current user: public

If you have questions about the server, please let us know.

Query: sp|Q8WXG1|RSAD2_HUMAN(removed signalp:1-15) Radical S-adenosyl methionine domain-containing protein 2 OS=Homo sapiens GN=RSAD2 PE=1 SV=1, from H.sapiens

Results of PSI-BLAST search in nr85s
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .
# E-value Template Links and tools%idFirst VFRQPLSSLWRSLVPLFCWLRATFWLLATKRRKQQLVLRGPDETKEEEEDPPLPTTPTSVNYHFTRQCNYKCGFCFHTAKTSFVLPLEEAKRGLLLLKEAGMEKINFSGGEPFLQDRGEYLGKLVRFCKVELRLPSVSIVSNGSLIRERWFQNYGEYLDILAISCDSFDEEVNVLIGRGQGKKNHVENLQKLRRWCRDYRVAFKINSVINRFNVEEDMTEQIKALNPVRWKVFQCLLIEGENCGEDALREAERFVIGDEEFERFLERHKEVSCLVPESNQKMKDSYLILDEYMRFLNCRKGRKDPSKSILDVGVEEAIKFSGFDEKMFLKRGGKYIWSKADLKLDWLast
1 0.000e+00UniRef50_A0A2E1ZKN3 GTP 3`,8-cyclase n=51 Tax=Gammaproteobacteria TaxID=1236 RepID=A0A2E1ZKN3_9GAMM  ali  16  6..............................................NKLVDKFGRHVDYIRLSVTDRCDFRCVYCMTEDPRTQILTLEELYQIAKAFTELGVKKIRLTGGEPMVRTDVMTLIE---KLGALPGIEELNLTTNGAQLDKHAPALKRAGVNRINISIDSLNAGRFKKISRVGKLEKVLAGIEAAREAGFD---RIRLNSVIMRGYNEDEVISLTDYALD---RDIDIAFIEEMPLGEASDHDRKETTCSNDWVKNAISQKYEL-INSTEQTAGPSRYAQIAGSRIGFISPVTHNFCEDCNRVRVTVEGRLLLCLGNEHSIDLRSILRDESS....... 294
2 0.000e+00UniRef50_A0A2H6F2M0 GTP 3`,8-cyclase n=1 Tax=bacterium BMS3Abin06 TaxID=2005714 RepID=A0A2H6F2M0_9BACT  ali  15  6..........................................KTKNQPIKDSYNRRIDYLRISITDKCNLKCVYCMPSKGEAEILTDEEIVRFIRIARNHGLRKVRITGGEPLMRKNIISLVSSIKE----TGIRDLSLTTNGITLSKIAGDLKAAGLDRVNISLDTLEAARYKTITKGGDINLVRESIKEAERAGL---TPVKINVVPIRGINEDEILAFASLTFKEN---YHIRFIEFMPATRNGIWRKKRCVNSEEVLEKI-STLGKLESFEF-RGRGPSRNYRLKGAAGGIISPLSDHFCGFCNRLRLTADGKIRPCLFSREEIDIKTPMRNNATDE..... 299
3 0.000e+00UniRef50_R6RD13 GTP 3`,8-cyclase n=4 Tax=Firmicutes TaxID=1239 RepID=R6RD13_9FIRM  ali  15  1................................................MIDSYGRNINYLRISVTDRCNLRCQYCMPESDHEEIFRFEEILQICESMGALGIHRFKVTGGEPFVRKGCMDF---LRQLKALPCTEQVTITTNGILLGKFLPELKEIGIDGINISLDTLQPEVFQQITGHTGLESVLENIVKSQEM----GIRTKVNTVLLKSINDKEFPDLLHLA---RDYAVDVRFIEIMPIGFGKNYEG---YSRKKLLPKIAELYPNYQITTKQRGNGPANYIKIPGFRGGFIDAVHGKFCHQCNRIRLTSDGMLKLCLYYENGLNLKKLLRNGA........ 283
4 0.000e+00UniRef50_A0A2E0A560 GTP 3`,8-cyclase n=69 Tax=root TaxID=1 RepID=A0A2E0A560_9GAMM  ali  18  3................................................LQDSFGRRFRYLRLSVTDVCNFRCNYCLPDGTEEQPLSVNEIQQLAQAFARAGTRKIRITGGEPSVRADLPEIIRTLR---AVPGIEEVALTTNGYRLGERVHEWKAAGLDRFNLSIDSLDPRQFHAITGHNRLQELLDGLDQARAAGFND---IRINTVLLRQFNASELDAFLEWI---RETPLTLRFIELMRTGDNAAFFNDNHVSGESIQTRLLDSGW--QPLLRSASAGPAREFSHPDYAGRIIMPYSKDFCASCNRLRVSATGKLHLCLFGEQGHDLRDLLKAEHSD...... 289
5 0.000e+00UniRef50_A0A1G3QZJ6 Cyclic pyranopterin phosphate synthase MoaA n=1 Tax=Spirochaetes bacterium RBG_16_49_21 TaxID=1802195 RepID=A0A1G3QZJ6_9SPIR  ali  14  7.......................................................KINYLRLSVTDRCNLNCIYCNPAEKKSEILSYEEMARITKIFSMLGVNKVRITGGEPLIKKEIVKFVGMLRDIKA---IDEISMTTNGTHLKKLAKDLKHAGLDRINISLDTLQAERFEKITGTDGFHDVWDGITASMEAGLS---PTKLNVILMKGINDDEVDDFIDLTFR---YPLIVRFIEYFPTNRRLKEYSGNTITNEKVKGVIINAYGELKEGRDVIGNGPARYYQVNGAVGGFISSFSDNFCSACNRIRIDSSGMIYPCLFTKEGYAVRHLLKENVSDEVLL.. 293
6 0.000e+00UniRef50_A0A1Q9NLR7 Cyclic pyranopterin monophosphate synthase n=2 Tax=Candidatus Heimdallarchaeota TaxID=1936272 RepID=A0A1Q9NLR7_9ARCH  ali  17  6........................................NKTVKAEHLVDKFNRKIGSVRISITDRCNLRCKYCMPEEGKEHILTFEEIIYLIRIFHSYGIKNYRLTGGEPTVRDDVVKLVELIKSEFPDINL---SMTTNGINLTKFAVPFKEAGLDRLNISLDTLNHEKFYEMTRRDQFTKVMDGISAAINANFE---NIKINSVALKDFNNDYLKEFIDFSEENNV---EIRFIEFMPF-TGTNWRNGQYIDSNSMIEEI-KAHEEITELPLLDPSQTSRIWSLREGKIGFISSVSNSFCDSCNRVRITAEGNLRPCLHNSKEYPLRDLIRK.......... 299
7 0.000e+00UniRef50_P39757 GTP 3`,8-cyclase n=1450 Tax=root TaxID=1 RepID=MOAA_BACSU  ali  18  2..........................................ITESRQMLDKRNRPLRDLRISVTDRCNFRCTYCMPAEKKEELLSFEELERLATLFVRFGVEKIRLTGGEPLMRKDMPELIKKLAR---IPGIRDIAMTTNGSLLPVYAKRLKEAGLKRVTISLDSLEDERFKKINGRGSVSKVLEGIEAA----KQAGLGVKINMVVQKGVNEKDILPMARYFKEKGH---ILRFIEFMDVGNTNQWEKKDVM-TKAEIIDLINKHMPVEPIAPNYIGEVASRFRYLDGSGGVISSVSDAFCGSCNRARLSARGELFTCLFASSGFDLRAPVRQELSDDELSE. 306
8 0.000e+00UniRef50_A0A1Z8WXC4 GTP 3`,8-cyclase n=5 Tax=Bacteria TaxID=2 RepID=A0A1Z8WXC4_9CHLR  ali  15  6..................................................DKLNRPVKDLRISVTDRCNFRCTYCMPKEPKDELLDFDEIYRIANTFAKLGVNKIRLTGGEPLVRRNIEELI---AKLSKINGIDDIAMTTNAYLLEPKLDSLIDAGLNRLTVSLDSIDNETFKKMSGQNEVSKVLSAIDQA---NKKGFESIKINCVVQKNVNEHSIIDLLDYFRDSGN---IVRFIEYMDVGNLNGWELKD-VLSIEEILKLIEIKYKVEKIPPNYEGEVAKRFNLVDYEFGFISSVSQPFCSTCTRARITMDGKLVTCLFANSGFDLRSIIRQGCTDEKLDE. 302
9 0.000e+00UniRef50_F9UBS2 GTP 3`,8-cyclase n=6 Tax=Proteobacteria TaxID=1224 RepID=F9UBS2_9GAMM  ali  16  2............................................NEQTLTDPFGRRIAYLRLSVTDRCDLRCGYCLPKEEPAHWLTFEEIARVVGAFTALGVRHVRITGGEPLVRKDLPNLAERLSAL---PGLDDLSISSNCTRMDVLAEPLYRAGVRRLNVSLDSLRPQVFKEVTGGD-LDKVLRGIKAARAVG---FAPIRVNTVVMRGVNDEEIEDILAYCAENG---FTLRLIETMPMGATGRGAQDQYLDLQSVRRRLEQRFELIPDILP--GGGPARYYRV-GARIGFITPISQHFCETCNRVRLTVDGTLYLCLGQENSYALRPLLRDG......... 289
10 0.000e+00UniRef50_Q89NT2 GTP 3`,8-cyclase n=492 Tax=root TaxID=1 RepID=MOAA_BRADU  ali  16  13.............................................SSAMTDPFGRTISYLRVSVTDRCDLRCFYCMSEDPKADLLTLEELDRLCSAFIAKGVKKLRLTGGEPLVRRNVMTLVRSLSRHLSSGALSELTLTTNGTQLAKYARELADCGVRRINVSLDTLDPKKFREITRWGEIDKVLEGIEAA----RAAGLAVKINAVALKNLNEDELPSLMRWAHG---KNMGLTLIEVMPMGEIGAGRIDQYLPLSLVRARLAQQF--TLMDLAESTGGPARYVSVAGGKLGFITPMTHNFCESCNRVRITCTGTLHTCLGHEDASDLRKPLRA-SDDDMLL.. 307
11 0.000e+00UniRef50_A0A1B9BMV6 GTP 3`,8-cyclase n=30 Tax=Clostridiales TaxID=186802 RepID=A0A1B9BMV6_CLOBE  ali  17  1................................................MVDSSGRNIEYLRISVTDRCNLRCVYCMPECGHDEILTFKEIMLIVKTVSQLGIHKIKITGGEPLVRKGIVNLV---RRIKDIDGIEEITMTTNGVLFGDMADSLAEAGLDSVNISLDTLNSTSFNKITRRDCLDKVKLGLKKAVEL----GLKTKINCVPIAQLNGDDLIDILKIAKEN---PIDVRFIELMPIGFGKSYSP---VCNEQIFEQIEQNFGTLQNSKIKHGNGPAVYYNLSDFKGGFISAISNEFCETCNRIRLTADGNLKLCLHYNKGVLLRSGISKEQ........ 288
12 0.000e+00UniRef50_UPI0009F1C5AA GTP 3`,8-cyclase MoaA n=1 Tax=Lysobacter enzymogenes TaxID=69 RepID=UPI0009F1C5AA  ali  16  277..................................................DRRGRPLRDLRLSLIEACNFRCPYCMPAERVADDLSFDEIETLVRGFVRVGVRKLRLTGGEPLLRKGLPELIARLSR---IDGLDDLALTTNGSLLARQARALREAGLRRLTVSLDALDPDLFRRLGGRGEVAQVLAGIEAARAAG---FGPLKINCVVQRGVNEDQVLPLAERFRGSGDV---LRFIEYMDVGNCNGWDPRGVVSSQELRDAIDARWP-LRALDAQYRGEVASRYAYRDGAGGFVSSISAPFCGDCHRARVSADGQLYTCLFAAAGSDLRGALAQGENA...... 567
13 0.000e+00UniRef50_A0A1X6ZF27 GTP 3`,8-cyclase n=11 Tax=Proteobacteria TaxID=1224 RepID=A0A1X6ZF27_9RHOB  ali  14  4...............................................PLIDPFQRPISYLRVSVTDRCDFRCVYCMSENPKKELLTLEELDQMCSTFIGLGVEKLRITGGEPLVRRGIMTFFDNMTRHLDSGALKELTLTTNGSQLARFAGDLHSAGVRRVNVSLDTLDEQKFADITRWGRLPQVLKGIDAAQAA----GLRVKLNVVALKGFNEDELFTLVEWCHA---RDIDLTFIEVMPMGDGNEDRLDQYWPLKDLRARLGEEY--TLIDLTERTGGPARYVQLAGQKIGFITPLTHNFCESCNRVRLTCTGELYMCLGQEDMADLREPLRKSPDDMQPLE. 299
14 0.000e+00UniRef50_E4TGB3 GTP 3`,8-cyclase n=8 Tax=Deferribacteraceae TaxID=191394 RepID=E4TGB3_CALNY  ali  15  1.............................................MNELTDKYGRTYRYLRVSVTDRCNFRCKYCIPTHNHKQILRYEDLIFALKIFSKYGIKKIRLTGGEPLVRKGLTNFIK---SIKSETDIEEITLTTNGSLLNQFAVELKKAGINRINVSLDSLKPERYQLITGGFNLNNIIDGIKAAQDAGL---FPIKINTVLIKGFNDDEIVDFCHFSADNNV---TVRFIEFMPIGNSIGWN-KNVIIRGKEILDIIGEHFSLTKIEKHRFEGPALNYKLNGAKIGIITPISNHFCGECDKLRITPDGKLRPCLLSDREIDLTEAI............ 285
15 0.000e+00UniRef50_Q9AC48 GTP 3`,8-cyclase n=2880 Tax=root TaxID=1 RepID=MOAA_CAUVC  ali  13  22...............................................SLIDGFGRAVTYLRVSVTDRCDLRCVYCMAEHPKAEVLTLEELDRLASTFVGLGVRKLRLTGGEPLVRKGFIGLVARLSRHLSSGALDELTLTTNGSQLERYASDLARHGVRRINVSLDTLKPALFRALTRGGDVTRVIAGIDAAQAA----GMTVKINAVALKHDNAGEIPALIQWAHGRGC---DITLIETMPLGEVDQDRTDQFLSLQDVRRDLSS--FWTLTDIPDSTGGPARYVHVAGGRLGLITPLSNHFCDTCNRVRLTCTGTLHTCLGRDDASDLRAEIRRGASDAELVD. 316
16 0.000e+00UniRef50_M1MZJ8 GTP 3`,8-cyclase n=19 Tax=Firmicutes TaxID=1239 RepID=M1MZJ8_9CLOT  ali  16  1................................................MFDNYNRKIDYIRISVTDRCNLRCIYCMPEKGSKEILSYEEIIHLCENFAKIGISKVKITGGEPLVRKDLALLIKGIKNIK---GINNITLTTNGILLEEQIDALADAGIDAINVSIDSLDKNTYKNITRVGNVDKVIRGINKVLEY---KDIAVKINCVPIEGFNEKGILDVIKLAQN---KNIHIRFIELMPIGFGKKING---ISEDKIKKMINGRYGELIPHNKSIGNGPSKYYTLDNFQGGFISAVNHKFCDTCNRVRLTSNGFLKACLQFNEGQDLKSIIRNGKSDDELME. 292
17 0.000e+00UniRef50_A0A2D9DPT4 GTP 3`,8-cyclase n=1 Tax=Pseudohongiella sp. TaxID=1979412 RepID=A0A2D9DPT4_9GAMM  ali  15  4...........................SSSTTDKSVTDAAIANAGNEGLIDRFGRRVDYVRLSVTDRCDFRCVYCMTEEPRRQVLSLEEIYQLGKAFTELGVRRLRLTGGEPLVRNNVMSLIQALGRL---PGLDELLLTTNGAQLEKLAGPLRDAGVNRINISIDSLDADRFKRITRVGSLQRVMAGIAEARKHGFE---RIRLNSVIMKEYNDDEVMALTDYALEQGV---DIAFIEEMPLGQASDHAREDTVCSNDWVREQIQSRYTLVSTDAQ-TAGPSKYYNVAGYDIGFISPMSHNFCADCNRVRVTVEGRLLLCLGNEHSADLR............... 303
18 0.000e+00UniRef50_A0A0Q6I8J9 GTP 3`,8-cyclase n=47 Tax=root TaxID=1 RepID=A0A0Q6I8J9_9BACI  ali  14  6.................................................KDSLDRPLRDLRISVIDRCNFRCQYCMPAEPKSELLSFKEIVRLSKIFASLGVIKLRLTGGEPLLRKDLTTLI---SKLVKIEGIEDIGLTTNGVFLKKQAGNLKSAGLKRVNISLDSLDDELFKQMNGRGGIKPVIEGIAAA----KEAGLGVKVNMVVKKETNQSQILPMARFCKEEG---IQLRYIEFMDVGHTNGWQMKN-VLTKKELLEILQAKFDLEPVEEDYFGEVAKRFRYKGTELGFITSMSESFCSSCTRARLSANGSLYTCLFNGKGHDLKSLLRSKISDEEL... 300
19 0.000e+00UniRef50_A0A0S7ZK54 GTP 3`,8-cyclase n=1 Tax=Spirochaetes bacterium DG_61 TaxID=1704237 RepID=A0A0S7ZK54_9SPIR  ali  16  3..............................................EILQDGFGRRVDYLRISVTDRCNLRCFYCMPKGGSSQILRYEEILKLADLFLELGVKKIRITGGEPLVRKNILFLLQELGKRKS---LEELVLTTNGTKLHELAYGLLEAGVKRVNVSLDTLIPFTFLKITGIDLHGRVMRGISEAASL----GLKIKVNVVAMRGVNDQELQDFVRYGID---KEVDICFIEIMPHAYNSGVARDLFIPRREIFKRI-KAIFPLFKTGEAHRRLTADVYGVKGSEIGFISALSHPFCERCNRVRLTPDGRLKTCLFGEKDLDLRALIQSQTEEDLI... 295
