSHEVEESFESYDPLRDEQMRPTPYQAFVRIMIGCDKFCTYCIVPSVRGPEQSRHPGQIEAEVRRLAAEGCREITLLGQTVNSYRYDGRTRLSELLGRL-HETDGLDRIKFVTNFPKDMTDDLLQ--AVRDLPKCSHYLHVPAQSGSNEILRRMKRNYTVQEYREMLVRIRETVPDAAVTSDFIVGFCGETEADFEATAELVRESRFKNSFIFKYSRRPGTKADELDDVPEEVKRRRNNELLAIQNAISENQAFLGREVTVLVEGPSKASRQLTGRTNCDRIVVFEGNRRLIGQFLPVVVYDANAFTLFGGVVTQ..................................................................................... 449
253 0.000e+00UniRef50_A0A2V2EZJ7 tRNA (N(6)-L-threonylcarbamoyladenosine(37)-C(2))-methylthiotransferase MtaB n=1 Tax=Clostridiales bacterium TaxID=1898207 RepID=  ali  27  5.......................................................ANTNMNTPKKVYFETLGCKTNQYESEALAALFAEAGYDYTEDIDEADVCVVNTCTVTHVSDRKSRQVIRRAKKKDAVLVVCGCYAQVAMEDALGEADVIVGTNQRSHIVKAVEDFLASNKRKTYVATTKEMADFEPLGAHRVI---NMTRAYLKIQEGCQQYCSYCIIPYARGPLRSRKMADILAEVRNLEEANFQELILTGTHIGAYGEEEGYDLADVCAQILAN-SSIPRLRLGSIEPTEVTDKLLQL--MVENPRMCRQLHMPLQSGSDEVLKRMKRPYKTDDYRKIVKKAREMVPEVAITTDIMVGFPGESNDDFRESLMFADEIAFAAMHIFKYSPRENTPAAAMDQVDSTLKDKRSKAMAAVAEELKYMERFVGAEVEVLLEEVDKK-GYWEGHTDNYLKILCRLDDAAKGQMRRVKITELNKRSLYGKEV....................................................................................... 445
254 0.000e+00UniRef50_Q9RV79 tRNA-2-methylthio-N(6)-dimethylallyladenosine synthase n=92 Tax=Bacteria TaxID=2 RepID=MIAB_DEIRA  ali  25  7.................AQAPTTHPRPHTLSSQVAPALPRRPRHAAPE------SLRQARGEVMKAHLITYGCQMNEYDTHLVQSQLVSFGADIVESPDEADFVLVNTCAVRGKPVDKVRSLLGDLRKQKAQVGMMGCLAQLEEGQQIAEVDVLLGPGSLLDIGAALES----------NERFWGLQFKDELHDHIPPPPSGKLQAHLTIMRGCDHHCTYCIVPTTRGPQVSRHPDDILRELDMQLAAGVREVTLLGQNVNAYGVDQGPSFADLLRMVGAS--GIERVKFTTSHPMNFTEDV--AAAIGETPAICEFVHLPVQSGSDRVLRRMAREYNREKYLTHIAQIKKHIPDVVLATDIIVGFPGETEEDFQDTLSLYDEVGYDSAYMFIYSPRPGTPSYKFQDLPRELKTERLQRLIARQKDWSARKNKVGTVQQVLLRGDAHDAGFLEGHTRGNHPTVVPKAIGADGAVYQVRIDHATPHMMYGHILGPDGQPLPEQPRFNPEAAAVG.................................................................. 499
255 0.000e+00UniRef50_A0A2M8D6T1 tRNA-2-methylthio-N(6)-dimethylallyladenosine synthase n=1 Tax=Acidobacteria bacterium CG_4_9_14_3_um_filter_49_7 TaxID=1973888 R  ali  26  1..............................................................MPRFKIETWGCQMNEYDSQKMVGLLKKNGFTQTESEEDAEIFILNTCSVREKAVHKIHSRVGVLKKRRKIVGVCGCVASHEGRELLEKIPFVLGTRSIHLITEAVNRALNGAKFLDTNDHTNEMDA-----PITFAERVGQTKAYVSIIEGCDNFCTYCVVPFTRGHEHSRPFSVILDEVRNAVEKGIHEIELLGQNVNSYNYE-GKCFADVL-QAVSEQPDVQRVRFLTSHPKDFNENLVRV--IAAHDNVCPTIHLPMQSGSDRILKKMGRQYSRIDYLRKIEMVREILPECWLSSDFIVGFPGEDEKDFMDTMNVIQSVKYDNLFSFKYSPRPRTAALKLKDVPDSIASSRLSILQHAQEQIQLNKHMINHVYPVLVESFSKKNKRLTGRTEGNHVVHFEAGEQLIGSIVDVRIESVTMASLKARLV....................................................................................... 435
256 0.000e+00UniRef50_A0A1F8UVE3 tRNA-2-methylthio-N(6)-dimethylallyladenosine synthase n=3 Tax=Firmicutes TaxID=1239 RepID=A0A1F8UVE3_9FIRM  ali  23  7..........................................TKIEIEKQRKIAEELQNICKGKKAAVQTYGCQQNEADSERIAGALRLCGYEMAVDTKDADLVIINTCAIREHAELKVLSGAGQLKKQKMLVGICGCMIQRDQKKSYPYVDFVFGTDMHHRLPEIIHTAISAKKRVSFVTEKPHI-EFGVISEDMPINRQSDYRAWVSIMYGCNNFCSYCVVPHVRGRERSRSYNDIMTEIKGLVSSGFKDITLLGQNVNSY--TGEKSFPQLLND-VAALNGDFWVRFMTSHPKDASSKLIEV--MAANEKIARHFHLPFQAGSDRILSLMNRGYTKQQYLEKAFEIKENVKGVAITTDVICGFPTESESDFLDTLDVVKQVGFDMIYTFVYSPRKNTPAEKMEQIPHEEKVRRFNALTELQNENALNKGLIDQTIKVLSDDKDEK-EINIGRSSQNKIVALDKP-IPKGVFVNAIVKEAQPYALIAEVID...................................................................................... 462
257 0.000e+00UniRef50_A4XLD9 Ribosomal protein S12 methylthiotransferase RimO n=8 Tax=Firmicutes TaxID=1239 RepID=RIMO_CALS8  ali  26  1..............................................................MVKVGFVSLGCNKNLVDSEIMMGACKEAGFEITPNAEDADVIVINTCGFINDAKQESIDTILEMAEYKKFLIVTGCLSQRYKDDILPEVDAILGVKEMLKLPNVIKKLYEGESKLQV---FDDKPTFVYTSSMPRLIATPKFYAYIKIAEGCNNRCSYCSIPLIRGNYTSRYIDDIIQEARKLSEDGYKEIVLTAQDTTKYGIDIYQKLATLLQKL-SEIDNIKWIRFLYSYPEDIDDELLNIVK--SLPKVVKYFDIPIQHINNRILKLMNRKTSSEGIKELIQRIRSAFDEVVIRTTVMVGFPTESEDEFEELYEFVKWAKFDRLGAFMYSQEEGTPAADLPQTDDETKVKRYERILNLQRKISLERNRISKKYEVVIEGRD-RNNFYIARSQDGKIIVFSKRKLLPGEFVVVKILDAFEYDLVGEVI....................................................................................... 440
258 0.000e+00UniRef50_A9WHB1 tRNA-2-methylthio-N(6)-dimethylallyladenosine synthase n=21 Tax=Terrabacteria group TaxID=1783272 RepID=MIAB_CHLAA  ali  27  8.................................................DQRPRPDRDQTPRERRYYVWTVGCQMNISDSERLEAALQGVGYSPATRPEDASFIVLNSCSVRASAEERILGKLGELKRQHPRIVLWGCMVGPNNRSIFPMVDHFVSPSAVDEVVAL---------------APNPIYTLDEPALPVRDWSHPPVSVHVPIQYGCNMTCSYCVIPLRRGRERSRPLAEIVEEVRRIVARGAKEITLLGQIVDSWGHDLPGRLADLL-EAVDPTPGLLRLRFLTSHPAWMTDRLIET--VARLPRCQPEINLPVQAGSDRVLKLMRRGYTVARYKTLIARIRAAIPDISLTTDIIVGHPGETEDDFRQTMDLCAEIGFDKVHIAAFSARPGTRAAEQEQVPPAVKEERRRRLEQLQEQIATERRFLGQTVEVLVEGESK--GKWRGRTPGNRLVFFSHPADLTGQLVPVKITATSPWSLQGVPQLDDSVNAQSKENGLVKAR..................................................................... 466