20 0.000e+00UniRef50_E3D0Z1 GTP 3`,8-cyclase n=7 Tax=Synergistaceae TaxID=649777 RepID=E3D0Z1_9BACT  ali  18  1.............................................MESLTDRFARKLNYVRISITDRCNYRCVYCMPPEGHHRILRYEEILFLCEALVAMGVRRVRFTGGEPLVRKGVLPFLKELRERFPSL---RVALTTNGSLLKPYAQDLAALDLDSLNVSLDTLDPERFRQLTRLGCLQDVLGGLDAVSRAGVA---PIKLNTVLIRGENDHEIPALLDFAHRRGHL---LRLIEFMPL-EDQRWSSDAFIGADEILRSLPGPGDWIEEEEAEAGKGPARYFRVTAQRLGIIAAVSHHFCSQCNRLRITATGELRTCLFAQEGTNLR............... 285
21 0.000e+00UniRef50_A0A2G4GX69 GTP 3`,8-cyclase n=5 Tax=Bacteria TaxID=2 RepID=A0A2G4GX69_9PLAN  ali  16  1................................................MIDSHGRTILDLRISITDRCNFRCVYCMEPDPADRLLTPTEIVRMAGIAEGLGVRKIRITGGEPTLHPELEAIIAGIRSTTRV----EIAMITNGSLLTRHAAQWKRAGLGRVTISIDSVRADRFARVTRSTATDDVLAGIDACLAEGL---TPLKLNAVLVRGVNDDEAVDLAKLARRFGV---EMRFIEYMPLDSAHAWDRTLMVPAAETRAAI-EQKFALLPTGADDAHSTARTYRFADGAVGFIAPVSSPFCGACSRLRLTADGFVRPCLFSTTEWLLRNGASDADIERFLID. 299
22 0.000e+00UniRef50_A0A250AXZ6 GTP 3`,8-cyclase n=3 Tax=Gammaproteobacteria TaxID=1236 RepID=A0A250AXZ6_9ENTR  ali  16  4...............................................QLTDAFARKFYYLRLSITDVCNFRCTYCLPGGYQPNFLSLDEIRRVSRAFAQLGTEKVRLTGGEPSLRRDFTDIIAAVRE---NPMVRQLAVTTNGYRLARDVERWRDAGLTAINVSVDSLDARQFHAITGQDRFQQVMAGIDAAFAAGYR---KVKVNAVLMRDVNHHQLGAFLRWIKD---RPIQLRFIELMETGEGGQLFRKHHVSGDVIRRQLEREGWC--RLPRGRSDGPALVFSHPDYQGEVGLIMAKDFCASCNRLRVSAIGNLHLCLFGEQGIPLRDLL............ 286
23 0.000e+00UniRef50_F0S3P3 GTP 3`,8-cyclase n=2 Tax=Desulfurobacteriaceae TaxID=558314 RepID=F0S3P3_DESTD  ali  15  3.......................................................RINYLRISVTDRCNFRCRYCMPEGPHSEILRYEEITEIVRVFTEFGIDSVRLTGGEPLVRKGIESLIVQIREL---EEIRDISLTTNGFFLSEKVKSLKEHGLNRVNISIDTLEPEKFGFITGTGDLSRVLHGLEKAIEEGLN---PVKVNTVLIKGFNDKEIESFVKLSENYGV---EVRFIELMPVG-GKFFSRKNFISSTLIKKQIEKKFGKLIP-VKTRGNGPAKSFIVEGAKLGFVSPISEHFCNSCNRVRLTSDGKLRLCLMSDKDIDLKSIIRN.......... 282
24 0.000e+00UniRef50_A0A2K8UGV0 GTP 3`,8-cyclase n=265 Tax=root TaxID=1 RepID=A0A2K8UGV0_9GAMM  ali  17  3..............................................EPLTDPFGRRIAYLRLSVTDRCDLRCGYCLPKEEPEHWLDFAEITRVVGVFTRLGVRHVRLTGGEPLVRRDLP---RLAARLAALPGLDDLSLSSNCTRMEALAEPLYQAGVRRLNASLDSLRPEVFAQVTG-GRLDQVLRGLAAARRAGFK---PIRINTVVMAGVNDGEVEQLLEFCAQHG---FTLRLIETMPMGSTGQAAQNQYVDLRRIKERLERRYPLIPDLLP--GGGPARYYRLSDTRVGFITPLSQHFCATCNRVRLTVDGTLHLCLGQENSYPLRALLRAGVTDEDL... 294
25 0.000e+00UniRef50_A0A1J5Q570 Cyclic pyranopterin monophosphate synthase n=2 Tax=root TaxID=1 RepID=A0A1J5Q570_9ZZZZ  ali  14  2..................................................DGFGRRKRDLRVSLTDRCNLRCNYCMPVEGNDALLTDDEILRVVKVAVDHGITRIRLTGGEPLIRPSLIEIVRSIAKLKPRP---EITLTTNGIGLAALAEPLAKAGLDRINVSLDTLNPERFLAITHRNRWNDVILGLAAAKATTLS---PIKVNSVLLRGINDDEAPALLDWALKN---DYALRFIEQMPLDPQHGWTREEMVSAEEIQRELEISHKLTAVGRRIRGSSPAEEFLIGDATVGIIGSVTRPFCADCDRLRLTADGQVLNCLFAREEDDLRAILRSGSAD...... 289
26 0.000e+00UniRef50_A0A1S8MY93 GTP 3`,8-cyclase n=9 Tax=Clostridiales TaxID=186802 RepID=A0A1S8MY93_CLOSA  ali  16  1................................................MIDIYNRKIDYIRISVTDRCNLRCIYCMPEDGHSEILSYEEIIHLCEAFAKIGISKIKITGGEPLVRSDLAYLIE---KIKNIDGINNVTLTTNGILLEEQIDSLVKAGLDAVNVSIDALDESTYKYITRIGSVNNVIRGINKALEY---KNLIVKINCVPIEGTNDKQILDITKMAKNKK---LNVRFIELMPIGLGKKMNG---LGEEEIKKIIGEEFGELTPFNKSLGNGPSHYYSLEGFEGGFISAVSHKFCDKCNRVRLTSRGFLKTCLQYDKGINLKKMISDGENQEELIE. 292
27 0.000e+00UniRef50_UPI0006B5A7A0 GTP 3`,8-cyclase MoaA n=1 Tax=Niameybacter massiliensis TaxID=1658108 RepID=UPI0006B5A7A0  ali  17  1................................................MHDLEGREVDYLRISITDRCNLRCIYCIPQGKQNEYLTKEELFKVVKVAASVGITKVKLTGGEPLLRKDIVALVKGI---KEIEGIQQVTLTTNGILLDTYGKALVEAGIDAVNISLDTLNRKKYAALTGYDGLSKVLKGIHILKEAGLK---KIKLNAVPLKDMNEQEISELVQFAKQEQ---LILRFIELMPFGGGKAF----LGISKQEIIEILERYGTLIPYHNTLGNGPAQYYQTKDVKIGFIHAVSQHFCNTCNRVRITCEGYLKLCLHSNKGIDLK............... 279
28 0.000e+00UniRef50_E4LM73 GTP 3`,8-cyclase n=5 Tax=Selenomonas TaxID=970 RepID=E4LM73_9FIRM  ali  17  1................................................MRDRFERKIEYLRISVTDCCNLRCRYCMPAHGHEDILSYEEILRDVRALAALGIRKVRLTGGEPLVRRDIVTLV---RGLKEIPGIETVAVTTNGVLLGAMLDDLVAAGLDAVNLSLDTLDGGKFFSITRRPLFGSVMESLER---LAAERRITVKLNCVPIADVNDDEIA---AIAAIARDHAVSVRFIELMPIGCARTAGYRG-VPMDEVRARLRSAFGALLPVGDGAHGGPAAYVRPAGFTGGFIDAMEHKFCSTCNRVRLTAEGFLKLCLYSNAGLDLRGGATDTELA...... 299
29 0.000e+00UniRef50_A8URQ9 GTP 3`,8-cyclase n=24 Tax=Bacteria TaxID=2 RepID=A8URQ9_9AQUI  ali  16  4..................................................DKLGRTLRDVRISVTDRCNFRCFFCMPPDKRSELLSYEEIARLVGVLVSLGVRKARITGGEPLMRAHLENLVE---KLASIEGLRDIALTTNGYTLDRKLDSLVSAGLKRVTVSLITLNQDKFTSMVGRDSLNRVIEGIRSARQMGLN---PVKVNMVVVRGVNDDEILDIAEFC---RENDLHLRFIEFMDVGTLNGWNMDR-VVTAQEILSLLDKRFGVEELGKRDGSETSVRFRYRDTEFGIVASVTRPFCSGCTRLRLSADGKLFTCLFSDRGYDIKKLLRSGASDDDLKEY 298
30 0.000e+00UniRef50_A0A162QZF2 GTP 3`,8-cyclase n=6 Tax=Terrabacteria group TaxID=1783272 RepID=A0A162QZF2_9CLOT  ali  17  1................................................MKDCMGREIEYLRLSVTDRCNLRCVYCREQCNKEKELTVDDIDRIVKSMVSLGVNKVRLTGGEPLMRPDLEMIVKKIAQ---NDRIKDLCMTTNGQGLSYRAKALKEAGLMRLNISVDSLDPARYSRITRGGKIEEVIRGIDEAIACGL---YPIKLNAVIVRGENDDEIDDFIALTKD---RPIDVRFIELMPIGKLGQ-DKENRVPSSE----ILESRSYLKRVMPRYPSQPSEDYKVEGYQGGFISPMSHKFCNICNRIRLTSDGQIKPCLGNNGEVSLKNAL............ 277
31 0.000e+00UniRef50_A0A1F9FC55 GTP 3`,8-cyclase n=1 Tax=Deltaproteobacteria bacterium RIFCSPHIGHO2_02_FULL_40_11 TaxID=1797858 RepID=A0A1F9FC55_9DELT  ali  12  1................................................MQDGFQRKIDYIRLSLTDTCNFQCFYCRPRSPSNEYLTAFDIEFMFQVLAQMGVRKVKLTGGEPLLRKDMCDI---LQKISAISQIKDISLTTNGYFLENIAYALKESGLKRVNISLDSLNADTFQKITQTPTFHRVWRGILKAIEVGLD---PVKLNIVLMKGVNDQEVEDFVELTQK---YPLSVRFIEFMPT-RQTVQDQKKYAVSNEAVLNALKRKYDLFPEINTSHTGPSRNYVLKNGLGGFISPITHNFCDQCNRVRISAKGKLRLCLLGQNEIEL................ 280
32 0.000e+00UniRef50_K9H249 Molybdopterin cofactor biosynthetic protein n=5 Tax=leotiomyceta TaxID=716546 RepID=K9H249_PEND1  ali  14  1...........................................................................MPEEGIDKLLTSPEILYLSSLFVSQGVTKIRLTGGEPTVRKDIVPLMQDIGKLRQN-GLRELCLTTNGISLYRKLDPMVEAGLTGVNLSLDTLDPFQFQIMTRRKGFDAVMKSIDRILEMNQGAGIKLKINCVVMRGMNDREILPFVEL---GREKPVEVRFIEYMPFG-GNKWNQGKMFSYQEMLAVIREKYPTFEK-VADHKNDTSKTYRVPGFEGGFITSMTHNFCGTCNRLRITSDGNLKVCLFGNAEVSLRDIIRKEN........ 265
33 0.000e+00UniRef50_A0A2C6CLN5 GTP 3`,8-cyclase MoaA n=5 Tax=Lewinellaceae TaxID=1937960 RepID=A0A2C6CLN5_9BACT  ali  15  1...............................................MLSDRFQRKHTYLRLAVTDRCNLRCRYCMPAEGRQELLTYEEMLRLTGVLKRYGLKKVRLTGGEPLARRGVETLLRGLATQGL-----SIHLTTNAILLQPFIGLFQDIHVAGLNISLDTLQPERFKTITRRDEFSATWKNLLAALEA----GLPVKINCVFMRGVNDDELVDFARLTQ---HYPIDVRFIEAMPFNAGDG-NQDVYISAADIHARLLAALPNLKSAETNFHSAT-DRYTVPDWPGGIIPAYSRSRCGSCNRIRLTPQGELLNCLYATDGLQLRSILRAGGSDEDLI.. 290
34 0.000e+00UniRef50_Q8ZGW5 GTP 3`,8-cyclase n=2688 Tax=cellular organisms TaxID=131567 RepID=MOAA_YERPE  ali  17  1.............................................MVQLTDAFARKFYYLRLSITDVCNFRCTYCLPEGYRPDFLSLDEINRVSRAFALLGTEKIRLTGGEPSMRRDFTDIIATIRQ---NPAIRTLAVTTNGYRLVRDVAQWRDAGLTAINVSVDSLDPRQFHAITGQDKFYQVMQGIDAAFDAGFD---KVKVNAVLMRDVNDRQLSAFLDWIKP---RPIQLRFIELMETGEGGNLFRKHHVSGGVIRQQLLEQGW--QQQDRARSDGPAQVFHHSDYQGEIGLIMEKDFCASCNRLRVSALGNLHLCLFGEQGITLRDLLGS.......... 286
35 0.000e+00UniRef50_A0A2N2JLH5 GTP 3`,8-cyclase n=1 Tax=Deltaproteobacteria bacterium HGW-Deltaproteobacteria-14 TaxID=2013741 RepID=A0A2N2JLH5_9DELT  ali  15  96................................................LVDGQRRVVRYLRLSVTDRCNFRCQYCMPEEGKAGILDFDEATRVVRAFAALGINRVRLTGGEPLLRRDFPELVRRIA---AVPGVEDLALSTNGFLFAPIARELRAAGLKRVNISLDTLRADRFASITRTGDLGRVLDAVAAALAEGYA---PVKLNAVVLRGFNEDELGGLVRYAGATGAL---LRFIEYMPIGVDGFWSDHTFMSTDDMIARLSEEFVVHEPRVGVVGGGPARYATVV-PKGGFISALSHNFCSSCNRVRVTATGALQECLAFPGTLSLRDLMRSGASD...... 394
36 0.000e+00UniRef50_A0A2N6BU18 GTP 3`,8-cyclase n=2 Tax=Desulfobacteraceae TaxID=213119 RepID=A0A2N6BU18_9DELT  ali  14  9................................................LVDRYDRNLNYLRVSITDRCNLKCLYCMPRESHREILSYEEILRVVKVGAALGISKIRITGGEPLVRKGVY---RFLSQLTRMEGLQDISLTTNAVLLKDNISKIRSVNIKRINVSLDTLNKAKFKHITGYDFFDQIWEGIHLARKMG---FYPIKINVVPLKGINDDELVDIAGLSIK---YPFHIRFIEYMPMGSSQISSDRHLL--APEIKERIHRLGKLIPVDRSLNDGPAERFKLESAQGGFIRPISQHFCSTCNRLRLTASGQLRPCLMSDDQEDLKSLLRQCSDAEI.... 299
37 0.000e+00UniRef50_A0A2D6EU43 GTP 3`,8-cyclase n=1 Tax=Desulfobacter sp. TaxID=2294 RepID=A0A2D6EU43_9DELT  ali  15  2...............................................KLIDTYNRHIDYLRISITDHCNFRCFYCTPFSGKSKILSYEELLKVSEAAVSAGITKIRITGGEPLVRKGVVEFCRMLSNIK---GLRSLTLTTNGLLLKEMAASLFEAGIRRINVSLDTLKPERFQKITGYNLLSNVLAGIKKAEEVGMH---PIKINMVVMRGINYDEIEEMVNITFK---KPYHVRFIELMPTEGWDFEHHKSLFIPLEEVMKRIGEIGKIQIEPAKNSNGPAKIYVLPGAKGGFISPLGRHFCGACNRLRLTADGNLRPCLFSKNEIDIKRLLRDGAALETLAD. 297
38 0.000e+00UniRef50_K0N530 MoaA: molybdenum cofactor biosynthesis protein A n=15 Tax=Deltaproteobacteria TaxID=28221 RepID=K0N530_DESTT  ali  16  5.....................................................NRTINYLRISVTDRCNFRCRYCVPSTPHEKIARYEEILRITRLACELGITKVRITGGEPFVRKNIF---SFLKKLCAIESLKDISITTNGSLLTEKIKELISFGIKRLNFSLDTLDPAKFAVITGRDRFNQVRNAIFTAHELGIS---PIKLNAVILKGINDDEIEKLTALTIK---YPFHIRFIEYMPMGDSAV-EKQQQILSDEIKEKIESEFGKLLPVQRTGNDGPAKKFQIDGANGGFITPISSHFCSECNRLRLTSRGTLRPCLLNNYEKDIIDPLRNGASDNELKE. 294
39 0.000e+00UniRef50_A0A1V4SJ35 GTP 3`,8-cyclase n=2 Tax=Ruminiclostridium TaxID=1508657 RepID=A0A1V4SJ35_CLOHU  ali  15  1.............................................MKILIDKYGRKIDYLRISVTDRCNLSCIYCIPKCGEEEMLSIKEIVSFVKVAASHGIRKIKITGGEPLLRKDIAALVSCITE---IDSIMDISMTTNGVLIKKFASELKRAGLKRLNISLDSLCSDKYKEITKYGELKDVLTGIERAMELGFS---QIKVNTVIIRDINLDEILDFVHFSTETG---IAVRFIEYMPTKNSLDGYAKKFVSADEMRFLCNEAYSLLPAAV--DGNGPAKYYVIPGTNGGFISPLSCKFCSDCNRIRLTSDGRLVSCLYTQEWVDIKNSLRKGPDIDEVTE. 296
40 0.000e+00UniRef50_A0A1G1DES4 GTP 3`,8-cyclase n=2 Tax=unclassified Nitrospinae TaxID=1449243 RepID=A0A1G1DES4_9BACT  ali  15  1.............................................MNPLIDKYNRRIKYIRISVTDRCDLKCLYCTPKDSDSYILRFEEITRIVRCFADLGVSRVRITGGEPLVRKDVVSLIGQLSNIK---GIEDLAMTTNATLLSKYAIDLKNAGLKRVNISLDTLKSETFKMICGGGKLKDVLEGIRGAVNIGL---TPVNLNTVVMKGLNNNELIDIVHFAIENMA---NIRFIECMPVRRIVNLSKERFVSVKEI-KSLIESHFELEPAES-SGGGPASYFTIKSAKIGFISPITQHFCKSCNRVRLTAEGILKLCLAYKDGIDLRDYIRSGISDE..... 298
41 0.000e+00UniRef50_A0A2N1QX30 GTP 3`,8-cyclase n=3 Tax=Synergistetes TaxID=508458 RepID=A0A2N1QX30_9BACT  ali  18  1.............................................MDRLIDDFGRNLNYVRISVTDRCNYRCKYCMPAEGHSEIMRYEEISFLCRVLWELGVRKVRFTGGEPLVRRD---LVSFLKELNGEFPEMKTALTTNGSMLGQYAEELAEANLHSLNISLDTLDPVKFADVTRLGNIENVISGIRAAVRAGIR---NIKLNTVLIRGFNDGEIGDLMAFAKREKVL---LRLIEFMPL-EDDVWNEDAFISGEEILKMLPEGDSWQAEKPDSAQAGPAKYYRNEGDSIGIITAVSNHFCKYCNRLRVSATGKLRTCLFAPVEIPMR............... 283
42 0.000e+00UniRef50_UPI000C084FF6 GTP 3`,8-cyclase MoaA n=1 Tax=Anaerococcus sp. Marseille-P3625 TaxID=1977277 RepID=UPI000C084FF6  ali  16  1................................................MKDQFNREISYLRISVTDRCNFRCKYCMGEEGHKDILTFEEIYEIVQIMTDLGVKKVRITGGEPFVRKNIMNLIEKIASIKA---LEDIGITTNGSLIYDKLERLKEIGVNRINFSLDTLKEDKFKKITKSCDFDKTIRSLEKALDL----GFKVKINTVLIKGFNEDEIDSFINLTKD---RDIEVRFIELMPIGQAKDFDKENFMGNQDILKAYSYKDLGYK--------GVARNYQIDGYKGGLISPLSNKFCKDCNKIRLTSDGKLKACLHSADEINIKGLSKEEKKEQII... 284
43 0.000e+00UniRef50_A0A2E8GJX5 GTP 3`,8-cyclase n=65 Tax=Bacteria TaxID=2 RepID=A0A2E8GJX5_9ACTN  ali  16  5...........................................IHERDLVDPFGRTVRDLRISVTDRCNFRCQYCMPAEGRKDILSFEEIERFARICVRFGFNGIRLTGGEPLVRAXXPELVERLAGLGV-----DLALTTNGAXLRLHAXALVAAGLXRINISLDSLXRERFTELTRRXELDRVXDGVDAALEAGLQ---PIRINVVMMRGINDDEIVDFANY---GREKDVTVRFIEFMPLDAGDVWTDRLVVPADEIIKTIGEAFP---IEPVERGNEPAERWRYSDGNGGVIASVTKPFXGNCDRVRLTAEGQFRTCLFAVDEFDMRSLLRSEANDE..... 296
44 0.000e+00UniRef50_Q44118 GTP 3`,8-cyclase n=1179 Tax=Bacteria TaxID=2 RepID=MOAA_PAENI  ali  14  13................................................LVDRYGRRATDMRLSLTDKCNLRCTYCMPAEGKQAVMSASEIVRIVGIGVRLGVRELRLTGGEPLVRHDLVDIIAELRRNHPELP---ISMTTNGVGLAKKVAPLKAAGLTRINVSLDSLHEETFTKLTRRPFLDQVLAGVDAAWAAGLG---PVKLNAVLMRGINDAEAPSLLAWAVERG---YELRFIEQMPLDADHGWTRRNM-ITAAEIRDLLSTDFVLTPDPRARDGAPAERFRVAGGTVGIIASVTEPFCSDCRRTRITAEGRIMSCLFSREEFDLLVLLRSGASDDDL... 316
45 0.000e+00UniRef50_A0A2A5D1T7 GTP 3`,8-cyclase n=1 Tax=Gammaproteobacteria bacterium TaxID=1913989 RepID=A0A2A5D1T7_9GAMM  ali  15  2........................................NNISTNTKYVDPFGRSIDYVRLSVTDRCDLRCFYCMPKEEPEDWLTFDEIERVISAFASLGIKRVRITGGEPLVRKNLADL---TTRLSKVSGVEDMSLSTNAVKLAKHAQALYDSGVQRLNVSLDCVDTDKFREITGGGKLEKVIAGLMAAKKAGFS---PIKINMVLMRGINDDQVFNMIDFCSE---HNFVLRLIETMPMGITGKEATLRYIPLDEIKAQIAERYEMLPAVQ--RGAGPARYMSIPNINIGFITPISQHFCDTCNRVRMGVNGTLYLCLGQEHQYPLRDILRGGVTDEEL... 300
46 0.000e+00UniRef50_UPI000488A2D5 GTP 3`,8-cyclase MoaA n=1 Tax=Treponema sp. C6A8 TaxID=1410609 RepID=UPI000488A2D5  ali  17  1................................................MTDSFGRTINYLRISLTDKCNLRCRYCMPPQGHQEILTFEEITELVRVLAGLGVKKIRLTGGEPLVRRDIVSLVKL---LKDIPGIEEICLTTNGILFSELATDLKAAGLSRVNISLDTLNDDTFFAITGSRGVEKVLQSLKTALDL----GFPVKINCVPSQYN----ASELAEITLLAKSNPIDLRFIELMPIGCANGM---KGLKSDFILSELEEKFGKAAPL-KRQNHSPETLYHFDGFDGGFISPLSHAFCSDCNRIRLTASGLLKFCLCYDDALDVKKLLRSGES....... 283
47 0.000e+00UniRef50_A0A2A4P4E7 GTP 3`,8-cyclase n=180 Tax=Bacteria TaxID=2 RepID=A0A2A4P4E7_9SPHN  ali  14  1................................................MRDAFGRQIDYIRLSVTDRCNLRCTYCMAEDPRRDLLTFEEIEALARHLXARGVRRIRLTGGEPLVRKGIMDLVGRLARLRGD-GLQELTLTTNGTRLPDMAQDLYDAGXRRINVSXDTLDRERFAQLTRRDEFDRVISGIEAA----RAAGLXIRINAVAMRGLNDDELPALLXWCSERG---LDLGLIEAMPLGEVSLDRQSTHLPLDDVRAEI-ERXFTLVPSL-HRTGGPARYFDVAGTRLGLITPLSDNFCAGCNRIRIGATGTVYGCLGHDQKVELRDIIRAGGEE...... 288
48 0.000e+00UniRef50_A0A2D9N0I3 GTP 3`,8-cyclase n=17 Tax=cellular organisms TaxID=131567 RepID=A0A2D9N0I3_9BACT  ali  16  2...........................................KPSGVLQDTHKRIIRDLRVSITDRCNFRCAYCLPEKPRAQILTYEEITRMIRVASSLGVNKVRITGGEPLLRRNVESLIESIVAHGT---IDDLSLTSNGTHFPRLAKRLKDAGLSRITLSLDSLDRENFRKITGRDGLEDVLESIRLAKTLGL---TPVKVNAVIIRGLNDHEIGALAHFAVQXN---IVMRMIEFMPLDSGRAWQREHVVPGSEILEXVQAEI-XVAPLPAQHAAETASRWSLGDAELGIIAPVTQPFCGQCNRIRLTADGHIRTCLFSVHEHDLKPLLRNDSSDDKL... 321
49 0.000e+00UniRef50_F5YGQ6 GTP 3`,8-cyclase n=11 Tax=Bacteria TaxID=2 RepID=F5YGQ6_TREPZ  ali  16  1................................................MIDRYGRTIDYLRISITDRCNLRCLYCMPAEGHGEILSFEEILRLCTVMAGIGIRKVKITGGEPLVRKDVGNFI---RSLRAVPGIEQVTLTSNGLLLESFLAENPALSLGGINVSLDTLDPELYSRITRYPGRDQGIPSILRALDLAEERGIPVKLNCVPLRGLNEAELPAIAALAKKAGRA---VRFIELMPLGSANELEP---IPGNEVAALLERAYGKLISYHGRLGNGPAEYFSLPGFAGGFINALSEGFCECCNRLRLSSGGMLIPCLSSESGTDLRRLLRSGVSEDEL... 297
50 0.000e+00UniRef50_A0A1V6M0X0 GTP 3`,8-cyclase n=2 Tax=Candidatus Brocadia sapporoensis TaxID=392547 RepID=A0A1V6M0X0_9BACT  ali  15  1................................................MIDKYFRRINRLRISVTDLCNLRCIYCRPESGHKDILTYEEIVAVVQHAVKLGIKSFRLTGGEPLFRKNIENL---LWMLGNVHGIEDLAMTTNGIYLKNYTKVLKAIGLFRLNISLDSLDKSKFEVITRGGKLKDVLDGIDEVLHLGFK---NTKINVVAMKGVNDNEFEEFAKLTLDRN---LEVRFIEYMAMNKKSLDSEDKYIPMANIIDILGKRNELKALAPPMLGSGAAKLYKINGARGGFVSAVSQPFCNSCNRLRLTAEGKLRSCLLSGGEVDLKTILRN.......... 286
51 0.000e+00UniRef50_A4BPZ7 GTP 3`,8-cyclase n=23 Tax=cellular organisms TaxID=131567 RepID=A4BPZ7_9GAMM  ali  17  20.........................................ATRQGDVLVDRFGRSKRKLRLSLTDRCNFRCGYCMPEDPRHELLSFEELLGIAQLFVRMGVTNIRLTGGEPLVRRGVPAFIERLNELRP-LGLERISMTSNASLLDRHAAALVKAGLDDVNISIDSIDPERFRQMTGGGELEPVLRGI----RATRDAGLSMKLNAVAIRGENEDDVVPLTQWAMGEG---ISLRFIEFMPLDARGGWQPNKVF-TEDEIITALKQHFIVEQLPRTR--EPATYYRMDGYRLGIISTISNPFCGSCDRVRVTSTGEIYPCLFSPVCTDLKTPLRSGASREEL... 316
52 0.000e+00UniRef50_A0A1L8CQH1 GTP 3`,8-cyclase n=5 Tax=root TaxID=1 RepID=A0A1L8CQH1_9PROT  ali  16  18................................................LYDRFDRQLTYLRISVTDRCNMRCDYCRPAEPHGQILRYEEIEHITRLAAELGVSKVRITGGEPLVRRDLLKLIE---KLAAIPGITDLSITTNATLLAKYADDLAMAGLNRINISLDSLNALRFRKLTGA-ELAPVLKGIEAAKKAGL---TPIKLNTVLMRGINASEVAELIDFAI---CCDATIRFIELMPMKQGLDWD-KHYISIDEVLAEDDVRQRIDLEAVAESQNTAASYLPLKNSKVGFITPMSERFCDDCNRLRLTADGHLRSCLPAESELNLRDLIRSGGSDD..... 311
53 0.000e+00UniRef50_P9WJS2 GTP 3`,8-cyclase 1 n=220 Tax=Bacteria TaxID=2 RepID=MOAA1_MYCTO  ali  13  19.................................................KDRCRRMMGDLRLSVIDQCNLRCRYCMPEEPRQDLLSVKEISAIVDVFLSVGVSKVRITGGEPLIRPDLPEIVRTLAKVGEDSGLRDLAITTNGVLLADRVDGLKAAGMKRITVSLDTLQPERFKAISQRNSHDKVIAGIKAVAAAG---FTDTKIDTTVMRGANHDELADLIEFARTVNA---EVRFIEYMDVGGATHWAWEKVFTKANMLESLEKRYGRIEPLPKHDT-APANRYALPDGTFGIIASTTEPFCATCDRSRLTADGLWLHCLYAISGINLREPLRAGATHDDLVE. 314
54 0.000e+00UniRef50_A0A1Y1SGF4 GTP 3`,8-cyclase n=1 Tax=Oceanococcus atlanticus TaxID=1317117 RepID=A0A1Y1SGF4_9GAMM  ali  15  1...............................................MLTDSFGRGHRKLRISITDRCNFRCPYCMPEKPRKALMSGDDIVAMARVFVELGITNLRITGGEPLLRRDVVDIIAGLNTLR-GEGLKRLSMTSNAAQLARHASALSQAGLQDINISLDSLNPDQFQRLRGRYGPADVIAGIEAA----RSAGLGVKLNGVIIRGYNDDQILPLLNFAET---HAVELRFIEFMPLDDEALWSRDRVVSAADILNTVGQFHA--VEHLPEDG-APARRYRLAGQQFGIIATVTQPFCARCDRLRITADGRLYTCLFGREGTLLRGL............. 282
55 0.000e+00UniRef50_A0A1Q9K1Z2 Cyclic pyranopterin phosphate synthase MoaA n=1 Tax=Anaerostipes sp. 992a TaxID=1261637 RepID=A0A1Q9K1Z2_9FIRM  ali  17  1................................................MKDNYGRKIDYLRISITDRCNLRCTYCMPEEGHDEILTYEEIEIICRMMAKIGLKHVKITGGEPLVRKECWRLIE---KLKQVPGIETVTLTTNGILLEEMAERLVQAGVDGVNISIDTLNKDAYAAITRGGNIDQVLKGLEAI---CTYPQVTVKINCVL----NGEDWKETVSMAQIARTKSVHVRFIEYMPTVFGGEEQRR----TQEQVKEVLEEVFGKMKECKEEGFGPSDYYQLDGFQGGFISAVSHKFCENCNRIRLTADGKLRLCLQSADMVDLKTLIRQGRKLEL.... 291
56 0.000e+00UniRef50_A0A250F786 GTP 3`,8-cyclase MoaA n=17 Tax=Flavobacteriaceae TaxID=49546 RepID=A0A250F786_9FLAO  ali  17  2.............................................STNLTDAFGRKHTYLRLSITDSCNFRCLYCMPNEPSSKLMNSDEIFGISKIFVEFGINKIRITGGEPLVRQDFDEIIQKLATLNI-----SLGVTTNGVLLDRYFNLLKVHNVQHLNISIDSLDEERFKQITKRDLLPQVWENIMHSIDL----GFKVKLNAVIMRGVNDDELLPLVALSHR---YPIEMRFIEFMPFY-GNTWERGK-VISVNEMLNIIAKEYSYIKLVDEKHDTSRKYRLTEDSKGGFISTMSNAFCGGCNRIRLTSDGKMKNCLFGAEEFDLLNLYRQGKD....... 289
57 0.000e+00UniRef50_UPI000BE1F94B GTP 3`,8-cyclase, mitochondrial-like n=2 Tax=Varroa TaxID=62624 RepID=UPI000BE1F94B  ali  15  87................................................LYDNHKRLHNYLRISLTERCSFRCRYCMPKNGIS--LTPRDLLYLIDIFANLGITAVRLTGGEPLLRKDLVHIIRHIHT--NHPQIRKIGLTTNGLALDRNLDSLIQAGLTHVNISLDSLVPTKFEEITRRKGFEKILRAIFNAQQR-----LPTKVNCVVIRDFNEDEVPAFVEMTKD---HDLEVRFIEYMPF-DGNRWSFEKLVPQKELEKRIHRSVPDVHPLPLEPH-HTAKLFTSPAHRGGFISSMSQAFCSSCNRLRLTADGVLKSCLFSAKSLSLRDVLRK.......... 371
58 0.000e+00UniRef50_A0A173MHE3 Cyclic pyranopterin monophosphate synthase subunit MoaA n=8 Tax=Bacteroidetes TaxID=976 RepID=A0A173MHE3_9BACT  ali  14  1...............................................MITDSYNRVHDYLRISLTDLCNLRCSYCMPEEDYPQLMQPAEIAEIVKIFAAEGVTKVRLTGGEPLARKDFDDILFRLQQLPVKLTLTTNA-----TLLHRHIDQLLEAGVSSLNISLDTLQAPRFFSLTRRDRFFQTRENI----QLALQKGLQTKINMVVMKGVNEAEIPDFIEWT---RHSPIEVRFIEFMPF-AGNHWSGTQVF-SKQEILELVQQHYSITPLPVPPHS-TSTPYQIPGFQGSFISTMSTPFCAGCNRMRLTADGKMKNCLFSKEETNLLQALREGK........ 283
59 0.000e+00UniRef50_B2FUM0 GTP 3`,8-cyclase n=469 Tax=root TaxID=1 RepID=MOAA_STRMK  ali  17  1.............................................MSQLTDGFGRSFPYLRLSLTEACNFRCSYCLPDDGRPRFLQVDEIARLVRAFAALGMSKIRLTGGEPSLRKDLDEIIATVA---AVPGIRKVAITTNGTLLPRRLPGWHRAGLTALNVSMDSLQRERFKTITGHDRLPE----IEQGLALAQALGLPIKLNAVLLRGLNDDELP---QWMDYLRGRPFSVRFIELMRTGDNEAYFQRHHLRADVVIEQLLAAGWHERPRAAD--AGPAREFGHPDHRGGIIAPYSRDFCKGCNRLRVTAKGDLRLCLFGEFGVPLR............... 281
60 0.000e+00UniRef50_A0A2E1H354 GTP 3`,8-cyclase n=6 Tax=Bacteria TaxID=2 RepID=A0A2E1H354_9BACT  ali  16  26..................................................DTLNRPQHSLRLSVIDRCNFRCDYCMPQDPKEDILSFEEMGRLARVFVKAGGRKIRLTGGEPLLRKDLSLLVE---ELAAIDGLQELALTTNGYLLEEHAQSLKDAGLQRLNISIDTLIAERFVRLCKVDGLQNTLRGISAAASAGFE---KTKLDMVVIRGQNCDELIAMLEFAQSQKV---QLRYIEYMDVGGALNWHEDKLMTASEMLETLSQYFGDIETVDAVSASAPAKVYRLAGYEFGIIASMSKAFCADCDRSRVTADGNWYSCLYATSGNNLLDAIR........... 307
61 0.000e+00UniRef50_H1XTW8 GTP 3`,8-cyclase n=1 Tax=Caldithrix abyssi DSM 13497 TaxID=880073 RepID=H1XTW8_9BACT  ali  14  5.......................................QPSLKPASVLTDPYGRILNYLRIALTDRCNLRCTYCMPAEGHEQIMRFEEILRLVQIMLPYGLRKIRVTGGEPLVRRGT---ISFLQKLRQVGPELQIHLTTNGVLLEDYFKELVEISISGVNLSLDTLNPQKFKKITRHDSFVKVW----RALQQVLDSNIPLKLNMVVQRGLNEDEIIPMAELA---RQHSLEVRFIEQMPF-DGLSRKIERPFTGEEILQTLRTAFGTLESTKKQ--NGTAQLYKIPGFKGGIISGYSRTFCSDCNRLRLTSTGVLKTCLYDRGSVNLKDLMRAGYDDARLL.. 303