259 0.000e+00UniRef50_M6D4C6 tRNA-2-methylthio-N(6)-dimethylallyladenosine synthase n=21 Tax=Spirochaetes TaxID=203691 RepID=M6D4C6_9LEPT  ali  24  1..........................................................................MNEYDSGIVSSLMQGAQFETVSDPELSDVIFLNTCAIRENAHAKIYGRLGYLKKRNPDIGVLGCMAQNLGDDLFHQLDLVVGPDNYRTLPELIQTIRSDKQPVSLTRLSKI-----ETYDEIEPRVVNGIQAFVTIMRGCNNFCTFCVVPYTRGRERSRDPHSIVRETRDLVAQGVKQLTLLGQNVNSY-KSEGVDFTGLVRLLLEETD-IERIRFTSPHPKDFPTHLLEL--MAENPRFCPNIHLPLQSGNTDVLENMKRTYSKEEFLEVVDRIKTIVPNVGLTTDIIVGFPGETEEQFEDTLDMVRKVGFDMAFMFKYSEREGTIAQKPDDVPEEVKGERLTKLVDLQTSISLEQNRIGKTFPILVEGASKKSKEACGRTPCGRMTVFKIPENLIGKTVSVKINFATSATLKGEVIE...................................................................................... 428
260 0.000e+00UniRef50_A0A0F0CJC2 tRNA-2-methylthio-N(6)-dimethylallyladenosine synthase n=2 Tax=Candidatus Omnitrophica TaxID=67812 RepID=A0A0F0CJC2_9BACT  ali  26  1..........................................................................MNVRDSGIIEESLKSRGYVFTDNILDADIVIFNTCTVRQNAEDRVLANVKSLKKKNPKIAIVGCVAERHGEKIFPAIDILAGPNNIYDIPDLIEESFSKNNVYAVGKEKRPSRKEEIDSLP-----NDDIQSFVNIMYGCDNFCSYCIVPYVRGREVSRPLMDIIDEIKILADKGIKEVTLLGQNVNSYGAGLNIDFTNLL-EAVNKVAGIERIRFTTSHPKDAGKKL--FTAMRDLKKVCPHIHLPLQAGSNRILELMNRKYTFEEYMEKIFLLREFLPDAGVSTDIIVGFPSEREEDFLATREAMKVIKFNSAFIFKYSPRP--PASSKDDVPSKIKEARNNELLDLQKKLAYDKNFIGSVREVLVEGKSKMNKKLTGRTLENVSCVFPCEENIVGKIVSVKIRDASPFTLKGEI........................................................................................ 423
261 0.000e+00UniRef50_A0A1G0SX12 tRNA (N(6)-L-threonylcarbamoyladenosine(37)-C(2))-methylthiotransferase MtaB n=4 Tax=Bacteroidetes/Chlorobi group TaxID=68336 Rep  ali  27  3...............................................................QRVALHTLGCKLNFSETSTIGNEFLKNGFGIVDFKEKADVYVLNTCTVTQNAEKECRQLVRKVLKQNPEIIVTGCYAQLRPEEIIKGVDVILGSNEKFNLFSLINNFQKRNPACIFVSPTDKLNDFGPAHST---DADNRTRAYLKIQDGCDYKCSFCTIPLARGLSRSMNPDEVIYQFKNLIDEGYREIILTGVNVGDYGKSYSTNLYKLLLKLV-GIEGDYRIRISSIEPNLLTDEIIQLTS--ENEKMCKHFHIPLQSGSSKILKLMKRRYKTDDYSELIYKCKNKIPDLGIGVDVIVGFPGETEEDFLQTYNFLNELPVSYLHVFTYSERPDTKAIEIENVDIYERRKRNNMLRILSKRYKFYKEMIGKDLDVLFETENF-NDKIKGFSSNYVRVSLDYNPNLVNQVVTISIDDIIDNCCSGTI........................................................................................ 430
262 0.000e+00UniRef50_A0A2G6LU65 tRNA-2-methylthio-N(6)-dimethylallyladenosine synthase n=4 Tax=FCB group TaxID=1783270 RepID=A0A2G6LU65_9BACT  ali  27  1...............................................................MKCLIEVYGCQMNVHDGEILAGILIQSGHELTDEISEAEAVLVVTCAVREHAETRALGRLTHLASRRPVMVLCGCVAQEHGSSLLKKLDFVVGPDEYHRLPELLS---KGGRKALTTQGEENYEGFT-------PVRTEFPRAFVNIIRGCDNYCTYCIVPYVRGTERSRSPELITAEVAQLVEEGYGEITLLGQNVNSYTFE-KTRFPQLLAQ-VSDIAGDRRIRFVTSHPRDLSEEL--AMVMASRKNICKSFHLPVQSGSDRVLKAMNRGYTRKGYLEKVAMLRDLMPDIVLSTDMIAGFPGETPEDFQKSVSLLDEVRYDYAFLFRYSERKGTEAAEMPSVPVEERLRRLYVLQDLQGRVTMEKSLVGREMPVLVTGTARRPGQLASRTGGNRMVILENCEYEPGETVQVRITAADGYTHFGEPV....................................................................................... 426
263 0.000e+00UniRef50_A0A2N3G8G2 tRNA-2-methylthio-N(6)-dimethylallyladenosine synthase n=1 Tax=Actinobacteria bacterium HGW-Actinobacteria-3 TaxID=2013648 RepID=  ali  27  8.................................................................YFIRNFGCQMNVHDSEHIAGVLENAGYERADSVEQSGLLIFNTCCVRQSAEDRVWGNLGALNNRGRIVAVCGCMAQRHGVEILPVANLVFGMDALSRLPELIEESRR-------SPVCDLGDVSHATIDCLPAIRGSKAQAWIPVSHGCDNRCAYCVVPMVRGAQRSRAMSDIVDEVERLVGQGAREIILLGQNVNSYGRDLETSFAGLLD-AVASVEGIRRVKFETSHPRDLTHEVLEV--MAREPHICEYLHLPVQSGSDRVLAAMNRGYGRDYCFELIARARKTVPELTVTTDIITGFPGETEDDFADTLELLREVEFDSAYLFIYSEREGTPASLLGNVSIEEKHRRFDKLARLQEGITAREKIVGHDVEVLIEGFSKRGGFLAGRARGHQVVLLSGDRPN-GCLARANIHEAGKRTLRGKVVE...................................................................................... 436
264 0.000e+00UniRef50_A0A0M2NH43 tRNA-t(6)A37 methylthiotransferase n=5 Tax=Clostridiales TaxID=186802 RepID=A0A0M2NH43_9FIRM  ali  26  1...............................................................MKVAAYTLGCKVNQYDTNAMVEMLEKEGFIRVSFHEAADVYLINTCTVTNMADKKSRNMIRRLHHQHPQICVCGCLAQRDSEKEIEGVGAVIGTENRSRIVEIVNEALLGRR----VNWARDISGTDEFEEMTVSSGGELTRGYIKIQEGCNNFCSYCIIPYVRGRVRSRAEESILAEARKLAQNHIREIVLTGIHISSYGQDGGGELLSMLRGL-NEVEGLERIRLGSLEPHILEPGFLR--ELAALEKICPHFHVSLQSGSDDVLRRMNRKYTSGQFAGYLENIRSEFNLPAITTDIITGFPGETDEAFRQTCDFAREQRFSRIHVFPYSEREGTPAASMKSVPVKVRRERANILIDIARELAFAMQFIGTRQDVLFEQKTGD-GLMEGYTDRYLRVHACAQE---GALKNVLLGEYKNGILYAK......................................................................................... 423