62 0.000e+00UniRef50_A0A149R4B6 GTP 3`,8-cyclase n=43 Tax=root TaxID=1 RepID=A0A149R4B6_9PROT  ali  15  5................................................LVDPAGRRISYLRVSVTDRCDMRCTYCMSERPRADVLDFEELLRLCQVFVKHGVKRLRITGGEPLVRRDIETLGQWLHHPEQAGSLDELTLTTNGSRLALYAETLFRAGVRRVNVSLDTLDEERFASITRRGKLAATLDGIKAA----RDVGMAVRVNAVAMAGVNDDEFDAMLAWCGEIGA---DLCLIETMPMGDTGEDRTARYLPLSEVKADLAKR-WTLEPL-ADRSGGPARYMRVAGQRIGFITPMSHNFCSTCNRVRLSCTGQLYTCLGHEDGVDLRAILRSGGDD...... 297
63 0.000e+00UniRef50_A0A2G1QQ97 GTP 3`,8-cyclase n=5 Tax=Bacteria TaxID=2 RepID=A0A2G1QQ97_9RHIZ  ali  14  10..................................RSIPLTTPARSQPTLTDTFGRAITYLRLSVTDRCDLRCTYCMSEHPRKDVLSLEETYRLAETFMRLGVRKLRLTGGEPLVRKNIMTLLAQLKPHLEARDLDEVTLTTNGTLLARYAAALKQNGVTRVNVSLDTLDPDRYRAVTRWGDLARALSGVDAALA----EGLSVKLNAVVQKGLFERDAADLIAFAHGRG---MDLTFIEAMPLGGALDDYGANHLPLTE-AEAWLRARYTLTPVTKKTG-GPARYMRVTGGLIGFIAPLSCNFCASCNRMRVSCTGQLFPCMGDDGAVDLRAALRGGE........ 310
64 0.000e+00UniRef50_A0A1T1BSS3 GTP 3`,8-cyclase n=62 Tax=Bacteroidetes TaxID=976 RepID=A0A1T1BSS3_9FLAO  ali  14  3...........................................PSKTILTDDFGRKHNYLRISLLEKCNLRCTYCMPADGKASLMTADEIFAIAQTFVENGVDKIRLTGGEPLLRKDFPEIISKLSTLE-----TSLSITTNGILIDRHIDVLKQAGVKKINLSLDTLVASKFHSITLRNQFEKVIDN----LHLLLNNNFQVKVNVVLIKGFNDNEIVDFINLTESL---PISVRFIEFMPF-AGNEWDRIKMVSQNEILSQVETCFYKIQKLEDEKNF-TARTYKIKGFQGDFISSITNPFCDSCNRIRLTANGKIKNCLFSNSETDLLTAFRNGESITELIS. 299
65 0.000e+00UniRef50_A0A060I7R2 GTP 3`,8-cyclase n=13 Tax=Alphaproteobacteria TaxID=28211 RepID=A0A060I7R2_9RHIZ  ali  14  19..............................................RPMVDPFQRAITYLRFSVTDRCDFRCTYCMAENPKKDLLTLEEMNRLCSAFIAKGIRKLRLTGGEPLVRKNVMHLVRELGK-QIGSGLDELTLTTNGSQLARFADELYDCGVRRINVSLDTLDPDKFRQITRWGDFHRVMKGIDAA----QNAGLKIKLNAVALKDFNDVEMPDMIRFAH-GRGMGLTV--IETMPMGEIEEDRTDRYLPLSKLRVDLEKQF--TMREIDHRTGGPARYVTVEGGRLGFITPMTHNFCDSCNRVRLTCTGTLYMCLGQNDAADLRSMLRATEDD...... 308
66 0.000e+00UniRef50_A0A252F316 GTP 3`,8-cyclase MoaA n=1 Tax=Butyricicoccus porcorum TaxID=1945634 RepID=A0A252F316_9CLOT  ali  16  1................................................MKDGYGRTIDYLRISITDRCNLRCTYCMPEEGHGDILTYEEIETICRAMAQIGLKHVRITGGEPLVRRQCWRLVKKLRR---VPGLQTVTLTTNGILLEEQAQQLVAAGLDGVNISLDTLDAAVYRSITRCGDVSRVLAGLEQMQKY---PQVTVKLNCVLGGVQWEQTAVAVAGLAKR---CPVHVRFIERMPLAEEDTQSCAQ----DDVLAALEAVYGAAQPCEKPMGFGPSTYVQFAGFLGGFISAVSHKFCADCNRIRLTADGKLRLCLQSDRMVDLRALVRGGRTAELI... 289
67 0.000e+00UniRef50_A0A1Z8SU64 GTP 3`,8-cyclase n=1 Tax=Planctomycetia bacterium TMED53 TaxID=1986839 RepID=A0A1Z8SU64_9BACT  ali  14  1...............................................MPRDGHGRIIDYLRISVMDRCNLRCSYCMPLEGEDQLLTAAEIQMVVEAAVNCGFRKFRITGGEPTLRKDLLQIIGGMRSVAPDA---DIAMTSNGILLPGLAADLKKEGLDRVNIHLDTLDDQRLRQIMRLADLDKIMAGIEAASDAGL---TPIKLNSVVVRGVNDMDVVEMARLTID---RPIHVRFIELMPFGSGEPEEQQKVVPSADSHSSIESALGDLTPVPAKDPSDESRNYQLKNAVGGFISPVSDPFCAFCNRVRLSAEGKLLLCLLRDDEADLRSVIRSG......... 290
68 0.000e+00UniRef50_A0A0P0C5R1 GTP 3`,8-cyclase n=8 Tax=Bacteroidetes TaxID=976 RepID=A0A0P0C5R1_9BACT  ali  14  3.............................................ESLLIDKYGRQLSYLRLSVTDRCNFRCYYCMPEEGRQELLSFEELYQLSALFCSMGVNKIRITGGEPFVRAG---IIPFLRKLSQIPGLEEITVTSNGTLNQKQIKALQEIGIRKINISLDSLDRERFFKITRRDSFDSVFASIFS----LMESGFDIKLNCVVAENKNIQDIVPFVELTKD---RPIAVRFLEEMPFNGSSTFGTPQW-SHREIYQHITNHYPTLEKLQSE-ASSTSVNYKVPGYAGGIIPSFSRTFCGTCNRIRLGATGELRTCLYGPPATNLRDVIRSGNTTE..... 293
69 0.000e+00UniRef50_A1B4A2 GTP 3`,8-cyclase n=37 Tax=root TaxID=1 RepID=MOAA_PARDP  ali  15  15...............................................PLIDPFARPITYLRVSVTDRCDFRCTYCMAEHPKRDLLTLEELDRLCSAFVGLGVRKLRVTGGEPLVRRNIMEFFRAMSRH-LGAGLDELTLTTNGSQLARFATELADCGVRRVNVSLDTLDEDRFARITRWGRLPQVLQGIEAA----KAAGMRVKINTVALKGFNEDELFRLVGWCADQGH---DLTFIEVMPMGEMGEEERLDQYWALSDLRDRLGERFTLTPL-AERTGGPARYVRLDGQKIGFITPLTHNFCESCNRVRITCTGELFMCLGQEDRADLRAPLRAGAED...... 304
70 0.000e+00UniRef50_A0A2G2F9H8 GTP 3`,8-cyclase MoaA n=4 Tax=Bacteroidetes TaxID=976 RepID=A0A2G2F9H8_9FLAO  ali  15  9.................................................IDKFGRVHDYLRISLTERCNLRCFYCMPEEGKANFMTSEEVLGIAKTFVRLGVKKIRLTGGEPLIKKDAKHLLLELGKLPV-----ELAITTNAVLVDQFIETFKEAGINSVNVSLDSLEEKSFNAISRRNYFDR----IKANIDLLIKNDFHVKINVVVIRNLNEHEIPDFISWTKNEN---IHVRFIEFMPF-DGNQWNWDKKVSYKEIMQIAKDRFGEKCIFKIEDKNDTARNYRLIDGEGGVISSVTNPFCDTCNRIRLTADGKIKNCLFSQDETDLLTAYRKEKDIETLI.. 298
71 0.000e+00UniRef50_A0A1C5VA78 GTP 3`,8-cyclase n=5 Tax=Clostridiales TaxID=186802 RepID=A0A1C5VA78_9FIRM  ali  17  1................................................MKDNYGREITYLRISITDECNLRCLYCMPEAKDSSLMSADEIVEITAEAVKLGISKVRITGGEPLIRPDVIDICRRISSL---PGVKELAVTTNGMLLKDLAYPLKEAGVSRLNISLDTLQTEKYTKITRKGNFQDVAEGIRLAAKAGL---TPIKINTVLIGGFNDCEIRDFGELTRTDNV---EVRFIELMPIGACAAFPKHAFVKGDIVLREI-------PELVEAENSGVARMYQYPDGCGGIISAVNQHFCLSCNRIRLTCDGKIKPCLHSKEEVLVKGL............. 276
72 0.000e+00UniRef50_A0A0B0I0V7 Multifunctional fusion protein n=1 Tax=Paenibacillus sp. P1XP2 TaxID=1472719 RepID=A0A0B0I0V7_9BACL  ali  15  300..................................................DYFKRALRDLRISVTDRCNFRCRYCMPEEPRESVLSVDETVRIARIFARLGVRKMRITGGEPILRKELPEIIRGIA---AIEGVQDIALTTNGSLLAKQAAKLREAGLMRVAVSLDALDDETFMAMNGGKASRQVLEGIDAAADA----GLAVKVNMVVQKGVNEHALLPMVRYFREKGH---ILRMIEYMDVGNTNGWDL-KHVVSKKEMLERIGAEFPLEPAAPNYAGEVASRYRFADGKGGIISSVSDAFCQSCTRGRLSADGMFYTCLFATKGHDLRTLLRSDVSDE..... 591
73 0.000e+00UniRef50_A0A2M7W8D9 GTP 3`,8-cyclase n=2 Tax=Proteobacteria TaxID=1224 RepID=A0A2M7W8D9_9PROT  ali  16  17................................................LIDPFGRKIGYLRLSVIDRCDLRCRYCLPERGKDEMLPGEQMVAIARAFMDLGVQHIRITGGEPLLRPDLLD---WLPEIGRDRRLRDLSLTTNATHLAEKADALRASGVKRLNVSLDSLRRPVFADVARRDRLPQVLEGLVAAKRAGFE---RIKINTVVMRGVNDDQIPELIEFCAQHGH---TLRLIETMPMGVEGFDAAAHALPLTELEQQLAAR-YTLEPVVLGSGAGPARYFRVVGTVIGLITPLSRHFCESCNRVRVSAKGELFLCLGQEDRADLAGALREGGTA...... 305
74 0.000e+00UniRef50_A0A2E1CEB1 GTP 3`,8-cyclase n=34 Tax=Bacteria TaxID=2 RepID=A0A2E1CEB1_9ACTN  ali  15  5................................................LTDLFGRVHKDFRISVTDRCNFRXQYCMPEEGREELLSFEEITRITKIXVEYGIXSVRLTGGEPTLRANLSDXISMLSXLPI-----EIALTTNGISLDKNAHNFRSAGLHRVNISIDSLKAERFKEITLRDDMKKVITGIEASIEAGLS---PVKINVVVMRGINDDEIIEFAKF---GRERXVIVRFIEFMPLDADEKWSTLSVVSLXEIFSTINSVYPL---EVVKRSNAPASRFRYXDGQGGIVASVTQKFCDTCDRIRITADGQFRNCLFSNEEFDLKEALRSESXDKEICE. 295
75 0.000e+00UniRef50_J9HIK1 Molybdenum cofactor biosynthesis protein A n=1 Tax=Oxytricha trifallax TaxID=1172189 RepID=J9HIK1_9SPIT  ali  12  1........MNIFSRYFSSATKEQQSLIDLSNNNLQQSHEMSHQEDQSILTDTFKRKHDYLRISLIEKCNFRC----------------QVNRIIDIFTQVGVNKIRLTGGEPLVRKDLIDIV---HDIKSRPQIKTIAMTTNASLLPRKIERLREAGLNQINISLDTLVEAKNQFITRRGGFQQTLKAIDMALNLDFEA---VKLNVVAMKGFNEDELCDFVEFVKD---RAMEVRFIEFMPF-DQNDWNNKKLLPYFQIRKLIEDKY--KLTRNQDGPHATSKTFSIEGYKGGFISSMSEHFCGGCNRMRITADGNLKICLFDNREINLREMIDQGMSDSDIL.. 311
76 0.000e+00UniRef50_W0RIC2 GTP 3`,8-cyclase n=11 Tax=Gemmatimonadetes TaxID=219685 RepID=W0RIC2_9BACT  ali  15  15................................................LRDQFGRSIEYLRISITDRCNFRCVYCMPAAGREHTLSADEIARVVREVAPLGLRRVRLTGGEPTLRPDLERIVGLLRE---IPEVEDLSLSTNGVRFCQDARRLRDAGLDRVNVSADSLRPERVAEIARRDLG---FDAIAAAAVAEEAGLAPVKLNVVVIRGRNDDELEAFARLTLDRAWH---VRFIELMPVGESDRSPLELVVPSDEILARLARLGAALGRPLPGRGNGPAAYHRFDGAPGGVITPMTHTYCGSCNRVRLTADGRLRTCLYGDHEVPLREALRAGA........ 316
77 0.000e+00UniRef50_R6EJ78 GTP 3`,8-cyclase n=4 Tax=Firmicutes TaxID=1239 RepID=R6EJ78_9FIRM  ali  15  1................................................MQDGLGREIDYLRISVTDKCNLRCRYCMPPQGHAEILTLEEIFRLVGIMEQLGIRKVRLTGGEPMVRKNLPWLVEQIHGL---PGIREIAMTTNGTLFAPQAEIYREAGLTAVNISLDTLDPERFRCITGCDRADRAVDSVLRAIDAALEQQLRVKINCVPCVEMNGEDMEGIAALAAD---RPVDVRFIELMPIGCGKDYTG---ISSKEILSRLEKRFGAAIAVPGEKTDGPAEYYQFPGFCGGFISPISHKFCRECNRVRLTCEGRLKLCLHYDRGLELKPLLRSGALDEEI... 309
78 0.000e+00UniRef50_A0A2G6LA99 GTP 3`,8-cyclase n=16 Tax=Bacteria TaxID=2 RepID=A0A2G6LA99_9GAMM  ali  16  1...............................................MFIDGYQRKITYLRISVTDRCDFRCVYCMGEEPRANLLTLEEIARIGKIFVDNGTTKFRLTGGEPLIRKEVEWLIK---ELGSYPGVSQIGITTNGSQLRRVAPALKAAGTTKLNVSLDTLDADNFASITRTGKLSVVLDGIAAAQQAGLK---NIRLNAVIMRGKNEDQIIPLVDYA---RQHGLHLAFIEEMPLGDISHNRQKTYIDSQMIRHKIHARYPLIKSLLKDDENGPADYWLFQDGKIGFISPHSCNFCADCNRLRLTVEGRLLLCLGHEDSINLRAMLRGGKSDKEI... 295
79 0.000e+00UniRef50_A0A1F9U2H5 GTP 3`,8-cyclase n=2 Tax=unclassified Elusimicrobia TaxID=1797919 RepID=A0A1F9U2H5_9BACT  ali  19  4..................................................DGLRRRVSYLRVSLTDRCNLRCRYCMPNFPKDSLLDLEELKRLLKVFRDMGMTKIRLTGGEPLLRPELEEILSEIIRL----GIEDVSLTTNGVLLSHRVQSLVAAGLKRVNISLDTFQAERFHKITGMAALDRVLRGIWDTVDAGLE---PVKINMVVMREWNLDEVEEFALFAKRA---PVEVRFLELMPFEGTAGADPDSFVSADEIKMRIER----VVTLGAEEPCGVAKVFPIEEGLGGFISPVSNHFCGSCNRIRLTARGALKTCLHGPDSADLRAALQGGADDTEL... 294
80 0.000e+00UniRef50_C3LA56 GTP 3`,8-cyclase n=1806 Tax=root TaxID=1 RepID=MOAA_BACAC  ali  16  7..................................................DKLQRPLKDLRISVTDRCNFRCRYCMPEESNDKILSFDEIERITRIFVSLGVRKLRITGGEPLLRRGLPQLIERLNK---VDGVEDIGLTTNGSLLKKFAPDLYKAGLSRVTVSLDSLEEERFFYLNGRSKVQRVLEGIQAAAE----VGMKIKINMVVQKGKNEQDILQMAQYFKENKH---ILRFIEYMDVGNYNGWELKE-VVSKQEIVDMIHQVMPLERIEANYAGEVATRYSYIGSEIGVISSVTDSFCSSCTRARISAEGKLYTCLFASKGNDLRELLRDYTDEEI.... 300
81 0.000e+00UniRef50_A0A1F9GK97 GTP 3`,8-cyclase n=4 Tax=unclassified Deltaproteobacteria (miscellaneous) TaxID=122706 RepID=A0A1F9GK97_9DELT  ali  16  1................................................MIDSFGRTIDYLRISVTDRCNFRCVYCMPPEGHNDVLTFEEIARIARIFLQMGGKRLRITGGEPLVRKNIIELVFQLSNL---PGLESLGLTTNGFYLKEFAKFLKEAGLKKINVSLDSVRPSRFSELTGGQRAPSSFEKVWEGIEEALFVGLQTKINVVALKGISEEEILSFGEMAKRL---PVEVRFIEFMPL-CGTGWHPEWMIPLREIRNALNSN-FELLPLP--RGTEVAESYQVKKGRGGFISSMTEPFCKNCSRLRLTCDGKIRPCLFSNLEIDLK............... 295