265 0.000e+00UniRef50_A0A2P6PES8 Putative tRNA (N(6)-L-threonylcarbamoyladenosine(37)-C(2))-methylthiotransferase n=14 Tax=Mesangiospermae TaxID=1437183 RepID=A0A  ali  46  33.........MEDIEDLFIGGGGAPPGFRLPVTSVGLNPKKKKKPDLSQIKHPLAPLSPKVPGTQTIYIKTFGCSHNQSDSEYMAGQLSAFGYSLSDNPEDADLWLINTCTVKSPSQSAMDTLIAKGKGAKKPLVVAGCVPQGSRDKELDGVSIV-GVQQIDRVVEIVEETLKGHEVRLLSRK-------TLPALDLPKVRKNKFVEILPINVGCLGACTYCKTKHARGHLGSYTVDGLVGRVKSVIADGVREIWLSSEDTGAYGRDIGVNLPILLNAIVKELPPDAMLRIGMTNPPFILEHLKEIAEVLRHPCVYSFLHVPVQSGSDAVLTAMNREYTVSEFKTVVDTLTELVPGMQIATDIICGFPGETDEDFAQTRDLIKEYKFPQVHISQFYPRPGTPAARMKKVPSTVVKNRSRELTSVFEAFTPYVGMEGRVERIWITEVAADGTHLVGHTKGYVQVLVAGPESMLGTSAIVKITSVGRWSVFGEVIETIPE----------SNDKAAVGKERQSQENCFPCSNNFETCACSTEPETCACGPESCGEQATLT...................... 569
266 0.000e+00UniRef50_S4Y1V0 tRNA-2-methylthio-N(6)-dimethylallyladenosine synthase n=7 Tax=Sorangiineae TaxID=80812 RepID=S4Y1V0_SORCE  ali  27  1..............................................................MPRYSITTFGCQMNVHDSERMHDVLRRAGYTEAGGPDEADVLVLNTCSVREKAEQKLRSEVGRLARWKREVVVAGCVAQQEGERLLKQIDVVVGPDN---IPELPGLLGDLALGGLPVARTVFDLDAPRFLVSPPPASRAAPTAFVTIMKGCDERCSFCIVPHTRGPERYRPSDEIVAEIAALVAAGTREVTLLGQTVNSYRDPLGSEFAALLRRVAADVPGLARLRYTSPHPRHLTPSL--LLAHAELAVLPRHVHLPVQSGSDRVLRRMIRRYTRAEYVARTRALVEAVPGLTLSTDIIVGFPGETEDDFAATLSLVREVGFKGLFGFKYSRRPHTPALKLDDVPEGVKGERLARLFEESEALAHLSGLVGTTQEVLVEGRDKERGHWSGRTGRHEIAHIEGAADLLGEVVEVSIARANKHSLQAELTE...................................................................................... 462
267 0.000e+00UniRef50_A0A1H4JQ09 Ribosomal protein S12 methylthiotransferase RimO n=6 Tax=Paenibacillus TaxID=44249 RepID=A0A1H4JQ09_9BACL  ali  26  4................................................................KVKVVTLGCEKNLVDSEIMAGLIHGRGFQLVEEKEEATVIIVNTCGFIDAAKEESVNTILDMADLKKALIVSGCLTQRYKQEEMPEIDGIVGTGDFDKINHIVDEALRGKKPILVGNPVFNYDQDLPRKVSTP-----RYTAYVKIAEGCDNACTFCSIPIMRGSFRSRSMESIVSEVEQLASQGVKEISLIAQDSTNYGTDLYEGFPALLNK-VSEVAGIEWVRLHYAYPGFFTDELI--ATIASNPKICKYIDMPLQHSVDAILKRMRRPGRQKDARELVRKIRENIPHVALRTSIIVGFPGETKEDFEDLKQFVRDMQFDRLGVFTYSKEDDTPASRLDQVADEVKEFRAHTLMEIQREISNLRSRIGQEIDVLIERYDGRSDVYIGRSEIDGEVYVSNAQLKIGEIAKVRITHSYEFDLSGEVVA...................................................................................... 442
268 0.000e+00UniRef50_A0A1V4RMB0 tRNA (N(6)-L-threonylcarbamoyladenosine(37)-C(2))-methylthiotransferase MtaB n=5 Tax=Bacteria TaxID=2 RepID=A0A1V4RMB0_9BACT  ali  25  10...............................................................PKASFFTVGCKLNQYETEGLKEHFRAEGFEIVPFGREADVVIVNTCTVTARADRRSRQALRKAARSGAIVAAVGCYAQVSPERLIPGVDLVVGTSQRQRLIELLRQRQQNPGGQPLVCR----REFSDFECLDITSFDRHTRAFVKVQEGCDNRCAYCIVPSARGPSRSRSLEDTLRQVNRLLNWGYQEIVLSGVCLGAYGLDLRIDLVELLKRL----EGLARYRLSSIEPSYISQELARLL--ANSPKFCPHLHIPLQSGDTEILKKMRRPYSAEQYQDLIWMLKSRMPDMAIGADVIVGFPGETGKHFQNTYRFIQKLPIGYLHVFRFSPRKGTAAYRMEHVDEYTKTLRSQRLRELQKRRQFISSFLGRSLPVLFERRDRQTGLLTGLTSNYIRVLAEGPDEFMNRIAKVRLERVQERKAIGRI........................................................................................ 443
269 0.000e+00UniRef50_A0A2N6EKX2 tRNA (N(6)-L-threonylcarbamoyladenosine(37)-C(2))-methylthiotransferase MtaB n=1 Tax=Desulfuromonas sp. TaxID=892 RepID=A0A2N6EKX  ali  25  16................................................................TVAFATLGCKTNQFETAAMQQQVVDAGYQVVPFAAGADLVVVNTCTVTSATDSQSRNLIRRARRLNPRVVVTGCYAQVDPQTLIPGVSVVIGNQEKGRLLDFLK-----TDPPAKAVAVSDSRSAGGHSLSAVSSFAGRSRAFVQVQNGCDAFCTYCIIPYARGPSRSVTAEEVLSQVQTLVKKGFNEVVLTGIHVGGYGKDLSPDLIDLTQRIAQQTK-VRRVRLGSIEPMEIPDRLVEL--VADSQVVCPHFHVPLQSGDNQVLQRMGRNYDSEMFRERIMAIHRSIPDVGIGLDMITGFPGESEAEFNNSLALIDSLPISYLHVFPYSRRPGTPAAEFDQVPGAVSRSRAERLRRLAKQEQFARRFVGSNLELIVEGQV-ESGHFKGVARNYLSVSFRGDDDLRGQLVWVKVTGFERGGLVGELVS...................................................................................... 444
270 0.000e+00UniRef50_A0A1B3ZGA9 tRNA-2-methylthio-N(6)-dimethylallyladenosine synthase n=7 Tax=Proteobacteria TaxID=1224 RepID=A0A1B3ZGA9_9SPHN  ali  28  1..........................................................................MNVYDGERMAEIMADQGLTATDDANAADLVVLNTCHIREKATEKVYSDIGRLRKHGPLIAVAGCVAQAEGAEIVRKVDVVVGPQAYHNLPDLVARAARGEAA------LDTDMPVDLKFGHLPPRRRVAPSAFLTVQEGCDKFCTYCVVPYTRGAEVSRGWVQVVDEAKALVDAGAKEITLLGQNVNAW-DDDGRGLHDLI-AALADIAGLHRIRYTTSHPNDMAQGLIE--AHRDIEKLMPFLHLPVQSGSDRILKAMNRSHTRDSYLRLLDRVRAVRPDIALSGDFIVGFPGETEADFAETLSLVDAVGHSQAFSFKYSPRPGTPAAGMDQVAAEVMDERLQRLQAALNRAAFNAASVGRRCTVLMERKGKLPGQLIGKSPWLQSVHVIGEAA-IGDLVDVGITAAGPNSVTGTILEQP.................................................................................... 417