82 0.000e+00UniRef50_UPI000D77909A molybdenum cofactor biosynthesis prote n=1 Tax=Pseudomicrostroma glucosiphilum TaxID=1684307 RepID=UPI000D77909A  ali  17  43....................................................FSRKHTYLRLSLTERCSFRCVYCMPPSGKPHLLTTPEVMRIAKAFVEMGVKKVRLTGGEPLLRKDVAEIV---RKLRDDLDVREIGLTTNGLVLERMLPELVSSGLTHVNISIDSLRHDRFAELSRMPG--KTLDKIMSAIRAALSIRLKIKLNVVVMKGRNDDEVADFVDLTKN---MDLDVRFIEYMPF-FSNSWSTSLLVPSSDLLSSLSARHSNIERHV-DSANDTTRHYTIPNHRGGFISSMTDHFCGSCNRVRVLADGGMKVCLFGDGEVSLRDAIRDGEDADLPL.. 354
83 0.000e+00UniRef50_A0A2G0CIM5 GTP 3`,8-cyclase n=2 Tax=Lewinella TaxID=70994 RepID=A0A2G0CIM5_9BACT  ali  15  1...............................................MLIDQHGRQLTYLRLAVTDRCNLRCRYCMPEEGREALLNYDEILTLCGVLADMGITKVRLTGGEPLVRRDLPVLVRGLGEL-----FPRLAMTTNGILLPRYLDELAAAGLTTYNISLDTLRPERFFRITRRDNFTETL----AALDLVLDRGYRAKVNVVVMRGVNDDELLDFVELT---RDRPLDVRFIEAMPFNDDDG-NHDVFLSYDAMLRQLLETYSTLEQTTAQGGS--AVTFTVPGYRGKVIPAYSRSLCGSCDRLRLTPRGTMLNCLYSTQGLEL................ 275
84 0.000e+00UniRef50_A0A1Q7SQG0 Cyclic pyranopterin phosphate synthase MoaA n=3 Tax=unclassified Archaea (miscellaneous) TaxID=93506 RepID=A0A1Q7SQG0_9ARCH  ali  17  8...........................................PRPKLLVDTKGRIAAKLRISVTDRCNFACLFCMPDKPSADLLSFDEIERVTRVFVSMGISKVRITGGEPLLRNGVEELVK---QLTGIDGLESVDMTTNGWFLGSRAQALKAAGLRGVTVSLHSLKEDRFAKVSGMNALPRVLESISEAIRVGLR---PLKINSVAIRGYNEDEILDLVNYARKLNVA---IRFIEFMPLDGLDIWDRDKMVTGQEILETVRSRY---SILPAGRGNGTASIWKFADGRGGVITPMSEPFCDDCDRLRLTSDGKLLSCLFDTEYHDLKPILRNGEDDEKL... 304
85 0.000e+00UniRef50_A0A1Y4L991 GTP 3`,8-cyclase n=1 Tax=Lachnoclostridium sp. An181 TaxID=1965575 RepID=A0A1Y4L991_9FIRM  ali  17  1................................................MQDQYGRVIDYLRISVTDQCNLRCVYCMPREPKDELLTDEEIVRLCRIFADIGISRIKFTGGEPLLRKGLADLV---FRIGQIPGVKEMTLTTNGVLLKDQIGALYQSGISSVNISLDAAQKEHFSSIAGIDYFEQVMEGFEEA----KKYPMTVKINCVLARELNEGQWLSLAEYAKDAKV---DVRFIEMMPIGTGKQYTSGGQ---DELLARIKERYGDVEE-QKEKGNGPAIYYKVQGFLGGFISAMSHKFCSQCNRIRLTADGVLKPCLQYESHVELKRMLRQGRTEHELTE. 291
86 0.000e+00UniRef50_A0A2M8BZW2 GTP 3`,8-cyclase n=2 Tax=unclassified Deltaproteobacteria (miscellaneous) TaxID=122706 RepID=A0A2M8BZW2_9DELT  ali  16  47................................................LSDRYSRRVEYLRVSLSDRCNLSCRYCRPSTPRSEILSFEELTRLVAVFASGGVSRVRFTGGEPTLRRELTHLVSSIA---AIDGITDLAMTTNAVLLESLAEPLYAAGLRRLNVSLDTLKADRFHGLTAVGTFSKVLEGLGAAERAG---FPSIKVNTVVVRGFNDDELFDLVEWSFQRR---FPLRFIEFMPIGEATRWGPEAIVPSREIRSLLGTRFLLREELTRRMGAGPARYWQMDGWPVGFISAVSDCFCAGCNRARLTAEGRLRVCLADDVEVDLKGPIRAGATDDDLL.. 344
87 0.000e+00UniRef50_A0A291GZ82 GTP 3`,8-cyclase n=2 Tax=Actinobacteria TaxID=201174 RepID=A0A291GZ82_9MICO  ali  14  4.................RRISLGMPTPRRTDDTAAALPDVSDRPATPALADRFGREATDLRLSLTDFCNLRCTYCMPASGKDQLLSAEEVVRLVRIGVELGIEQVRFTGGEPLTRPDLEQIIAGVAALEQRP---DISLTTNAIGLDHRAARLREAGLDRINVSLDSVVSETFERLTRRPLLHRVLAGIDGARAAGLS---PIKINAVLLPGVNDHELPDLLDWCLD---RDLQLRVIEQMPLDADHIWERDTMVTAGDVQGMLAER-FLLAPVSEARDGAPAELFEVADGRVGIIASVTRPFCADCRRTRLTAEGRVRTCLFSREETDLRAALRSGADDE..... 330
88 0.000e+00UniRef50_C6C060 GTP 3`,8-cyclase n=89 Tax=root TaxID=1 RepID=MOAA_DESAD  ali  18  3................................................LTDKIGRTVNYLRLSVTDRCNLRCMYCVTKDPHPDILRYEEMLRLVDLAASMNISKLRLTGGEPFARKGFMDFISQVMDSHPEIDLR---ITTNGTLIEPLVPELKKIGVSRLNISLDTLDRETFKEVTGRDHLTDVLATI----SACLSAGIRVKVNAVAMKGINDRELNSFIDFA---RENPIDMRFIEFMPMGDDTKSDS-RFWSADDILEQGREYVNLIPVKRTAENRGPARMYSIEGGKGGLISPVSSHFCATCNRLRITSDGQLRTCLFSDKTYGLRDILRN.......... 285
89 0.000e+00UniRef50_R8W1Y2 GTP 3`,8-cyclase n=3 Tax=Butyricicoccus pullicaecorum TaxID=501571 RepID=R8W1Y2_9CLOT  ali  14  1................................................MIDRLGRNITYVRVSVTDRCNLRCRYCMPETGHEEILRFEEITEVVRALAQLGLRQVKLTGGEPLCRHDLPTLARM---LGEIPGIEEVTLTTNGLLLPGQAQALADAGISRVNLSLDTLRPDRYAEITRCGKLKDALSGLQAAQKA----GMRVKLNVVPVRGFNDDEIVDLVRF---GREHDCPVRFIELMPVGLGA---SRQGLSNAEVLDIIQKAMPGFTPFRGGKGNGPAVCYGWDGGVFGLIGAVHDRFCASCNRVRLTADGMLRLCLAQPDGLDLKPYLRDGKE....... 285
90 0.000e+00UniRef50_A0A2E7SU48 GTP 3`,8-cyclase n=3 Tax=root TaxID=1 RepID=A0A2E7SU48_9BACT  ali  14  25................................................LKDQFGRTFNYLRIAVNEICNLRCIYCMPEEGSKELLTSDEIIRFIKVAAGLGVIKIRFTGGEPLLRKGLVQLISDVS---NIPNIQSVHLTTNGVLLEGMAVELKGAGLHGINISIDTLDPDKYKMITRRDEVEKALKGLKAA----KEVKIPIKVNIVALRGFNDSEISDFVNLTK---HYPLTVRFIELMPFDAHQIWKTGKFFSAKQIINDLKQLFPNIKTSIGTATEH--SIFSVPGFKGKVIPSYSRDLCSACNRVRLTADGQIRNCLYAKNEYNVKELLMNGSTDNDIAD. 317
91 0.000e+00UniRef50_A0A1X7LC60 GTP 3`,8-cyclase n=5 Tax=Bacteria TaxID=2 RepID=A0A1X7LC60_9BACL  ali  17  18...............................................PLRDQWDRPLRDLRLSVIDRCNFRCSYCMPKEPPSELLSFDEMERLIRLFALLGVKKIRLTGGEPLLRQDLPRLIE---RLVVIPGIEDVAMTTNGVLLDRYMEELHQSGLRRLNISLDALDAELFKHMNGRGYPPT---RILHNIKEAKRRGFKVRVNMVVQRGVNDHEIIPMARYFKEQE---IDLCLIEFMDVGNDNGWDMTRVVTKREMIAKVTEA-MSIEPLEARYYGEVAARYRYHDAEIHFISSVSESFCSTCTRARVSSDGKLFTCLFASSGFDLREELRAGASDAELL.. 315
92 0.000e+00UniRef50_A0A142XYP0 GTP 3`,8-cyclase n=1 Tax=Pirellula sp. SH-Sr6A TaxID=1632865 RepID=A0A142XYP0_9PLAN  ali  15  4............................................PFPPLIDRFGRVHQSLRISVTDACNIRCRYCMPEQPQHRLLSFEHITKVVTALAGSSIRKLRITGGEPLMRPQLPQLVSQLRS---IPEIEKIAMTTNGMMLEESASSLVEAGLSHFNISLDTLQEETFHRLTRREGVHRVLAGIEGAIR----TKASVRLNALIMRDINFDDILPLVEFALERG---LVLRFIEFMPLDADRQWSRQQVVSGAELRALLQQRFGSIEPITRTESSQPSTDYRIANQLGGFIDPVSSPFCEQCDRLRLTADGKFRNCLFGREEWD................. 285
93 0.000e+00UniRef50_A0A0J8VIZ3 GTP 3`,8-cyclase n=18 Tax=Gammaproteobacteria TaxID=1236 RepID=A0A0J8VIZ3_9ENTR  ali  16  14..............................................SQLTDAFARKFYYLRLSITDVCNFRCTYCLPDGYKPSFLSLDEIRRVTRAFAALGTEKVRLTGGEPSLRRDFTDIIAAVRE---NAAIRQIAVTTNGYRLARDVKAWRDAGLTAVNVSVDSLDARQFHAITGQDKFRQVMAGIDAAFAAGFE---RVKVNTVLMRDVNHHQLDTFLAWIKPRR---IQLRFIELMETGEGGSLFREHHISGATIRDELLKRGW--IHQLRNRADGPAQVFCHPDYEGEIGLIMDKDFCASCNRLRVSSSGKLHLCLFGDGGVSLRELLAD.......... 300
94 0.000e+00UniRef50_A0A0Q1B2B9 GTP 3`,8-cyclase n=1 Tax=Smithella sp. SDB TaxID=1735324 RepID=A0A0Q1B2B9_9DELT  ali  16  2.........................................................NYLRVSITDRCNLHCRYCRPKEGHDDILRYEEIIRVVSVAVKMGLVKVRVTGGEPLVRRGCIDF---LSRLKKIEGLQDISLTTNGILLEEFAQKIFDAGICRINISLDSLNKDKYSYITGGGGIDAVLRGIMRAEEIG---FAPIKINTVAIKGFNDDEVMDFVRLAAD---KPFQVRFIELMRVGQTNLDYVGDYMPTSQLIDKIKQK-YELEPIKKKRSDGPARIFKIKEGCGGFINPVSDHFCSTCNRLRLTSDGNLRACLLNEKEVDLKKALRENCSDEERLFW 292
95 0.000e+00UniRef50_F2AG53 GTP 3`,8-cyclase n=1 Tax=Rhizobium etli CNPAF512 TaxID=993047 RepID=F2AG53_RHIET  ali  15  206....................SDPAAEELVNTRIGTTGNASPLTANAHPMIDPFGRAVTYLRVSVTDRCDFRCTYCMAENPKKDLLTLEELDRLCSAFVAKGVRKIRLTGGEPLVRKNIMYLVRQLGE-KIGSGLDELTLTTNGSQLSRHAEELYECGVRRINVSLDTLDPDKFRKITRWGDFAKVMEGIDAAQKA----GISIKLNAVALKDFNAAEMPDLLRFAHGRG---MDLTVIETMPMGEIDEDRTDQYLPLSELRADLERQFTLTE--IDYHTGGPARYVRVEGGRLGFITPMTHNFCESCNRVRLTCTGTLYMCL........................ 503
96 0.000e+00UniRef50_A0A2G5KZ04 GTP 3`,8-cyclase n=2 Tax=Bacteroidetes TaxID=976 RepID=A0A2G5KZ04_9BACT  ali  17  6.............................................QTRLTDQWGRQMDYLRIAVTDRCNLRCFYCMPAEGKKELLTYEEILRLTRLSAELGVTKVRITGGEPFLRKDLTSL---LHNIKNTEGIQSLNLTTNGVLTLPYLDELQEIGIDHVNLSLDSLDRDNFRRITRRDEYDRVLDTLHGLI----HRGIKTKINMVVMQGKNTHEIIDMAALT---REHDISVRFIEEMPFNGST--DMQNTWTATQILQELSTRFGTLTPIV-TDANAPSTDYLIDDHLGGIIAAFSRSFCGTCNRLRLTATGSIKNCLYDEGVLDIKNLIRSGYSDEQL... 297
97 0.000e+00UniRef50_A0A1H0Z1G7 GTP 3`,8-cyclase n=3 Tax=Bacteria TaxID=2 RepID=A0A1H0Z1G7_9GAMM  ali  16  17..............................................NMPLDRRGRPLRDLRLSVIEACNFRCGYCMPADQVPDDLSFDEIETLVRGFARIGVNKLRLTGGEPLLRKRLPELI---ARLSVVPGIEDLALTTNGSLLAAQAHALHRAGLRRLTVSLDALDADLFREMGGRGEASAVMAGIDAATRAG---FGSLKINCVVQRGVNENQVLPLVEHFRGSGHV---LRFIEYMDVGTCNGWQRAQVVASAELRDRI-AACWPIIPLDANYRGEVAKRYRFQDGAGGFVSSVSETFCGDCHRARVSADGQLYTCLFASEGADLRGAL............ 305
98 0.000e+00UniRef50_R6EMV9 GTP 3`,8-cyclase n=1 Tax=Firmicutes bacterium CAG:145 TaxID=1263005 RepID=R6EMV9_9FIRM  ali  14  4.................................LTDIFEGQASRKELMMRDRHGRLINYMRISVTDKCNLRCRYCMPEGASDQMLTFDEILRIAQASVKAGISRIRLTGGEPLIRRDIVSLIENI---KEIDGIERIALTTNGIFLKEQLKELTRAGLDSVSISLDTIERDKYKAMTGIDGLPAVLSAIDETKKY---EDLEVKINSVIIRGFNDSEICDLALLAE---VRDISVRFIELMPIGPGKEYEMSREDVKQRLESFLCKKLMWSRESCGASGCGPAEYYRVCGFAGGFISPMSHNFCKDCNRIRLTADGRLRLCLQYEDGIDLKPALRSGAGRDELTE. 327
99 0.000e+00UniRef50_A0A0F6SFW5 GTP 3`,8-cyclase n=5 Tax=Myxococcales TaxID=29 RepID=A0A0F6SFW5_9DELT  ali  16  36................................................LTDAHGRRITYLRASITDRCNMACVYCMPPGGRSDVLAFEELVAITRALATGGVRRVRLTGGEPLARRDVVRLVAMLR---AGTPIEALAMTTNGARLTTLARPLREAGLDEVNVSIDSLDRDRFRAITRGGDLDEVLAGVHAALDA----GMVVKINCVALGGLNDDELGAIVDWAWSIGIVP---RFIELMPIGEAAALPRERFVAAREIVSRLGARVAPDASATKPDGKGPARYLAAADGSGGFITAVSDEFCGGCNRVRITSRGELRACLASRRAVSLRDLVREGASD...... 326
100 0.000e+00UniRef50_A0A1V5INY1 GTP 3`,8-cyclase n=1 Tax=Firmicutes bacterium ADurb.BinA052 TaxID=1852896 RepID=A0A1V5INY1_9FIRM  ali  15  7................................................LVDRFGREITYMRISVTDKCNLRCVYCMPEEGHGEMLTMEEFARVVRIASTLGISRVRITGGEPLARKGVASLVRAAA---GIPAIRDISMTTNATMLAPMADELAGAGLRRVNISLDSLKPDTYARLTRRGDLASAIAGIHAAQRAGLR---PIRLNAVVLRGINSEEIESLAALTLKHDW---DVRFIEFMPFGNGGLFGEEYVVPIHEIRRRVLDRMAQLSEAKRTDVCGPASYLRLRGGLGGFISRDGDEFCGGCNRIRLTADGMFRPCLLSEASIDMKTALR........... 312
101 0.000e+00UniRef50_A0A1C5PPJ7 GTP 3`,8-cyclase n=12 Tax=Terrabacteria group TaxID=1783272 RepID=A0A1C5PPJ7_9FIRM  ali  15  1................................................MIDNYGRVIDYMRISVTELCNLRCRYCMPEDGHDEMMTAEETIDAVKAAVSLGIKKIRITGGEPLVKRG---IVRLCSAISAIEGVEELCITTNGTLLPKFGRELREAGVSRVNISLDTLDPDRYREITRVGELSEALAGIDAAFEAGFD---NIKINNVLMGGFNDDEIEDFVKLTVD---RPIEVRFIELMPIGGGMDFDRSGFIS----CQQVLSKVPELEPL--EHSEGVAVLYRLPGAKGRVIRPISCEFCGDCNKIRLTSDGMLKPCLHSDAELCIKGL............. 277
102 0.000e+00UniRef50_D6SP03 GTP 3`,8-cyclase n=4 Tax=Desulfovibrionales TaxID=213115 RepID=D6SP03_9DELT  ali  17  1...............................................MIQDNYGRGVSYLRLSITDRCNLRCFYCRPGKGHKNILTYEDMLYLLHAASGMDVQKVRLTGGEPFVRRDILYF---LHRLKSELPQMEIRLTTNATLIAGKIRALRDIGIKGLNISLDTLDRDKYQRITGQDKLDSVMASIDR----CLEEGIRVKINAVALKGVNDDELGDFIRLAMD---KPLDVRFIEFMPIGEKTLWEQDYYWSSADLLTQAAELTDMVPVDNLTRNHGPARMYK-PGHRVGVISPLSAHFCATCNRLRVTANGRLRTCLFSDKEYNL................ 280