271 0.000e+00UniRef50_A0A1I0N6W4 Threonylcarbamoyladenosine tRNA methylthiotransferase MtaB n=2 Tax=Clostridiales TaxID=186802 RepID=A0A1I0N6W4_9FIRM  ali  27  1..............................................................MKKVALHNLGCKVNSYETEAMEQLLIGAGYEIVKFDEEADIYIVNTCSVTNIADRKSRQMLHKAKKLNAIVIATGCYVQAEGSELQLDVDIVIGNNKKADLLHIIEEYENNNAENSAIIDINRTEEYEDLSINSVC---EHTRAYIKIQDGCNQFCSYCIIPYTRGRVRSRNPELIVKEVKGLVDKGYKEIVLTGIHLSSYGIDLGTNLLELII-LLHPIEGLERIRLGSLEPRIITEEF--ASSIAKLEKVCPHFHLSLQSGCDATLKRMNRRYDTTEYYEKCELLRKYYVHPAITTDVIVGFPGETDEEFAITRAFLEKVNFYEMNIFKYSRRKGTVADKMGQVLNQIKTLRSKALLELVDVMSFNRYYEGKYVEVLFEDVNNFEGYAIGHTKEYIKVFVNLNDILLNEIINVKILE--KNTVLGKI........................................................................................ 445
272 0.000e+00UniRef50_A0D7J9 Uncharacterized protein n=1 Tax=Paramecium tetraurelia TaxID=5888 RepID=A0D7J9_PARTE  ali  23  7..........................QRFPRNYFSTSKRSINEIPSLSEMKQQDPQVNNTNNGPKFFIETYGCQMNANDSQIVQSILSSEGYSNTNDISEADIIFLNTCSIRANAEKKVFQRMSELKSQNKVLGILGCMAERLKEQLFQGANIIVGPDSYKSLPTLLNSFQLTRDKQIDT----NLSLTETYDDILPINPTDSITTYVSIMRGCNNMCSFCVVPFTRGRERSRNPESILEEIQILTQKGIKEVTLLGQNVNSYRSGNGLRFDQLLDEIAVKFPK-TRIRFTSPHPKNFPKKVLEV--IAKHPNICKNIHIPIQSGSDEILKKMRRNYTRGAIVDLCNEARTLIPNVTLSTDVIVGFCDETEYDFEQTLSLLQLVQFENAFMFAYSMREKTHAYRQDNVPESVKSSRLEKLIEQQHKIMNYKNEIGKKHIVLVEQLGNKPNQLKGRTDSNKGVVFQNDNNIIGDFVEVEILGSGLKTLSGRPLNKCEI.................................................................................. 501
273 0.000e+00UniRef50_A0A0T5ZMN9 (Dimethylallyl)adenosine tRNA methylthiotransferase MiaB n=3 Tax=unclassified Chloroflexi (miscellaneous) TaxID=189774 RepID=A0A0  ali  27  15.....................................VRPAPPRHPASAPEGLSEFATDDVALPRFHVWTLGCQMNRSDSEEMAGALLAAGCGEAPTLEAADLVVINTCAIREAAEQKVIGRMGRLKQANPRVVLTGCAVRADNPRRYPAVDLFLRPDEEPELVERLGIASPTAPGRLARPTYERVGRSVAATADGRVARHSPFQAWLPIIYGCDKTCTYCIVPFSRGPERSRPFDEVVGEARALAAAGYREVTLLGQNVNSYGHDLRPDIAALLRAIDDGAPAIPRLRFITSHPWDLTDRLID--AIAECPSVCEHLHLPVQSGDDAVLHRMGRQYSVGSYLSLVERLRAAIPGISLTTDVIVGFCGETEAQFERSLELLRTVRYDQVFAAAFSPRPGTPAARLDDVPAAEKRRRLNELLALQEGIGLERNWVGRTIEVLVEGVDTSGPQLTGRNRENRLVHFAGPEALVGLLVPVVIERAGPYALVGRL........................................................................................ 533
274 0.000e+00UniRef50_A0A2M6X802 tRNA-2-methylthio-N(6)-dimethylallyladenosine synthase n=1 Tax=Bdellovibrionales bacterium CG10_big_fil_rev_8_21_14_0_10_45_34 Ta  ali  25  14.................................................................VYISTYGCQMNVNDTERMNSLLEMMNYRAVETPDEASLIIINSCSVREKPVHKVHSEVGRYKKLKLKIGVAGCVAQQEKSKLLPILDFVLGPDNIDELPEIVSAISAEIEPIATDLMEMSLRAPGPNAISSKTIRPKMTRAFVNITKGCDNFCTFCIVPFTRGRLRSRSLTELITDVKVLIDRGVKEVTLLGQNVNSYESSCGANFADLMRTLCEDTD-IARIRYTTSHPKDFDQQLVDISAKYRS-KICDYIHLPVQAGSTEILKRMNRGYSRDEYLAKIEMIKAGIPGVSLSTDVIVGFPGETEDDFRQTFELIQSVGYESIYAFKYSPRPFTKAARYDQVLEADKSRRLTELLEMHREQVFENAPLGKTYEVLVESFNSESSVVTGRTTQNKVAHFLGSTEDIGKMIDVRINKAYPLTLYGERVG...................................................................................... 477
275 0.000e+00UniRef50_K0R5V1 Uncharacterized protein n=1 Tax=Thalassiosira oceanica TaxID=159749 RepID=K0R5V1_THAOC  ali  27  261.........................................PLNIGLEDDNTQSKTIYSVPDAKHYKIVTTGCQMNVADSERIMGVLEELGLKSIESEREPDVLLLNTCTIRDHAEQKVYDAIGAMKRNGRPIVVAGCVAQQEGDALFPEIDLVLGPQYIPWLGELLIEVGKGAQLCMTDAQERDSTRDKDADWQVPIKRGHSTRAWVNVIYGCNEHCTYCVVPGVRGVEQSRSMEAILQECLKLAEAGYKEVTLLGQNIDAYGRDMTPNFADLLYYLNDNIPDISRIRYVTSHPRYFSDRVID--AVANLDKVCECFHMPFQAGDDKVLKEMRRGYTFDSYMNIIRKIKEKAPDASICGDVIVGFPGETEEEFQRTLDLMNEVHFDNLNTFAYSPRPNTEAALWKQVPPEVSAERLQRVQKLANEHALERRYLGKIVEVLVEDRNPKNEEVMGRTRQGRQVFFKADIGLAGKLVDVKITEAGTWSLLGEL........................................................................................ 754
276 0.000e+00UniRef50_A0A1F3VPX3 tRNA-2-methylthio-N(6)-dimethylallyladenosine synthase n=20 Tax=Oligoflexia TaxID=1553900 RepID=A0A1F3VPX3_9PROT  ali  27  21..............................................................KRNVWIKTFGCQMNYHDTERVLSHLRKLNFLPTDDKNDADLLLFNTCAVRALANMKFYSQLGELKKSNIVIGVLGCISQIEGQELLKHLDFALGTDMVDQIPEVLYRIYSGESKIVL-----DSFDKTSAYSIETKITHQSPQAFINIMKGCNNFCTYCIVPYTRGREKSRLIKEVVADIQRLVENGIAEVTLLGQNVNSFGKENQETFPELLAR-VNQIAGLRLIRYTTSHPKDLSDELIN--AHGTLSKLALHLHLPVQSGSNTVLARMNRKYTREAYLDLLARLRDKQKGIVISSDIIVGFPGETDEEYEDTIDLLKQARFDFIFSFKFSKRPGTQAYLMEDHPDDIKSKRLKKLQDLQLAIQNEQEMVGKTMQLLVDGVGKIEGKWKGRSSCNRIVHFDGPPELLYKWVTVKITSSTALSAQGEFIS...................................................................................... 462
277 0.000e+00UniRef50_A0A1F7RPT6 tRNA (N(6)-L-threonylcarbamoyladenosine(37)-C(2))-methylthiotransferase MtaB n=4 Tax=Bacteria TaxID=2 RepID=A0A1F7RPT6_9BACT  ali  26  1...............................................................MRIAFYTLGCKANQFDEAAMKQVLEGMDVEFVPFNNLADIYIINTCTVTAKTDYQARQAIRNAVKYKSKVIVTGCYAQVNKEEIIPGVSLVLGNQEKAKIDKYIGDFPENGDSIIKVSEIINVSGFDSIEI---KNFGNHTRAFVKIQDGCNSRCSYCIVPYARGKNRSLEIEKVKIQIERLLEQGYREIVLTGIHLGTYGEDFGGNLSRLLQQI-ETIKGKFRIRLSSIEPLEITDELINV--IASSERIAPHLHIPLQSGDDEILKKMNRNYNAGFYKDLVAKLINKIPNLNIGADVIVGFPAETDDQFKKTYMLINGLPLSYLHVFPFSKRALTPAALLEQITHSVCKERSSILRELGKKLEFRTRFIGKTMSVLVEEKDRETGLYKGFTENYIPVLFNGKNEFKKKLIPVKLNRIEGNRVFGEI........................................................................................ 439
278 0.000e+00UniRef50_A0A2G9ZDJ7 tRNA-2-methylthio-N(6)-dimethylallyladenosine synthase n=4 Tax=unclassified Bacteria TaxID=2323 RepID=A0A2G9ZDJ7_9BACT  ali  28  1...............................................................MKYFILVLGCQMNNSDAERIETVLNGLGYKKTGKEKDADLIVAVACSVRQAAIDRIHGKVRNWQREKQKTVLTGCVLATDKKKFTESFDLVFNIENLTLLPEML------------HSMKETDVRERGKYLTLKPMHSSGFQALVPIMTGCNNFCAYCAVPFTRGREYSRPAEDIISEVKELVENGCKEITLLGQNVNSYGNDKKPNFAELLSKI-NDIPGDFWIRYITSHPKDMSQDLIK--KFVQCSKVCGYLHLPLQAGSSEVLKNMNRNYTYEHYKNLIERVRAVKPNIAISTDIIVGFPGETIEQFEDTMEAFKDLKYDMAYIAQYSPRSGTKAASFDDVDKKEKKRRLKVLTEILAGTALEKNYVGQTEKVLAEKFEK--GLLFGHTDSFKLVAISGGKEYVGNFVQVIITDNNPWALEGTMV....................................................................................... 422
279 0.000e+00UniRef50_A0A2W6B9X6 tRNA (N6-isopentenyl adenosine(37)-C2)-methylthiotransferase MiaB n=1 Tax=Chloroflexi bacterium TaxID=2026724 RepID=A0A2W6B9X6_9C  ali  30  2.........................................................SENETPKRYWIWTVGCQMNKVDSDRVAGTLKSRGCIPAEREEDADIVILNSCAVRESAERRVSGKLGQMKKERPDIGLTGCSVSADTAQRFRGADMYFQPTRLDQFVEQLDQFWPSTQDPGAMSCWQEQSGETECA---------GPSAYVPISNGCDKFCTYCIVPYRRGRERSRPMLDIVDECGSLVKRGARELTLLGQRVNAYGRDFGTELADLL-ALVNTIPELVRLRFLTSYPKDMSDRLID--AVASLDKVCEHIHLPIQSGNDEVLTNMRRGYSRQDYVRLIGRLREAVPSLALSTDIIVGFPGETEEQYRDTLSLMEEVRFSTVYSAAYSPRAGTLAARWDDVPRDVKKDRLQRLDALQQHISQHQALKGETVEVLVESERKDTAQWRGRTRQNRLVFIPGGQDLMGRTVHVRIEKASPFAMQGTPL....................................................................................... 441
280 0.000e+00UniRef50_A0A1V2YK04 tRNA (N(6)-L-threonylcarbamoyladenosine(37)-C(2))-methylthiotransferase MtaB n=2 Tax=Clostridiales TaxID=186802 RepID=A0A1V2YK04_  ali  27  17............................................................GRAKYVSIYTLGCKVNQYDTEAVAEQFKERGYEVVPFKEIADIYIVNTCTVTHLSDRKCRQILRKTKKINPILVAMGCYAQAVSDKIQDEVDIVIGTNRRKELIDIVENFSHGTNNELITNYVDNIMEIAEFEELTISQMSEHTRVYLKIQEGCNNYCTYCIIPYVRGKIRSRKEDNVIKEASRLAINNFKEIVLTGIHVASYGKDLNVSLNTLLPKL-NNVDGIERIRMSSIEPIVVTNEFVNML--VTTKKMCQHFHLSLQSGSNSVLNRMKRRYTTQQYFDSVMILRNLWPDIAITTDIIVGFPGETEQEFLETLEFVQKVGFSQIHIFPYSNREGTIASKMEQISSQIKDERVKRLIEAKLRYAFLDRECGKIVEVLFE--TSQNGISTGYTSNYLKVEVATDEILTNKINKVSIDKRVGDVLSATLI....................................................................................... 455
281 0.000e+00UniRef50_A0A1V5K6A2 tRNA-2-methylthio-N(6)-dimethylallyladenosine synthase n=2 Tax=unclassified Firmicutes sensu stricto (miscellaneous) TaxID=84086  ali  24  1..........................................................MQGKCKRARVVAFGCQMSERDSETIAGLLSACGYDPVADSAPPDMVLFVTCCVRGNAENRAIGNLGDMKRLKMIVAVAGCMAQEEGMRRLPWVDLVFGTHNIQNLPAMLARVEAGERVIEVLDDSDSIAE------HLPAIRAYRHKAFVNITFGCDNFCTYCIVPYVRGRERSRTEADILKEVSDLVDAGCREVTLLGQNVNAYGKGLPPGFAHLL-RAVNGVEGLRRIRFTTSHPRDFTPDMIR--ACAESERVCRHLHLPLQAGSDRVLARMHRGYTLKRYLELLDEVRSAMPDVAITTDLMVGFPGETEEDFLETLRAVAEARFDAAFTFVYSPREGTVAAGMDQVDEAVKGDRIRRLIEAVSAAASNAALVGSVQEVMVEGPSERDSVMAGRTRTNKMVHWPTPQPPPGDILNIRIEQASVYTLRGV......................................................................................... 480
282 0.000e+00UniRef50_A0A2E4HBH7 tRNA-2-methylthio-N(6)-dimethylallyladenosine synthase n=23 Tax=Chloroflexi TaxID=200795 RepID=A0A2E4HBH7_9CHLR  ali  28  1..............................................................MESYYIWTVGCQMNKADSERMESALGQMGLGPTESPGDADVIVLNSCVVRESAEDRVIGMLKPLKQKNPELALMGCMPQTKLQKRYPYVDAFMQPQQFGRLLEIVGERIGIDPEGCVGPLTARADVAT----------------YIPIIHGCDKFCTFCIIPYRRGREVSRPVDEIVLEARMLARRGVKEVTLLGQNVDSYGHDLSGDLGDLL-SAVNEVEELERVRFLTSHPNDMSDHIIDT--IAHLDKVCEHVNLPFQAGDDQVLKNMRRGYTNDEYRAKIERIRNRIPNVSMATDLIVGFCGETEEQFERTLEMVRDMKFDKVHAAAYSTRPGTIAARMDNVPHEEKQRRLKAITSLQETVLTEINLEGTTQEILVEG--RKRGRWFGRNRNDKLVYFDEDINRSGEMVTVKIERVGPWSLQGTL........................................................................................ 422
283 0.000e+00UniRef50_A0A1F8UE89 tRNA (N(6)-L-threonylcarbamoyladenosine(37)-C(2))-methylthiotransferase MtaB n=2 Tax=unclassified Clostridiales (miscellaneous) T  ali  25  1...............................................................MKVAGYNLGCKVNKYELDSVLEEFKKNDYEIVDFGDIADVYIVNTCAVTQLAERKSRQMINRAKSKNAIFVAAGCYTQKEGESITD-VDIVIGTNNKDKIYKMVEEYIKNREKILLVESISTEKIYDDMKLSST---QDATRAYVKIQDGCKNYCTYCIIPYLRGAVRSRKLVEVLEEVEMLAKKGYKEIVLAGIEVASFGEDLGDKLIQVLEE-TSKVRGVERIRLSSMYPTVVDEEF--VSSIKNLNNICNHFHLSLQSGCNATLKRMNRRYTTEQYRQGIKLLKKNILDVAITTDIIVGFPGETEEEFEATYNFVKEMKFSKIHVFKYSKRKGTKAEILEQIDENIKNNRSSKMIKLGEEQEFLKNYIGRELDVLFEGKIKKDNRYPGHSMNYLKVVVESAENIKNEIKTVKIEKVEKDYLVGSL........................................................................................ 428