103 0.000e+00UniRef50_A0A1Q8CL38 GTP 3`,8-cyclase n=7 Tax=cellular organisms TaxID=131567 RepID=A0A1Q8CL38_9PSEU  ali  13  12..................................................DRYRRPLRNLRISVTDRCNLRCRYCMPEAPRRDLLTFEEISTLVDVFMSLGVDKVRVTGGEPLLRHDLPTLVGMLAAK----PLRDLAMTTNGVLLADHVEALRAAGLRRLTVSLDTLRAERSKTLSQRNTHPQVLAGLASIAPAG---FTDTKIDTVALRGINDDELVDLVEYA---RTVPAEVRFIEYMDVGGATTWSPDLVLSRADMLETLTAHYGPITPLPASDV-APADRFALPDGTFGIISSTTQPFCATCDRSRLTADGMWFRCLYAIEGTNLRDPLRDGASFEEL... 299
104 0.000e+00UniRef50_E4WUL9 Uncharacterized protein n=2 Tax=Chordata TaxID=7711 RepID=E4WUL9_OIKDI  ali  18  12................................................LLDSHGRPHDYLRISLTEKCNLRCRYCMPIEGSDQLLSAQELYRFSSLLVKAGVQKIRLTGGEPLVRREIQEIISDLNSLR-DDGVKQIGITTNGVALSRKAKRLRDAGLDTANISLDTLEPMKAEFITRR--SKDMHYSVMKAIENSIDAGITTKINCVLQRGLNDDEIVDFVKMSKDL---PITVRFIEFMPFNGNEWAKGKRFISLREILRVVTSEFGEVEHQRGER-SDVAKNYRVPGFAGNFIGSMSQPFCSGCNRVRLTADGMIKNCLFSNEKLDLRKYLRDSSISDDEL.. 311
105 0.000e+00UniRef50_E8RFK7 GTP 3`,8-cyclase n=7 Tax=Bacteria TaxID=2 RepID=E8RFK7_DESPD  ali  16  10...........................................PPGNSLTDLFSRSISYLRLSLTDRCNLRCMYCVTEDESSGCLTYEELLRVVRVAVAMGITKVRLTGGEPLVRRGVLDFIRELNR---IEGLDDVRITTNGVLLAQYGRELLEAGVTKVNISLDSLRPERVAAITGIDCFDAVWRGVETVLALG---FAPVKLNMVAMRHINDDEILDFARMSQRL---PLQVRFIEFMPIGASSRWNANTYISTDEIMERI-GTLGELIPLQKGRNDGPAKVFRLEDAAGGFISPLSHHFCDRCNRLRLTSAGTLRSCLLHDEEVDLRAVLRNEPTDD..... 309
106 0.000e+00UniRef50_A0A1Z5T0L5 Uncharacterized protein n=4 Tax=Capnodiales TaxID=134362 RepID=A0A1Z5T0L5_HORWE  ali  16  64.........................................AKPFSDFLTDSFSRQHDYLRISVTERCNLRCLYCMPEAGPKTQLTSPEIFYLSQLFVNQGVNKIRLTGGEPTVRKDIVPLMQQIGSLRSN-GLRELALTTNGISLHRKLDAMVEAGLTGVNISLDTLDPFQFQLLTRRQGFDAVMKSINRVQDMNRGAGVKLKVNCVVMRGLNDHQIMPFVDMT---RDQDLEIRFIEYMPFG-GNKWEEQKMMPYAEMLDVIREKYPTLTRMQ-DAKNDTSKSWHIPGFAGGFITSMTHNFCDG........................................ 330
107 0.000e+00UniRef50_A0A285NXL4 GTP 3`,8-cyclase n=11 Tax=Bacteria TaxID=2 RepID=A0A285NXL4_9AQUI  ali  17  1...............................................MIKDAYGRELHDLRISVTDRCNFRCQFCMPEGPRSEILTFEEITRIVKISTRLGVKKVRITGGEPLLRRDIEKLIHM---LSQIEGLEDISMTTNGFLLEQMAERLKDAGLRRITVSFHSLKDEVFSKIVGRSVK---VSQIIKGIEASLKAGLPVKVNVCVVKGLNDEEILPIAKFFKKMRVV---VRFIEFMDVGNLNGWSLDK-VVSAKEIVEIISKEFPIEPVEKNYRGEVADRYRYKDDEFGVISSITQPFCGDCNRLRLTADGKLLTCLFATQGYNIKTLLRNGAKDE..... 293
108 0.000e+00UniRef50_A0A1Q7F8I2 Cyclic pyranopterin phosphate synthase MoaA n=1 Tax=Thaumarchaeota archaeon 13_1_40CM_4_48_7 TaxID=1805396 RepID=A0A1Q7F8I2_9ARCH  ali  18  4........................................NASNVDKALVDSFGRVAHKLRLSVTDRCNMQCVYCMPKDPKNELLSYEEFVRISEVMARLGIEKIRITGGEPLLRPRVEDLIAGLSKIN---RIRSISMTTNGLFLAEKADLLKRCGLQSVNISLDTFKAGRFRAMCGVDGLHKVLNSILAA----DNAGLKVKVNMVVVRGWNDDEVIDFATFARERR---IIVRFIEFMPLDGSGIWSPELVVSKSEIISRIRSEIVDIESRIVEDNCAPAKLYSFADGKGGFIASMTEPFCAQCDRVRITSDGKLFTCLFHDIKFLLRNGKTDQEIANFIME. 332
109 0.000e+00UniRef50_M1V6U3 Probable molybdopterin synthase Cnx2 n=1 Tax=Cyanidioschyzon merolae (strain 10D) TaxID=280699 RepID=M1V6U3_CYAM1  ali  15  5.............................................MRPITDSFGRVHNYLRLSLTERCNLRCQYCMPATGVPNLLTASEIAALAEHLVRQGIRKLRLTGGEPLVRKDVEQVLDALAPLSAGSPVVALSMTTNAVLLERHLPTLQRCGMRSVNISLDTLRPERFTILTRRSGLPRVLRAIRRAVQAGLD----VKVNCVVMRGINDDELLDFCEYFASMETRLQAVRFIEFMPFS-GNGWESNRFVPYAEMLQRLRGRFEPESREQVQRPHDTTKYWAYRGDRVGFITSMSNHFCAGCNRLRVTATGHLRTCLFGRTEYGLRHLIGDWQELDAVID. 337
110 0.000e+00UniRef50_R7QKM4 Uncharacterized protein n=5 Tax=Eukaryota TaxID=2759 RepID=R7QKM4_CHOCR  ali  16  1...........................................................................MPSAGVPSLLSTPELTRLASLFLARGVDKIRLTGGEPLLRRDLPELLSALTSLSPSP---RVSLTTNGLVLSRMLPALRAAGLSGVNISLDTLHAAKFERIARRKGHARVLAAIQTAAEAGLDA---VKVNVVVMKGVNDDELPAFAALTEHMRV---DVRFIEYMPF-DGNRWSADKLVPYADMLDSVARAYGRLERA-SDSPNDTSKHYRVPGFLGGFITSMSDHFCGTCNRIRVTADGNLKVCLFGREEVSLRDAMREGMADDDLSE. 266
111 0.000e+00UniRef50_R5WQW2 GTP 3`,8-cyclase n=39 Tax=Firmicutes TaxID=1239 RepID=R5WQW2_9FIRM  ali  18  1................................................MIDRCGRTIDYLRISVTDRCNLRCIYCMPENGRSQILREEEIIRISRVMAQLGITRIKLTGGEPLVHVRMPELV---RQIKEIPGIKKVTLTTNGTLLKEQMKELAEAGLDAVNISLDTLNRDCFQKITRRDLLNEALEGIQEALRY---PGISVKINCVPL-GIEGQDLCEIAELA---RKYPVHVRFIEMMPIGCGMEF---KGMSEKELTELLEKRFGALTLYQGEPGNGPSRYYEAQGFEGGFISAVSHKFCKDCNRIRLTSQGYLKTCLQYSAGKDLREIIRNGGTDEELTE. 292
112 0.000e+00UniRef50_A0A1F8PW37 GTP 3`,8-cyclase n=78 Tax=Bacteria TaxID=2 RepID=A0A1F8PW37_9CHLR  ali  15  25............................................RYPMAFDRFGRCIHYLRISLTDHCNLRCVYCMPEEPNAELMQDEEIIRLARLFAGLGFDKIRLTGGEPTVRAGIVNLVGEIAS---TPGVRSLSMTTNGVLFSKLAEPLAKAGLTRVNFSLDTLDPAKFYRLTRRGSLHEVWSGVQASEEAGL---IPIKLNCVVVRGYSDEEVVPLARLTLEHPW---QVRFIEMMPFAGATEFQRSQIVTAEEIIRRIEMELGPFVEINNGKLDGEARLYKLKDAIGGFISTISQPFCTTCTRARLTADGRLRLCLLCEDEVDLRAGVSD.......... 317
113 0.000e+00UniRef50_A0A0R0LHG9 GTP 3`,8-cyclase n=51 Tax=cellular organisms TaxID=131567 RepID=A0A0R0LHG9_9PROT  ali  17  2........................................NDNRLAFKLVDQLERPLRDLRISVTDRCNFRCSYCMPRAPRPDILSFEEIARVGQVFSTLGVRKIRLTGGEPLLRKNLEQLISQLSLLPNV----ETALTTNASLLAKKAYALKEAGLNRLTVSLDALDNATFQLMSDADDVEDVLQGIEEAHRVGFE---NIKVNCVIKRGVNDHALEDLTRYFKGTA---ITVRFIEYMDVGSTNNWHAKEVVPAKEMKETI-ERMFPLKDGEQSYPGEVAKSYRYEDGKVGFITSVTQPFCGDCTRIRLSTDGKLYSCLFATTGFDLRQQLRSGASD...... 302
114 0.000e+00UniRef50_A0A2G6N9T6 GTP 3`,8-cyclase n=1 Tax=Deltaproteobacteria bacterium TaxID=2026735 RepID=A0A2G6N9T6_9DELT  ali  16  1...............................................MLQDHFGRTISYVRMSITDRCNLRCLYCRSVSGHKDIMRYEEMKYLIDILRDEGVRKIRFTGGEPFVRRDCIAFLEEVAEA---CPDMAIHVTTNATLLRDKLPRLKALGLAGLNISLDTLRRDRFKEITGRDFCGHVLKAIDAALEL----GLRTKVNVVALRGVNDDEVKDFVAFVKE---RPLDLRFIEFMPIGGTSLWSQDNYWSAKAIYEAVARHTPLLPVPVQEDGQGPARMFDLPEGQGGIISAVSNHFCETCNRLRVTSDGRVRPCLFSDKEY.................. 279
115 0.000e+00UniRef50_A0A259U1N4 Cyclic pyranopterin phosphate synthase MoaA n=15 Tax=cellular organisms TaxID=131567 RepID=A0A259U1N4_9BACT  ali  14  5................................................LIDPLGRRHTQLRLSLTERCTLRCTYCMPAEGNRLLLTTDELERVAALFVGMGVNKVRLTGGEPLARKDA---VEVARRIGAMGGVQGLAMTTNGLALEKHLPALDEAGVTQITLSLDTLRDDRFRTLTRRDGLDRVLGAMEAALARGYGVGTPLKINVVVLRNENDDEVQDLAALALR---YPVEVRFIEWMPF-AGLGWEKSALVPWTETHARIEDAHGPLAPRE-DAPDSTSRTFTFAGGPGGFIASMSAPFCRGCTRLRVTADGALKVCLFGSAEVSLRDAMREGATDDDL... 309
116 0.000e+00UniRef50_R6PRG0 GTP 3`,8-cyclase n=4 Tax=Firmicutes TaxID=1239 RepID=R6PRG0_9FIRM  ali  16  1................................................MIDGFGRTIDYLRISVTDRCNLRCVYCMKEEPSGELLTLGEWVRLCKGAALAGIRKIRITGGEPLMRRDIVELVQAIS---NIPGIEKVVMTSNAVHLAPLAEKLKKAGLSGVNVSIDSLDEEQYCRLTRRDVLSDALAGL----ASCGKVGLPVKVNCVPVAGENEKELLHLAELAKE---YPMEVRFIEMMPIGEGSAFPP---VKNETIRKRLEEVYGGFIQTEKDDREGPVVYYTNAHFKGGFISPVSHSFCHQCNRIRMTAEGKLKLCLHHPVDCDLRELVRSGAKPEEI... 289
117 0.000e+00UniRef50_A0A1G3BL86 GTP 3`,8-cyclase n=5 Tax=unclassified Planctomycetes TaxID=473814 RepID=A0A1G3BL86_9BACT  ali  16  1................................................MLDRFQRKITRLRISVTDLCNLYCVYCRPPQGRKEILSFEEITLVARCAAQLGVRSFRLTGGEPLTRRNLKSLV---ASLSSIPGVEDLAMTTNGVLLRRYARALKEAGLMRINISLDSLQKERFRQITGGGNIEDVLEGIEAAVDAGFE---QVKVNMVVMRGINEDEVEDFARLSMD---KPLEVRFIEYMAFGC-RMIEEKKFVPGQEVLERI-RKVGDLVLADAENPCGPAKCYRLKGARGGLILPVSQPFCGDCNRLRLTSQGKLRACLLSGGEVDLKTILRS.......... 299
118 0.000e+00UniRef50_A0A1G7KDM9 GTP 3`,8-cyclase n=2 Tax=Desulfovibrio legallii TaxID=571438 RepID=A0A1G7KDM9_9DELT  ali  20  22.......................................GNLEAADAPLRDSHGRVVRYLRLSVTDRCNLRCVYCRSEAPHQKVLRYEEMARLVGLLTRLGVHKVRLTGGEPFARKDCDTLLALLHERHPQLDLR---LTTNGTLLEPHIPLLRRTGVRAVNLSLDSFDRATFARVTGRD----VLPAVLAALDALLRASIRVKINVVAMRGVNDGQMDDFAHAARNL---PVDLRFIEFMPMGNGTLWGPETFWPADQIRAEAQRRLRLTPETDAEAEAGPARMYRVEGGKGGFITAVSCQFCGSCNRLRLTSDGHVRTCLFDDKEYRLRGLLRHCDDADL.... 323
119 0.000e+00UniRef50_A8ZST4 GTP 3`,8-cyclase n=2 Tax=Desulfococcus TaxID=896 RepID=A8ZST4_DESOH  ali  15  2............................................KPNLLTDRFGRHLSYLRVSVTDRCNLNCLYCRRWDPSSEILSYEEMLRLIHIGAGLGITKIRITGGEPFVRKDACSFIDRVA---AFDGISDISVTTNGLLLGRYLDRLRQAGIRRLNISLDSLKREKYRLITGRDVFHTVWDNIMAALDAGFD---PVKVNVVVMREVNDDEISRFADLTFRF---PLHIRFIEYMPSCKYHLDSYRQMFTP--EIRERVEANGALIPIETADSSNIAHRFKYHGAKGGFISPMSSHFCAACNRLRLTADGMLRPCLLSDRFVNIKTPMRNG......... 290
120 0.000e+00UniRef50_A0A1H3FP86 GTP 3`,8-cyclase n=2 Tax=Eubacterium TaxID=1730 RepID=A0A1H3FP86_EUBBA  ali  14  1................................................MKDQYGRHIDYMRLSITDRCDFRCVYCMPEDGHDEILTFDEILRICRSAVDLGITRFKVTGGEPLVRKGAVDL---LARMKALPGVEQVTLTTNGYVLGQYVEALKALGIDGINISLDTLDRERFREITKRDGLDRVLQSLEKAVDA----GIRVKTNTVLMPQNRKDGIADLARF------WPVHVRYIEMMPIGMGRDYSG---CTGDTVMAMLKEKHPNLTAVSEPLGNGPAQYFKIPGYLGGIISAVSHEFCQTCNRVRVTSDGILKLCLNRAGHVDLRKLLRDGGDD...... 285
121 0.000e+00UniRef50_A0A1G1LE67 GTP 3`,8-cyclase n=4 Tax=unclassified Candidatus Omnitrophica TaxID=1047005 RepID=A0A1G1LE67_9BACT  ali  15  1................................................MKDQFGRELSYLRISVIDRCSLRCLYCMPAHGAGELLSYEEIIALTKCFAELGIRKVRLTGGEPLVRKDIAELVFRIRE---IPEIRELAMSTNGVFLKGQARKLKEAGLDRVNISLDTLNRIRFQQIAGIDRLAQVLDGIEEALVCGLR---PVKLNTVLLRGINEDEILDLVRFAIE---RSIEVRLIELMPTNELIQLDPEERFLSTEEAKEKIEQAYELIP-VDTYDSSPARVFSIKGARVGFISPLSNLFCARCNRLRLKANGALKTCLHGKEDLDLRALVRSG......... 286
122 0.000e+00UniRef50_A0A0E9M0N6 Molybdenum cofactor biosynthesis protein MoaA n=8 Tax=Bacteroidetes TaxID=976 RepID=A0A0E9M0N6_9BACT  ali  14  1...............................................MLKDQFGRIHNYLRISLTDDCNFRCLYCMPNEKISQIMQPHEILKLAETFVNLGVNKIRLTGGEPLVRNGFGQILDELAQLPV-----ELTITTNGFLLKRYLPNLLDAGVKSINVSLDALDPKRFAAVTQRNHFQMVWDNIM----LLLQNNIRVKINTVAMAGLIEHELFDFIELT---RDLPLHVRFIEFMPFN-LNDWKSSKVITADHLLQQTQSRY--KIVKLKDEPHATAKKYKIPDHKGTFITTMSDHFCEECNRIRLTADGKLKNCIFSSEETDLLTALRKGQAIEPLI.. 289
123 0.000e+00UniRef50_A0A077ZET3 Molybdenum cofactor biosynthesis protein 1 n=1 Tax=Trichuris trichiura TaxID=36087 RepID=A0A077ZET3_TRITR  ali  16  36................................................LLDSFGRFHNYLRISIVDQCNLRCVYCMPAEGSDKMASKEEIVHLTSLFVKLGVTKVRLTGGEPTIRKDLTDIVGKLDSLSRISGLKKVALTSNGIILGKLLPNLKERGLTHLNLSLDTLIETKFQIMTRSIGWKRVWNTIEIAEKL----FPIVKINCVVIRGFNDDELCDFVELT---RTRPLDVRFIEYMPF-DGNKWEHRKMVSYVEMMETIQRRFGSLRKLDNEMHDETSKGYQVPGFRGGFITSMSQHFCETCSRLRLTADGCLKVCLHGNSEVSLLNALRSGASEE..... 364