284 0.000e+00UniRef50_A0A2N2CL84 tRNA (N(6)-L-threonylcarbamoyladenosine(37)-C(2))-methylthiotransferase MtaB n=3 Tax=Firmicutes TaxID=1239 RepID=A0A2N2CL84_9FIRM  ali  24  1..........................................................MNNAQRKVGFMTLGCKVNTYDSEAMMEIFETAGYTIVDFSEVADVYVINTCTVTHLGDQKSRKMMRKAKRINPIICAVGCYVQVAPDEKIAEVDLMIGTKNRGDILAYIDAHLQDVSQRDFVSDIMDEKIFEPLMISEVK---GKTRAFIKIQEGCNQFCTYCIVPFARGPVRSRDRQQILDEVNRVVEIGYQEVILSGIHIASYGVDNKTDLIDLI-EALDGVDQLKRIRLGSMEPKFITPE--RLKRLAVLESFCPHFHLSLQSGSDTVLKRMGRRYTTAEYMEIVSQIRAVFPLAAITTDIMVGFPGETAAEFAETLDFARAVGFYQIHVFKYSRRLGTKAAAFDQVDEVVKNSRSHELGELSKELEFIKKNDGLIAEVLFEATQDVAG-YEGHTKNYVPVFLVTDEKINGRIIKVRVSYSSRYALIGESMEEIAAFE................................................................................ 449
285 0.000e+00UniRef50_A0A232EI88 Uncharacterized protein n=2 Tax=Pteromalinae TaxID=272242 RepID=A0A232EI88_9HYME  ali  59  18..................SQDITPKERYSYKKNNIRPSRKKQKEEIVFPEIQIYS--SVIPGTQTIYIKTWGCTHNSSDSEYMAGQLSMYGYNLTEDKSIADLWLLNSCTVKNPAEDHFKNEINLARKLGKHIVVSGCVPQGAPKSNFIQGLSIIGVQQIDRVVEVVEETLKGNTVKFLNKKKEAGKKIGGAPLSLPKVRRNPLIEIIAINTGCLNQCTYCKTKHARGELGSYRPEEIIERAIQAFKDGIKELWLTSEDTGAYGKDINTNLPELLWKLIDVIPDKCRMRIGMTNPPYILEHLEEIGKILKHPKVYSFLHIPVQSGSDRVLFDMKREYSRSDFENIVDFLKEKIPNINIATDVICGFPTETSEDFEETMSLCQKYKFSTLFINQFFPRQGTPAAKMIQVPSKEIKNRTKLISEFFQSYEPYNTKIGEIQEVLVTEIAHDNKHYVAHNSYYEQVLIPMKKEYMGEMLKVKIISASKHSMKGEALDETKVSRPFLTQALAPEEQQDVKQ............................................................... 515
286 0.000e+00UniRef50_A0A1F5R449 tRNA-2-methylthio-N(6)-dimethylallyladenosine synthase n=1 Tax=Candidatus Edwardsbacteria bacterium GWF2_54_11 TaxID=1817851 RepI  ali  24  6.................................................................YYMETYGCQMNLYDSAAVRTLLDQAGCRETEDPEQAQLVVINSCAVRGHAEERVLGRVGELKSWKRRMILMGCVGQENGQNLLDQLDLVLGTERYREIVPHLQSLLKTGARAAIT-----GLEKAGPDLSIIPRFEKQVGAFLAVMRGCDNFCSYCIVPYVRGREYSRTSGDILGEIKCLAERGIKEITLVGQNVNSY-LSAGTDFPGLLAQAAD-VPGLERLRFITSHPKDCGIKLLET--MAGNQKICRHLHLPLQSGSDRVLAQMNRKYTLGQYREIVSTARKLMPDLVLTSDLIAGFPGESEEDFKMTLDVMQDIRFDSAFTYKYSIRPGTKAAQMPQLAEDVRQDRLARMISLQQKISQESNQIGKTFIVLVEKAVPKRGQMMGRSPGNKPVAFDASGVSPGDIVKVTVNKATQSTLTG.......................................................................................... 432
287 0.000e+00UniRef50_H0E2U0 tRNA-2-methylthio-N(6)-dimethylallyladenosine synthase n=3 Tax=Patulibacter TaxID=361607 RepID=H0E2U0_9ACTN  ali  27  2.........................................................ASSDTPKRYHVTTFGCQMNEHDSERMRGMLESLGYGAAETAEDADLILFNTCSIRESADSRFLAHLGHAKRMKKE-----CWAQSVKDERFPFVDVAFGPGQINKLAEFL---------TADSLSAQGYFEFEGFPAHLPTKRDRSFQAWVQIAVGCNLKCSYCIVPSTRGRESSRPFEQLLDEVRALAADGVREVTLLGQNVNAYGRDLRTTFAELLT-AVAAVDGIERIRYTSPHPKDIREDVVAVH--AALPEVCQHIHLPLQAGSSRILKRMRRTYDKQRYLDRVAMIREQCPDIAITTDIIVGFPGETEAEFEETLEVVDAVAFDGAFTFVFSPRRGTEAAELDFVPHPVKVERMERLVERVQHHARERRFVGRTLEVLIEGESRDPDKLRGRTSHNKVVNFVG-FGQPGETVPVQITGATSQTLSGEM........................................................................................ 460
288 0.000e+00UniRef50_A0A1V5US31 tRNA-2-methylthio-N(6)-dimethylallyladenosine synthase n=10 Tax=Lentisphaerae TaxID=256845 RepID=A0A1V5US31_9BACT  ali  26  1...............................................................MNVYIKTYGCQMNERDSESAAAMLAVAGHTIVSGEQEADVVILNTCSVREQAERKAVGKLGILKRERPIFGIMGCMAQSRGEELLDHLDFVVGTDNIHTLPEILRDLAQERRKVC--RDACMGADTPGIDAHRIHDAANPFSAFVSISRGCNRYCSYCIVPYVRGPERSRNADGILTETEALAKEGVTEVMLLGQNVAAYGLDGNSPFADLLER-VHAVEGIRRIRFTSPHPAFFNRKLIET--VARLPKVCKNIHLPLQSGSDRILKKMNRPYTAAEYLAVVSGLRSLAPGITFSTDIIVGFPGETAEDFEATRSVMRAVRCDNAYIFKYSPRKGTVSSRMDDVPXXXXXXXXXXXXXXXXXXXXXNNLVGRTFELLAEGPSKRNSRWSGRTDTFKQVVFPSESLKPGDYVPVKIMGSTSMTLYGERV....................................................................................... 445
289 0.000e+00UniRef50_A0A2A6CR52 Uncharacterized protein (Fragment) n=1 Tax=Pristionchus pacificus TaxID=54126 RepID=A0A2A6CR52_PRIPA  ali  24  38................IAMGNKGPGLSDFIKD--LPRTRKDKIFPAISDTHAYISRAQLNGDGKKVLLVTFGCQMNVNDMEVVRGLLIQNGYIETKEEAEADAILLMTCSIRDGAEEKIWKRLKHLKRNQRRVAVLGCMAERVKSTLLPG-DLVAGPDSYRDLPRLLALSQSGTKAMNV----QLSFEETYADVTPVRVDTHTKTAFVSIMRGCDNMCTYCIVPFTRGRERSRPIDSILDEVKRLRDEGVKQITLLGQNVNSYGVDGGRSFATLLDH-VSRVDDSMRIRFTSPHPKDFPNQVIELIK--ERKNICNQIHLPAQSGDDSVLDAMGRGYTRESYLTLVDNIKNAIPNVSLTSDFIAGFCGETEEAHQNTLSLMREVDYSFCFVFPYSMREGTRAHRKDDVPENVKMRRHEELASVFREISLRRNRLGKRELVLIEGRSKRGEKMSGRTDGGIVVHIEEKEKKMGDYVVVKITGGTSQTMSGE......................................................................................... 541