124 0.000e+00UniRef50_A0A0M4HFU2 GTP 3`,8-cyclase n=6 Tax=Bacteria TaxID=2 RepID=A0A0M4HFU2_9BACT  ali  14  6..............................................SVLYDNHGRPLEYVRLAVTDRCNLRCFYCMPEQGRQALLSYEELERVVRILARLGVHKVRLTGGEPFVRRGLLPFI---GRLRQIEGITDIGLTTNGVLTAPHVPELVRLGIRSVNLSLDTLDRARFLRITRRDELPQVLATFDALVAA----GIQVKINAVVMDGQNTEDIISLAELT---RDLPVEVRFIEEMPFNGGSHAAMSLPWNHVRIREHLAAHFPGLMPVPTAPGATAAE-YTIPGYAGGIIAAYSRTFCGTCNRIRLTAEGGLKTCLYDQGVLDVRALLRGGATDEEI... 298
125 0.000e+00UniRef50_A0A2I0MZY1 GTP 3`,8-cyclase n=2 Tax=Clostridiaceae bacterium JG1575 TaxID=1658742 RepID=A0A2I0MZY1_9CLOT  ali  17  5................................................LLDGQGRRLDYLRISLTCACNLRCTYCMPSQGEESPMTCEEILALARVFHELGIRKIRLTGGEPLLRGDLLPIVRGLKDL----GIEELALTTNGLLLKDLAQPLKDAGLDRVNVSLDTLDPVKYLSITRGGALSKVLEGLEAAKRSGL---TPLKINTVLLGGFNEIEVDALMELTH---HEALSVRFIELMPMGEALHGIFRFYS-----AQTILNEHPELQPLPQERG-GVASLYRLPGYKGGFIDPISCSFCDTCSRLRLSATGKLRLCLHHETGVDLRLALRQGRDLKPLI.. 291
126 0.000e+00UniRef50_A0A0T5ZQF7 GTP 3`,8-cyclase n=4 Tax=Bacteria TaxID=2 RepID=A0A0T5ZQF7_9BACT  ali  18  3..............................................SILSDRFGRKIDYLRISVTDRCNLRCVYCMPPEGKNEILTFEEMERFSRVAINLGVRKIKLTGGEPLVRKGIVDFIASISK---IEGLEDLSLTTNGIFLEDMANDLKASGLDRVNVSLDSLNPKRYGEITRGGDLRSVLRGINKVLE----VGFKVKINTVVLGSLSEKEIFELIEFGKE---KGIEVRFIEFMPL-CGNGWNRDYFIPLVDVKKKIEQMY----KLTNLKNDGVADRYSIDGGGIGFITTISEPFCSSCSRLRLTARGTLRPCLFSTLEIN................. 276
127 0.000e+00UniRef50_B1KU20 GTP 3`,8-cyclase n=61 Tax=Clostridium TaxID=1485 RepID=MOAA_CLOBM  ali  17  1................................................MLDKHGRKINYLRVSVTDRCNLRCVYCMPPEGHDNIMRYEEIFKVVKSASLLGVNKIRFTGGEPLILKNIDKLIYNTSKISS---IKDIAMTTNAILLEDRVEELKKAGLKRVNISLDSLKEDRFKSITRGGDINKVFKSIEKSLSIGMR---PIKINTVIMKGINDDEIDDFMNLTKE---YPISIRFIELMPIGEGRKLYKDGYISSEE----IISRHSDLIP-VETDKSSTALLYKFKESKIGFISPMSCKFCSGCNRVRLTSEGTLKPCLHSEKEVNLK............... 276
128 0.000e+00UniRef50_A0A1H9S0M2 GTP 3`,8-cyclase n=3 Tax=Corynebacterium TaxID=1716 RepID=A0A1H9S0M2_9CORY  ali  15  48................................................LADRFGRIARDLRVSLTDRCNLRCTYCMPADGTDFTLNDDEMIRLIRIGVELGIRMVRFTGGEPLLRKNLDHILAATKTLITDEGVPQTALTTNGVSLARQAQKLADAGLDRVNISLDTIDPELYTRLTRRNRINDVFKAIDAALDAGLN---PVKINAVVMPGVNKDGILDLARFALDKGT---QLRFIEQMPLGPREEWKRSDMVTAEDIIDKLKQE-FELSPAKQPRGSAPAALWNVTNGEIGIIASVTHPFCGDCDRTRLTTDGAIRNCLFADSEISLRDLLRAGASDDEL... 348
129 0.000e+00UniRef50_UPI000D6BD000 GTP 3`,8-cyclase MoaA n=1 Tax=Sediminitomix flava TaxID=379075 RepID=UPI000D6BD000  ali  13  3........................................NSSIFTKSLEDTFGRKHDYLRLSVTDRCNLRCFYCMPESPSEELMQTDEIEAICHDFVKMGVRKIRITGGEPLARKDIDDILLRLAKMPV-----SLHMTTNGVLVSKHQEALLKSGIESINVSLDSLNPKGFHHITRRNDFEKVME----AIEWLKTTPIKTKVNVVLMRGENDHEITDFADFAIQ---HNLDVRFIEFMPF-QGNEWSINKRVSHQEVVSILENHLGNKLQTLAHQAHETSTNFKIEGAIVGLISTVSQPFCGDCNRLRLTADGKMKNCLFSDSELDLLSAFRNGTS....... 294
130 0.000e+00UniRef50_U5T1C3 GTP 3`,8-cyclase n=6 Tax=root TaxID=1 RepID=U5T1C3_9GAMM  ali  17  3..............................................QPITDQYDRPLRDLRISLTDRCNFRCGYCMPRAPRRELLSFEEIARLAAVFSRIGVRKLRLTGGEPLLRRGLETLVEQLR---GIPGIDDISLTTNASLLTEKAHALRAAGLDRITVSLDGIDDTTFQRMNDVGFVARVLAGIDNAEAAGLG---PIKINMVVQKGVNDHDIPAMAAHFRGTAH---IVRFIEYMDVGNSNGWRYDHVVPSREVLDGIEARWP-VEPLAPNERGEVASRYRYRDGGGEIISSVTQPFCGTCKRARLSAEGRLYTCLFASDGHDLRQRLREGG........ 297
131 0.000e+00UniRef50_A0A1Y5GQI7 GTP 3`,8-cyclase n=10 Tax=root TaxID=1 RepID=A0A1Y5GQI7_9GAMM  ali  16  4..............................................KKLIDQFGRKVSYLRVSVTDRCDYRCVYCMAEEPRSQILTLEEQFRLCKNFVEMGVQKIRLTGGEPLIRRNIMALIE---PLGALEGLRELVITTNGSKLKELAKPIRKAGVSRINVSLDSLQPERFKEITRTGKLSKVLEGIEEAVEAGFE---RIKINAIIIKGRNEDEIMPLIRYVKSLG---IDITFIEEMPLGTSLAYDRAETFMSSVELQKVIAQEFTLVATDRDSG-GPARYFDLAGSRVGFISPHSNNFCSTCNRVRLTSEGRLLLCLGNEHSVDLRALVREQNLDDDQI.. 297
132 0.000e+00UniRef50_A0A2E8KLG1 GTP 3`,8-cyclase n=11 Tax=cellular organisms TaxID=131567 RepID=A0A2E8KLG1_9PLAN  ali  18  5......................................EANVDKPPGVLVDQFGRHHVDLRVSVTDRCNLRCTYCMPLDRQEKLLTFDEVTRCVSVAAEMGVRTIRLTGGEPLMRPNVHRLIQQLTRL---PRIEEVALTTNGLLLTDQAAGLAEAGLSRLNVSLDSLDEGRFETISRRSGLQRILEGLEEA---GRQGFRSIRINAVSIRGLTEQEIVPLAMFCREHR---FHLRFIEFMPLDAEDAWSRQHVLTGLEVRRILEMHIGQLKRREPEDSGQPSVDYSYVDGHGGFINPVSQPFCDRCDRLRLTADGQFRNCLFSSKDWDARALLRGGG........ 301
133 0.000e+00UniRef50_A0A291QYF4 GTP 3`,8-cyclase MoaA n=1 Tax=Chitinophaga caeni TaxID=2029983 RepID=A0A291QYF4_9BACT  ali  16  1...............................................MLTDRYGRKINYLRLAVIDRCNLRCTYCMPGEGKKELLNDEEIIRLAGILVELGIRKIRITGGEPFVRKDILHL---LKELSGIPGLDELALTTNGILTAPFIPKLKEIGIKSVNLSLDTLDEYRFHQITRRKGLNQVLETLQS----LQEHQIKVKINAVVMDGINIDDIFPLVRLTEQ---KDIDVRFIEEMPFNGTNEPHHSLKWDYLQILNHIKTEFPSISKI-ADPLHATAYSYQIPGFVGGIIAAYTRSFCGSCNRLRITPTGDLRTCLYDNRGTNLKEAIR........... 284
134 0.000e+00UniRef50_F4C4B2 Molybdenum cofactor biosynthesis protein A n=2 Tax=Bacteroidetes TaxID=976 RepID=F4C4B2_SPHS2  ali  15  1...............................................MIVDRYNRVHDYLRISLTDRCNLRCFYCMPEEPMKHLMSATELEIIAGHFVRLGVNKIRLTGGEPMVRSDFGDIILRLAKLPV-----SLHITTNAILLDRYFDVLRKARIGTLNISLDTLSAEKFKRLTRRDKFDLTMRNIHMALQ----QGFQVKINMVVMRDFNEDEILDFVAWTKEE---SLDVRFIEFMPF-EGNKWTSNQVFSLKEIVSLVESKH--KIQVIEGSLHDTAKHYKVSGHKGRFISTMSAPFCEGCNRLRLTADGKMKNCLFSKNESDLLSALRDG......... 282
135 0.000e+00UniRef50_UPI000D77B3EB molybdenum cofactor biosynthesis prote n=1 Tax=Ceraceosorus guamensis TaxID=1522189 RepID=UPI000D77B3EB  ali  16  51................................................LMDAHNRHHTYLRISLTERCNLRCVYCMPFDGNDDLLSSEEIRRLAELFVRNGVDKIRLTGGEPSVRRDLSDIVASLQELAP-LGLKQIGMTSNGLSLARQLPHLASNGLTHLNISLDTLQPETFESLTRRKGLHRVLDAIEQSLQL----GIHTKVNVVVMGGVNDQDVLDFVRWTKD---KPITVRFIEYMPFS-GNSWQATSLVPYKVLLQRIQAAFGPLER-VQDDKNDTSKHWKVPGHRGGFITSMTDNFCGTCNRLRITADGNLKVCLFGNKEISLRDAMRHG......... 340
136 0.000e+00UniRef50_A0A0S7XLZ3 GTP 3`,8-cyclase n=1 Tax=candidate division KD3-62 bacterium DG_56 TaxID=1704032 RepID=A0A0S7XLZ3_9BACT  ali  18  25........................................SEGPPVTRLTDGWGRRISRLRLAVTDQCNFRCVYCRPAATRGRLLSADEIVTVADAAVGCGIENIRLTGGEPLLREDLPEII---HRLSGLAPGLDISLTTNGSLLAELAQPLARAGLNRVNVSLDSLRGERFRSITGSRSLDAVMAGLEAAERAGLR---PIKVNVVILRRLNDDEVVEMVTFAQAHR---YHIRFIELMPLDGGQEWRPEAIVSIDEVRARIENR-FALTPLP--DGGSPGDEYLLDAGPTRVIGSISHPFCDRCNRIRVTADGFLRLCLFSSSEHDLR............... 309
137 0.000e+00UniRef50_A0A2J6NG18 GTP 3`,8-cyclase n=21 Tax=Bacteria TaxID=2 RepID=A0A2J6NG18_9STAP  ali  16  1.............................................MKQVTDKFGRPLRDLRISVTDKCQFRCSYCMPKEPEEHLLSFDEIERLARIYADLGVKKLRITGGEPLMRKDLHELIARLNK---IPGIEDIGMTTNALLLKKHGQKLYDAGLRRLNISLDAMDDELFGQINRGIGTSRILENIDYAISL----GFKIKVNMVVQKGLNDHEILPMARHFKNT---PITLRFIEFMDVGNDNGWNFEK-VVSKEDILDMLREEFTLEPVDPAYYGEVAKVYKHTDAHLGFITSVSENFCSTCTRARLSADGKFYGCLFATEGFDIREGISDETLEDILMEW 307
138 0.000e+00UniRef50_F7NQ37 GTP 3`,8-cyclase n=4 Tax=Sporomusaceae TaxID=1843490 RepID=F7NQ37_9FIRM  ali  15  1................................................MRDGFNRNIEYIRVSVTDRCNFRCLYCMPAAGHADILTYEEILRLLSLLGRAGFRRVRLTGGEPLIRKGFADFVREVAALR---YFEDIAVTTNGSLLAEMAFPLKAAGLKRVNISLDTVNVNRFSHITGGGKLSRVIEGVEAALLAGLS---PVKLNVVLTDILQQSDISYFVDLVQTS---PVSVRFIEYMPISQCDVSAG---MSIPALKQTIETLGGLLTPTSMSYANGPAKYFRLSGSKGGFITPISEHFCGSCNRVRLTADGKIKPCLLSNQEYDIKTALRGEISDKNLL.. 291
139 0.000e+00UniRef50_A0A2A4UE55 GTP 3`,8-cyclase n=2 Tax=Proteobacteria TaxID=1224 RepID=A0A2A4UE55_9PROT  ali  13  22..................................................DRFGRKLTYLRISVTDRCNMRCDYCRPAESHSNILRYEEIERIVSVAAELGVSKIRITGGEPLVRRDLPMLIE---KISAISGITDLALSTNATLLGKYAKDLASAGLQRINVSIDSLNALRFRKLTG-GELAPVLAGIQAANDAGL---TPIKLNTVLMKGINDDEVADLIDFASDIGA---TIRFIELMPMKQGLDWEKHYMSVDDILARKDVQARVDISPMQ--TGNTAARYLPLKSGKGGFIMPMSERFCEGCNRLRLTADGGLRSCLPADDQLNLRDLMRHGGSD...... 307
140 0.000e+00UniRef50_A0A1Y3Q6B3 GTP 3`,8-cyclase n=30 Tax=root TaxID=1 RepID=A0A1Y3Q6B3_9BACL  ali  17  6.................................................TDPYQRPLRDLRISVTDRCHFRCTYCMPREPERDLLTFGEIGRLARLFASLGVRNIHLTGGEPLLRRDLDELI---RRLAAVDGIEDIALTTNGHLLHHHARRLYEAGLRRVNISLDALDPDIFGRMNGRGIGP---ERILANIDLAREIGFEVKVNMVVQRGVNEGEIIPMAEYFRKRG---ITLRFIEFMDVGNDIGWSREK-VVTKREMLELLGRAHELKPEGRSRCGEVAEYYRYVGGRIGFITSVSESFCSTCTRARLSSDGKLFTCLFASEGFDLRAMLRGGASDDEI... 300
141 0.000e+00UniRef50_C8W9A0 GTP 3`,8-cyclase n=23 Tax=root TaxID=1 RepID=C8W9A0_ATOPD  ali  17  1................................................MYDELGRNIRYLRLSVTDRCNCRCLYCMPAHGHEDILSFEEMRAIVEASAQLGVRKVRLTGGEPLARRGIVDLVRMVS---AVEGIEEVVMTTNATLLAPLAKDLKAAGLSRLNISLDTLDSELYTKLSRTGTLDDALAGIEAAREAG---FIYTKFNTVLLGGLNESEIRPLAERAKSE---PVDVRFIELMRMGECSKWPAERFISAD-------CVLKVLPELEAAGSNGVTELFQAPGWRGRVIRPMTHTFCSSCDRIRVTADGMLKPCLHSAREIPLRGLVGD.......... 279
142 0.000e+00UniRef50_UPI0009DFE6D0 GTP 3`,8-cyclase MoaA n=6 Tax=Bacteria TaxID=2 RepID=UPI0009DFE6D0  ali  16  57.................................................TDRMGRPLRDLRISVTDECNFRCTYCMPKEPPSRYLSFPEIRDLVAMMVPLGVRKLKITGGEPLLRPGLHQLIARLTR---IPGIEDVGLITNGFHLKTLGPRLRDAGLTRVTVSLDSLDGQTFAAITGRGGLGQVLEGIRTSLDLGFS---PVKVNMVVQRGVNDHEALSMAEYFRESGV---ELRFIEYMDVGRRLDFRSGLLVPNREIRDSI-HRHWPLEPLEDAYYGEVAESYRYADGGGGFISSMTQPFCGSCTRLRLSADGKLYRCLFSGIGLDIKSLIRGESGD...... 349
143 0.000e+00UniRef50_A0A2H0LXL8 GTP 3`,8-cyclase n=1 Tax=Candidatus Omnitrophica bacterium CG11_big_fil_rev_8_21_14_0_20_42_13 TaxID=1974746 RepID=A0A2H0LXL8_9BA  ali  14  1...............................................MLQDNFGRKIDYLRLSVTDRCNLRCRYCMRKEGIGEILTLKEIARIARVFARCGIVKIRLTGGEPLLRQDIAAIMRSIFDHG---GIRDICLTTNGVLLKDKAASLKAAGLRKINISLDTLKRDRFAFISRGDFLNNVLSGVDEAV----NAGFLVKLNVVAIKGVNDDEILDFVEFCQKKK---IILRFIELMPVSANFNLGDCRYLSRRDI-EKVLRTLGALTP-QGQLGSGPADYYGMPGFPVGFISAMSGKFCFRCNRLRISAKGEIFPCLSSRRKINLRNYLRSGASDEELM.. 292