290 0.000e+00UniRef50_UPI000D364400 tRNA (N6-isopentenyl adenosine(37)-C2)-methylthiotransferase MiaB n=1 Tax=Candidatus Similichlamydia epinepheli TaxID=1903953  ali  26  1..........................................................MYQKPKSFFIQTYGCQHNVLDSELMTGSLVKYGLKKSKTLEEADLVLFNTCSVRHTAENKAIGKLVSLAKTKRKLGVSGCVANHRKDHLLPHVDFIMGTNNLHAILDIIEELISTGKRIIRVDDVFEHDLDYRLAE-----RADNVSAFVSIIRGCNKYCTYCIVPYTKGPEVSRKYNNILDECIDLANRGYKEITLLGENVNGYGKDRDDGFHHLLEKL-HEIPGIERIRFMTSHPIDISDELIE--SIGALPKVCEFVHFCLQSGSNRILKKMNRMYTRESYQEKVKKIRQTIPDWGIGSDFIVGFPTETEEEFLQTKTAVKEDNFTTAFFFMYSPRKGTPSTRMDNVTKEEKLNRLQQLLDLHEQISLEQRKIGKVVEVLVEGPSKEENFVKGRTRGWWRAILPGTTNLIGTIQTIRVLDVKHLTLIGEPVTPS.................................................................................... 457
291 0.000e+00UniRef50_A0A2N2BH89 tRNA (N(6)-L-threonylcarbamoyladenosine(37)-C(2))-methylthiotransferase MtaB n=2 Tax=unclassified Firmicutes sensu stricto (misce  ali  27  1..............................................................MAKVAFHTLGCKVNQYETEGMMTQFEKLGYDVVGFFEKADIYVINTCTVTNMADKKSRQMLAKAKKNNPKVVAVGCYVQASNKELLEQVDLLIGNTDKGNVVQVIETYLESKTK----PKILDLSQYKVYDDLWISMTQDHTRAHIKIQDGCDQFCTYCIIPYARGRIRSRSVTSILEECKELAKKGYKEVVLTGIHLASYGIQFDDKLIDLLEDI-QEIEGILRIRLGSLEPTLITQDF--VSRVEKLDKVCPHFHLSMQSGNDVILKKMNRKYTTVDYKRAVDRLREKMPTCAITTDLIVGFPSETEAQFEDTLIFIKDIGFANMHIFKYSKRNGTPAAKMEQVNPKERNIRSTRAIEMAENMKFLTGFIDVEMEVLIEEEVILDHYYVGHTTNHIKVYTMSTQVLKNTIKKIHLKQRFEDGLLG.......................................................................................... 431
292 0.000e+00UniRef50_C0D0N3 Ribosomal protein S12 methylthiotransferase RimO n=27 Tax=Clostridiales TaxID=186802 RepID=C0D0N3_9FIRM  ali  27  1............................................................MEKIKLFCVSLGCDKNLVDTEKMLGLLNREGYAFTDDEGEADAILINTCCFIGDAKEESVNTILEMARLKRALVVAGCLAQRYKEEIIPEVDGILGTTSCDEIVNVLNGILGREKPAPVSCFHDLAEPPTGGENRVVT--TGGYYAHLKIAEGCDKRCTYCIIPYLRGSFRSVPMEQLVREAGQLAEQGVKELILVAQETTLYGKDLYGELPKLLHEL-AKVPGIQWIRLQYCYPEEITDELIE--AIRTEEKVCHYLDIPIQHASDGILRRMGRRTNQAQLREMIARLRREIPDIALRTTLISGFPGETQEDHEELMAFVDEMEFERLGVFAYSAEEDTPAYSFDQVPQEVKEDRRDEIMQLQQEIAFEKSMVGRVLTVLIEGKVVDEPAYVGRTSVDGLIFVNADVELMGDFVRVRVTGSAEYDLIGEIYDESAQ.................................................................................. 451
293 0.000e+00UniRef50_A0A0S7Z1I0 tRNA-2-methylthio-N(6)-dimethylallyladenosine synthase n=1 Tax=Gemmatimonas sp. SG8_23 TaxID=1703356 RepID=A0A0S7Z1I0_9BACT  ali  23  5.............................................................RPKRAYVETYGCQMNISDGELMEGILADRGYEIVTAPEEADVVLVNTCAIREHAEKRVLGRVSQLNRPGMVIGVTGCMAQRMGETLLPYVDLVMGPDGYRGLPDTLARLGHGRKGRRGPQLAVLQLDMDENYQGLEQRRSDGPSAWVPIQRGCDHRCTYCIVPYVRGSEKNRSAPDILKEVRGLAEQGVTEVTLLGQTVNSYVWE-GVAFPRLLRD-VARVDGIRRVRFTSPHPNDVTEELVAV--MAEEAAVCEHLHLPAQAGNDRTLKRMLRRYTVDSLMEKIELTRSWIPDIALSTDIIVAFPGETDEEFRDTLDLMRSVRFDEAYTYKYSARSGTPATRLDFIDPDEAQVRLEELIEVSRAVQSEINEVGRVEEVLIEGEGRDPGQVRGRTRRNKVVVFDGDAARVGSYTRVRLERTTGATFAGSEVAQA.................................................................................... 466
294 0.000e+00UniRef50_A0A2N5ZH82 tRNA-2-methylthio-N(6)-dimethylallyladenosine synthase n=1 Tax=bacterium BM706 TaxID=2053465 RepID=A0A2N5ZH82_9BACT  ali  25  1...............................................................MKVCILTYGCQMNVHDSEVIKNKLHQLGYSFTDDTEQSDMILIVSCCVRESAEKRIYGRINYFKKLKLIIGLMGCLAQKDKKEVFPHIDFALGPQEIGSLENMILSVKAGKRSV------GDFKEREFIVSGDRVIPDNHYVGWISIMKGCDNYCSYCIVPYVRGHEVSKPFEYIVDEMKYLSSLGIKDVTLLGQNVNSYGKGLEENFTKLLSKI-DKLNIIPRIRFMTSHPKDMDISLIDV--IGKGKNLCEHIHLPVQAGSNRVLKEMNRKYDIETYLKKIEYIKKTLKGYAITSDIIVGFPGEKEEDFEKTIELVKKVRYDAVHTFVYSKRSGTKAAEMETVPEETKQRWIKKLIDVQNPISLEINQEGKEFEVYFEGFDNKGENLKGRTRNNKIVVVKKDETLLGEFRQVRITQGQHWCLMGELL....................................................................................... 434
295 0.000e+00UniRef50_A0A1I4STF0 tRNA-2-methylthio-N(6)-dimethylallyladenosine synthase n=2 Tax=Bacteria TaxID=2 RepID=A0A1I4STF0_9DELT  ali  23  13................................................................RLYVHTFGCQMNEYDSLRVQRMLSLEGYELVDDPSRADVIFINTCSVXXXXXXXXXXXXXXXXSPHSIVAVGGCVAEQVREERFPHVDIVVGTRGLADFPRLVQFVAETRQKVSSFPEEEKSCGMEWLNPSDPSWNTE-VVAPVTIMQGCNNFCTYCIVPYVRGRERSRPVEDIINEIEALARKGAREVLLLGQNVNSYGKTLNPTFADLLRQIVAGELGILRVRFTTSHPKDLTEDLMACFR--DLETLCPQIHLPFQAGSDRILRLMNRKYTQREYLGKIDRLRSYRPDIAISADVMVGFPGETEADFRETMKVIETVRFDGLFSFRYSDRPFTVASRMEKVDDETKTRWLVELQQRQAEITLQKNKEGLVREVLVEGRSKAGGQLTGRTPHGRIVNFDGPEELVGKIVAVRIVEGYAHSLKGELIDNNRVT................................................................................. 459
296 0.000e+00UniRef50_A0A1C7I9J1 Ribosomal protein S12 methylthiotransferase RimO n=8 Tax=Clostridiales TaxID=186802 RepID=A0A1C7I9J1_9FIRM  ali  24  1..............................................................MRKVLFISLGCDKNLADSEEMLGMLVAHGYTIVNDETEADVAVVNTCAFIHDAKEESISNILEMAKYKKVLLVTGCLAQRYKEEIIPEVDAVLGTTSFDGIIEALDKAFEGEKYLEFKDTSYLPEVETKRMIT-----TGGYYEYLKIAEGCDKHCTYCIIPKLRGRYRSVPMEKLIKQARYLAEQGVKELVIVAQETTIYGCDLYKSLHKLLKELC-RIPGIAWIRVLYCYPEEIYPDLIRV--MKEEPKICHYLDLPIQHCNDRILKRMGRRTTRQELVDMVTVLRKEIPDIVLRTTLITGFPGETQEEHEELMDFIDEMEFDRLGVFTYSPEEDTPAAGMDQIDEEVKKERQAELMELQQEISLDKGQIHSEVQVMIEGRVAEENAYVGRTYGDAPIFINTDTELIGDLCTVHITGALEYDLIGELKDE..................................................................................... 443
297 0.000e+00UniRef50_A0A1G1IP79 tRNA (N(6)-L-threonylcarbamoyladenosine(37)-C(2))-methylthiotransferase MtaB n=1 Tax=Omnitrophica bacterium GWA2_50_21 TaxID=1801  ali  26  1............................................................MPLKKVHFATLGCKTNQYETQAMREKFLKAGYEEASRPEDADLFVVNTCTVTGEGDRKSRSVIRRLHRENPKIAVTGCYATLNQEEILPGVSFVIANQEKEKIVERVNLDAAGK-----FCGEGDESESNRYSDLSISFFADRTRAFVKVQDGCDHACTYCKVVIVRGPSRSRAEADILEEASRLAEGGYQEIVLTGIQLGAYGWENGLNLTSVLKKLCA-VKGLRRIRLSSIDPSDVTDEFIRC--MSEEPKICAHLHLPLQSGDDTILKAMKRAYRRDQYLRIVEKLRKAVPDFSLTTDVMVAFPGETEEHFKNTVRVLEETLPLKAHIFPFSAREGTRAADFGRLTPEVSRERVTALQAVSKDLAYKQRFAGRITEVLVENPNEK-GELEGHTSNYLKVCFQGDVRWVGSLKKVRLLEAGPEHFRGEVITD..................................................................................... 434
298 0.000e+00UniRef50_A0A1V5PI99 Threonylcarbamoyladenosine tRNA methylthiotransferase MtaB n=1 Tax=bacterium ADurb.Bin363 TaxID=1866927 RepID=A0A1V5PI99_9BACT :_  ali  25  1............................................................MKKRKFSFFSLGCKVNQAEMESLSRFLLQNNWEIASINEKAHLCVINTCTVTNRADRKSRQKIRRVIKDNPFIIVTGCYAQAAKEEIISGVNLVIDNSEKNRLSEIISK-------RFLIGDTEKTGHIYSDFISY-----GRTRTFLKIQDGCDNFCSYCIIPFVRGNPHSMPPEEVIKRIKSLTLAGYKEIVITGINLGSYGKDFPLKFADLLNLICEKTP-LERLRLSSIESLDINKAFLEMFN--KYPVLCNHLHIPLQHGHNSILHNMNRNYTVEQYREIINLARERIKDLAITTDVMVGFPGEKEEYFSSTRNFLQEMQLSKIHVFSYSPRKGTVAFNMEQVSEEIKNERSRILLELSKKMSFYRKFIGQSLSVLFEHRDKKTGLLKGLTTNYIPVTIEGRENCFGKILMVNIIGLKEEALFGEIISE..................................................................................... 429
299 0.000e+00UniRef50_A0A2P6NAF7 Uncharacterized protein n=1 Tax=Planoprotostelium fungivorum TaxID=1890364 RepID=A0A2P6NAF7_9MYCE  ali  25  82........................................................PATVGQGRSVYVETYGCQMNVSDTEIIKSIMITSGFGEAESAEQADVVFLNTCAVRERAEDKIWDRLDHLNKKDMIIGVLGCMAERLKTKIIEKVDIVVGPDAYRDLPRLLARVDSLEGPSINVL---LSQDETYADITPVRTSSNGLVGFVSITRGCNNMCSYCIVPYTRGRERSRDPDSIVDEVRGLIRDGYREVMLLGQNVNSYGEELGVSFTDLLDR-VARVDENVRVRFTSPHPKDFSDDLVDL--IASRSNICKSLHLPAQSGSTTVLDRMRRGYDRPSYDRLISSIKEKMPGVAISSDFISGFCGETEEEHQDTLSLLRQVKYEHAFMFAYSLREKTHAHRADDVPPEVKQRRLAEVISLFYSTSKEQNEIGREHLVLVEGRSRRSEEWVGRSDTNKKVVFQTREVKPGDFVIVKIDSVTSATLRGTPITDYDSYRLSKSTPIHEQRHTQTTEPIICRDKDHEGS................................................... 602
300 0.000e+00UniRef50_B8C4S6 Uncharacterized protein n=2 Tax=Bacillariophyta TaxID=2836 RepID=B8C4S6_THAPS  ali  26  4..........................................................SIPNAKYYKILTAGCQMNVADSERIMGVLEELGLTSLDDTEEPDILLLNTCTIRDHAEQKVYDALGSLKRDGKPIVVAGCVAQQEGEALFPEIDLVLGPQYIPWLGDLLVEVGKGSQLCMTESMIWNW--------MVPIKRGHSVRAWVNVIYGCNEHCTYCVVPSVRGVEQSRSMEAILQECVQLAASGYKEVTLLGQNIDAYGRDMTPRFADLLHYLNDNLPPISRIRYVTSHPRYFSDRVID--AVADLDKVCECFHMPFQAGDDQVLRDMRRGYTYASYMNIIKKIRAKAPDASICGDIIVGFPNETDEAFQRTLDLMEEVKFDNLNTFAYSPRPNTEAANWEQIPPDVQSERLQRVQALAAKHALERRYEGRVVEVLVEDRNPKNGEVMGRTRQGRQVFFEGSDELKGELVMVKVVEARTWSLVGKLAD...................................................................................... 453
301 0.000e+00UniRef50_A0A1G7A6P7 Threonylcarbamoyladenosine tRNA methylthiotransferase MtaB n=2 Tax=Peptococcus niger TaxID=2741 RepID=A0A1G7A6P7_PEPNI  ali  26  15...............................................................PTVAFHTLGCKVNQHDSDMMAALFAAAGYEVVPFHDIADVYVINTCTVTHLSDRKSRQMIRRAVSQNPIVAVCGCYVQTAADERIEGVDVLIGTNERSRIVEAVEAYRQAGERQILMPSEEDLYTFEPVTHAQV---SDRSRAYVKIQEGCNQFCSYCIIPYARGPLRSRRVADTVSQVQDLVRAGYREVVLTGIHIGVFGQDEPGDLTALCRAILAETD-LPRLRLGSIECTEITPDLIRL--MAEEPRMARHLHIPLQAGADKTLSAMNRPYNTEAFRQIMREVRAAIPGIAVTTDLMVGFPGETDDDFRASLIFANDMAFSDMHIFKYSMRGGTPAAAMDQVPAEVKDRRAKQMVARKNKEAYARAQIGKTLSVIIEDHHTDGG-VTGHSSNYLKVYIPQDAPPAKTVAAIEIIDYKDYLLQGQVTSADKA.................................................................................. 451
302 0.000e+00UniRef50_A0A1V5T339 tRNA-2-methylthio-N(6)-dimethylallyladenosine synthase n=2 Tax=Bacteria TaxID=2 RepID=A0A1V5T339_9BACT  ali  25  12...............................................................KRYYIRTFGCQMNEHDSSKMGVMLENMGYLPSESVEDADLLLYNTCTIREKAHHKAISEIGRLKKKNPNVGVCGCVAQQEKDEIYPHLDLVFGPDKISKLPFMINSAINGERPLMV--ELVNSSDGYEFLGDIGRQKFEAGAAFVSIMKGCNCACSYCIVPKVRGREVCRTPLEIMTEINRLVDAGAREVTLLGQNVNAYKRSLDTNFTDLL-RMISDSTGIERIRFTSPHPKDVSLELIE--EYGKNEKLCPHIHLPIQSGSNKILKAMRRSYTRERYLEIAAGLKTARPGISITTDIIVGFCGEKIEDHHHTLDLMNEVKFDSSFAFKYSPRPDTEAFDFDDVDEGEKERRLADVLDLQSNLSKNESLVGSAGNCLVYGMDRKKGLLTGRMPDNRIIHFSGNPDLIGGIVRVRVTGAFRNSLKGEL........................................................................................ 452