144 0.000e+00UniRef50_A0A1V5CHY3 GTP 3`,8-cyclase n=6 Tax=Deltaproteobacteria TaxID=28221 RepID=A0A1V5CHY3_9DELT  ali  16  1...............................................MLFDRFDRAVSYIRISVTDRCNLKCRYCLPFVSHKEILRYEEIIRLARICAGLGVNKIRITGGEPLIKKGIPVLIK---EIGAIPGITDVGLTTNGVHLAGQLPDLQVAGLKRINISLDTLKRRRFAAMTGVDAFDQVWNSINLAIGSGLN---PVKINTVIIDGFNDDEVLDFVKLAKTRNV---EVRFIEFMPFGDSGLWESSRVITSWAIEEFIRTRY--ILERSSCSSGGPAMTYAIKGGAGGFISPLSSHLCRQCNRIRVTAQGGIRPCLFSGQEYDVKALLRGGASDEEI... 291
145 0.000e+00UniRef50_A0A1F2R841 GTP 3`,8-cyclase n=2 Tax=unclassified Acidobacteria (miscellaneous) TaxID=305072 RepID=A0A1F2R841_9BACT  ali  16  2...............................................SLVDRFSRPLGNLRLSVTDRCNLRCAYCMPEDDREDVLHFEEISALVDVFIGLGVNKVRLTGGEPLVRRDLPELVRMLA---AKPGLTDLALTTNGVLLTEQVDALHSAGLGRITVSLDTLRPDRFVKLTRFDRLNAVLEGIKAASTLRLKPDTTLKIDSVVMRGVNDDELVDLIEYGKSANA---EVRFIEYMDVGGATRWSQADVVSRVEILDTLACRYGRVEPL-AEQSSAPADRFSLPDGTFGVISSTTSPFCRSCDRSRLTADGMWYLCLYAAQGIDLRGLFRRGASAEEL... 330
146 0.000e+00UniRef50_S6AKI2 GTP 3`,8-cyclase n=255 Tax=Proteobacteria TaxID=1224 RepID=S6AKI2_9PROT  ali  16  3.............................................DAMLCDSHGRRIEYLRLSVTDRCDLRCTYCMPAEEPANWLTFDEIERVVGAFARLGVHKIRLTGGEPLLRRNLAEL---AGRLSSLPGIADLSLSSNGTQLAKHAQALRAAGITRLNVSLDTLDQARFATITGRDALDAVLHGLMAAKE---EGFGPIKINMVVMAGTTDNEFDAMAAYCIEHR---FVLRLIEAMPVGETGRKTA--FVALGTIRERLRTCFGLVDGVVA--GGGPARYLVSPDGQIGFITPISQHFCDTCNRVRLSVDGTLYLCLGQDDKVDLRALLRSGCSDDQL... 294
147 0.000e+00UniRef50_A0A1I4JWD0 GTP 3`,8-cyclase n=1 Tax=Pelosinus propionicus DSM 13327 TaxID=1123291 RepID=A0A1I4JWD0_9FIRM  ali  16  1................................................MLDGYKRVIDYLRISVTDRCNFRCRYCMPPQGSQEILSYEELLRIITVLGQHGISKIRITGGEPLLRRGIVDFIRQIRKL---DTIKDLSMTTNGSLLSQMALRLKQAGLDRINISMDTTNFIRFAHITGQGQLKQVLAGVKSALEAGLN---PVKLNVVVTEALCDSDLSYFIT---QVYQHPIAIRFIEYMPIGEKNMGQK----ISIAIVKSKIEFQGQLEPVMNIEGNGPARYYRLPGAQGGFITPMSEQFCNSCNRIRLTADGKIKSCLLSNQETDIKSLLRKGCDDEEI... 293
148 0.000e+00UniRef50_A0A1Z8TCF3 GTP 3`,8-cyclase n=2 Tax=Bacteria TaxID=2 RepID=A0A1Z8TCF3_9BACT  ali  15  21.............................................DSPITDRFGRTFNYLRLAVNEHCNLRCIYCMPEEGINKILTTNEIKSILKVVADLGVSKVRLTGGEPLLRKDIFELIGYASK---ITTIDSVHMTTNGLLLSDYIEKLEEAGLSGINISLDTLDPEKFKEITRRDALHDVLGGLNAAVKSNIKH---VKVNVVAMRDFNNAEIHDFTELTKSN---DITVRFIELMPFDSHQIWKTGKYYSAANILEDLRKKIKVLSPISGSSTEHH--IFKIKGYKGRVIPSYTRTLCGKCNRLRITADGKLLNCLYSQQETNIRDAIR........... 306
149 0.000e+00UniRef50_A0A1G1LEC8 GTP 3`,8-cyclase n=2 Tax=unclassified Candidatus Omnitrophica TaxID=1047005 RepID=A0A1G1LEC8_9BACT  ali  16  2.............................................QDDFVDSFGRGISYLRISVTDRCNLRCCYCIPPGGRTDILSYEEILRLSECFVDLGIDKIRLTGGEPLARRNLSSLV---NALSQIPGIKDLSLSTNGIFLADQAEDLFEAGLKRINISLDTFSSAKFRQIAGWDVHHRVVTGIEKAIQVG---FHPVKINAVIMKEINDDEIESFVAFAME---HPVEVRFIELMPTHNSFVAKKKYFVSNDWVKNEI--AKWAVLLPEPRLPGDVSEVYRPAHGVGGFISSISHPFCSECNRIRLRVDGTLKLCLHGEETFDLRTPLRGGKS....... 291
150 0.000e+00UniRef50_A0A0E9ETD2 GTP 3`,8-cyclase n=135 Tax=Bacteria TaxID=2 RepID=A0A0E9ETD2_CHLTH  ali  17  1................................................MKDAFNREIDYVRLSLTDRCDLRCTYCMPATGKEQLLTDDEIIFLLRILAKEGIKKVKLTGGEPLVRPNLLSLIK---RIKQISGIEKVTLTTNGMKLAREAQGLKEAGLDGINISLDTLDPEEFREITRVGQLRNVLAGLEQAIDVGL---PNIKINTVARKELSEATIVELAEIAKKETVH---LRFIEMMPIGLGKEHPGKQ----QEEVEDILTKHYGLQPYQKPLGNGPASYYALKDFKGGFISALGHCFCETCNRIRITADGHLKTCLHSADGYSLKEALAKEQTAELL... 290
151 0.000e+00UniRef50_K1YWH2 Uncharacterized protein n=1 Tax=groundwater metagenome TaxID=717931 RepID=K1YWH2_9ZZZZ  ali  16  3................................................LIDSYNRKLDYLRISLTDRCNFRCVYCMPPEGKNEVLSLEEIGRLAGIFISLGTKKIRLTGGEPLLRKN---IVSLVRDLASVAGLEELGLTTNGFFLAPLAHELKANGLSSVNISIDSLNRLRFHHVTRTDSFEDVFAGFMASLEA----GLKVKVNVVAMNDLGEKEVESFVELAKKF---PVELRFLEFMPLCGSAWQSEKRLSLS--QLKQWVSSHCSLVPIPRGRN--VADTFQIEGHEGGFISSMSEPFCGDCSRLRLTSTGMLRLCLFSPLEMDLRTPLRQGALDEEI... 290
152 0.000e+00UniRef50_A0A1K0H7F2 Related to Molybdopterin biosynthesis CNX2 protein n=6 Tax=Ustilaginaceae TaxID=5268 RepID=A0A1K0H7F2_9BASI  ali  15  76................................ISEIDSRLEPPSPSHVLRDRHARQHTYLRISLTEKCNLRCLYCMPEDGSNELLSTSEVERLASLFVSQGVNKIRLTGGEPTVRSDLPQIVSSLNELKQH-GLEQIGITTNGIALKRKLDTLVQNGLTHLNVSLDTLDSFKFEFMTRRRGHKAVMDCIERALALGM---PSVKINVVVIKELNDQDVIDFVRFTKD---KPITIRFIEYMPF-DGNKWQVQKLVPYRDLVKTIQSEFPDFERVNRDDPNDTSKHWHVPGHQGGFIT-----------RLRITADGNLKVCLFGNAEVSLRDAMR........... 369
153 0.000e+00UniRef50_D4M4I4 GTP 3`,8-cyclase n=82 Tax=Bacteria TaxID=2 RepID=D4M4I4_9FIRM  ali  17  1................................................MIDQYGRTIEYLRISVTDRCNLRCVYCMPEEGHEQILTFDEIERVCRISTELGISKIKLTGGEPLVRKGLPDL---LGKIKRIPGIEQVTLTTNGILLKNQLDELMRQGLDAVNISIDTLDETCYHTVTRCGELNQALEGLQVALEY---PNLRVKLNCVPMNQ-SEEEYIQMAEYAKE---HPVEVRFIEMMPIGMGKACQGK---SRDELLELLEKAFGNAEPYEKHLGNGPAEYVSFSGFHGGFISAVSHKFCDSCNRIRLTAEGYLKLCLQYESGIDLRKLLRSGATDEE.... 288
154 0.000e+00UniRef50_B8BUD0 Uncharacterized protein n=2 Tax=Thalassiosira TaxID=35127 RepID=B8BUD0_THAPS  ali  17  48.............................................DNILTDTHGRHHNYLRISLSERCNLRCQYCMPPEGVPHLLTNEEVVRLVDLFVKNGVNKVRLTGGEPLLRPNLISLVRMASQRSGEVEKESVGITTNGISLSRHINGLVDAGLTGVNISLDTLRNDRFLEITRRKGLSKVLRAVQDTIDAFREGGSRVKINCVVMKGFNDDELGDFVRMANDTFKGDVDMRFIEWMPFND-NGWNRSRFVSYTDMMDKIVRTEGMHLERIGDGPNDTTKWWRVRCSRIGFITSMSEHFCSTCNRLRITADGKIKVCLFNEKEVSLRDILR........... 378
155 0.000e+00UniRef50_A0A2H6K2K8 GTP 3`,8-cyclase n=1 Tax=bacterium BMS3Abin01 TaxID=2005709 RepID=A0A2H6K2K8_9BACT  ali  16  37.......................................................VIDYLRVSITDRCNFRCIYCMPPEGHEQILSFEEIERFVFVATTMGVSRVRVTGGEPLVRKGCTGLLARLAAL---PGVEDLSLTTNGSLLAGHEEQLRQAGLSRINISIDSLNPQRFRRITSGRELRPVLAGLERALDAGLA---PVKVNAVMLEGI-EDDVEAFVRLA---RERPVHVRFIEFMPIG--RRRGGDWRFVSRRRLMDLIGRFGKLEPAHSPAGGGPARYFRLDGGTVGFISSMSDHFCSRCNRLRLTADGRLRNCLFSDKEVDVR............... 307
156 0.000e+00UniRef50_A0A1Q8TTA4 GTP 3`,8-cyclase n=8 Tax=root TaxID=1 RepID=A0A1Q8TTA4_BACPF  ali  16  2...............................................NLVDRFERKHDYLRISVTDRCNLLCHYCVPNGSHDRLLKDDEIVNIVQVGAELGIKKIRITGGEPLVRKGLPQLI---GKLKQIDGIEDIALTTNGVFLAKYAHELKKAGLNRMNISLDTLNEEKYTRITRNGKLQNVLEGIQAAIEY---NFQPIKLNVVLLKDYNVDEIETFLRWTMKENV---QIRFIEYMPIGDQQSEWSNQYQSLS-IVEEVARTIGDYVEHKRQQMAGPARVYSFQNAKGSFIHPISNEFCTSCNRLRLTADGHLKSCLFWESEVPVKQIAYD.......... 287
157 0.000e+00UniRef50_UPI00077FB1B4 molybdenum cofactor biosynthesis protein 1-like isoform X2 n=1 Tax=Parasteatoda tepidariorum TaxID=114398 RepID=UPI00077FB1B4  ali  16  18.........................LSISKNFNISSHCRTISFKAASSIEDTFGRHHNYLRISLTELCNLRCQYCMPEEGDQHLLTTKEILSLSKLFVKLGVTKIRFTGGEPLLRKDLLEII----------------------------------GLNALNISLDTLIPAKFEFLTRRKGYNNVIKSIHSALDAG---FHPLKVNCVVMKGINDDELTSFVKFTEK---QDVDIRFIEYCPFG-GNKWSDNKMVPYEQMLDLIKAEYPDLKRLT-DQPNDTSKAYKVPGYKGGFITSMTENFCSSCNRLRITADGNLKVCLFGNKEISLRDALREGASEESLL.. 301
158 0.000e+00UniRef50_I2G3P2 Related to Molybdopterin biosynthesis CNX2 protein n=1 Tax=Ustilago hordei (strain Uh4875-4) TaxID=1128400 RepID=I2G3P2_USTH4  ali  14  76................................ISEIDSRLEPPSPSHVLRDRHARQHTYLRISLTEKCNLRCLYCMPEDGSNELLSTSEVERLASLFVSQGVNKIRLTGGEPTVRSDLPQIVSSLNELKQH-GLEQIGITTNGIALKRKLDTLVQNGLTHLNVSLDTLDSFKFEFMTRRRGHEAVMASIERALAL---EMPSVKINVVVIKGLNDQDVIDFVRFTKD---KPITIRFIEYMPF-DGNKWQVQKLVPYRDLVKTIQSEFPDFERINRDDPNDTSKHWHVPGHQGGFIT-----------RLRITADGNLKVCLFGNAEVSLRDAMR........... 369
159 0.000e+00UniRef50_A0A1H9S0I2 GTP 3`,8-cyclase n=8 Tax=Terrabacteria group TaxID=1783272 RepID=A0A1H9S0I2_9BACI  ali  16  7.................................................TDKFGRVLQDLRISVTDRCNFRCRYCMPREPKEHLLTFEEIERLASTFLQLGVKKIRLTGGEPLLRKNIDELIERLASL---EGLEDIGLTTNGVLLGKMADKLKAAGLKRVNVSLDALDDKTFMAINDSNFSHPVIKSIQQA----KDAGLVVKINMVVKKGMNDHEVLSMANFFKERG---ITLRFIEFMDVGQTNGWDFQHVVTKKELYEMIAKEH-DLEPVEPDYIGEVAKRYRYKGTEVGFITSVSESFCSSCTRARIAADGHFYTCLFAGTGFNLKDILREGSNEELK... 302
160 0.000e+00UniRef50_D0LV10 GTP 3`,8-cyclase n=2 Tax=Haliangium ochraceum TaxID=80816 RepID=D0LV10_HALO1  ali  15  6..........................................LPVIAPLSDGFARRVRYLRVSLTDRCNFRCTYCMPATGRKELLSFEELERLIGVFASVGVRRIRLTGGEPTVRAEVVSLVGRIAR---VPGIDEVVMTSNGHLFPELAQPLAEAGLAGVNISLDTLDPERFRALTRRGDLARVLAGIDAARAAGLE----VKINAVALKGENDAEVPALCAYAWGRGITP---RFIEHMPMSEGQLYSETRQLTAAEIRAAVSAHFGELVPEQPAQASGPSRYWRLVGGRLGIISAMSEHFCDTCNRLRLSAVGALHTCLGYDDAHSLRDLMRAGASDDEL... 312
161 0.000e+00UniRef50_A0A0P6XCF1 GTP 3`,8-cyclase n=6 Tax=root TaxID=1 RepID=A0A0P6XCF1_9CHLR  ali  14  1...............................................MLIDHYGRAITYLRMSITDRCNLRCAYCQPASGDDQRLTKDDFIRLARVAAALGITKIRLTGGEPLVNPDILEITAQIA---AIPGIEDLSLTSNAILLGKLAGPLADAGLKRVNISLDTLHPEKYRRVTRFGDFDQAWQGILAAEKAGL---LPLKLNTVVVGGFNDDEIPELARLSIDHPWH---IRFIELMPVANSQDWGDQRYVSVQTMHEKLADL--SLVPEATPPNAGPERMFRIPGAAGGFIAPLGEHFCARCNRLRLTADGRLRSCLLVDKEISVRDALKSGAD....... 294
162 0.000e+00UniRef50_A0A260EEM4 GTP 3`,8-cyclase n=4 Tax=Bacteria TaxID=2 RepID=A0A260EEM4_9NOCA  ali  14  38.......................................GAAAPREGGLLDRFGRVATDLRVSVIDKCNLRCTYCMPADGQSQLMSTDEIRRIVRVAVQLGAEELRLTGGEPLVRKDLEFIIAGIREDNPDLP---ISMTTNAVGLDRRAQALKDAGLTRVNVSLDTLHPETFAELTRRPHLDKVLAGLQAARAAGLG---PIKINAVLLRGINDTEIVPLVDWAVSNG---FEMRFIEDMPLDGDRSWTATNVISAHDIRTEIETA-FSLAPDPRGRGAAPAERWEVPGGHVGIISSVTEPFCSSCTRTRVTADGKVRSCLFSHEETDLLSTLRAGADDE..... 342
163 0.000e+00UniRef50_Q8WXG1 Radical S-adenosyl methionine domain-containing protein 2 n=136 Tax=Euteleostomi TaxID=117571 RepID=RSAD2_HUMAN  ali  100  16VFRQPLSSLWRSLVPLFCWLRATFWLLATKRRKQQLVLRGPDETKEEEEDPPLPTTPTSVNYHFTRQCNYKCGFCFHTAKTSFVLPLEEAKRGLLLLKEAGMEKINFSGGEPFLQDRGEYLGKLVRFCKVELRLPSVSIVSNGSLIRERWFQNYGEYLDILAISCDSFDEEVNVLIGRGQGKKNHVENLQKLRRWCRDYRVAFKINSVINRFNVEEDMTEQIKALNPVRWKVFQCLLIEGENCGEDALREAERFVIGDEEFERFLERHKEVSCLVPESNQKMKDSYLILDEYMRFLNCRKGRKDPSKSILDVGVEEAIKFSGFDEKMFLKRGGKYIWSKADLKLDW 361
164 0.000e+00UniRef50_B5GGI0 GTP 3`,8-cyclase n=1362 Tax=Bacteria TaxID=2 RepID=B5GGI0_STRSH  ali  15  70................................................LLDTHGRTATDLRVSLTDRCNLRCAYCMPEEGKPELLTDEEIVRLVGLAVRLGITDVRFTGGEPLLRRGLVDLVRRCAALAPRPRL---SLTTNAIGLARTARALADAGLDRVNVSLDTLDADVFHRLTRRDRHHDVLAGLAAAREAGL---TPVKVNTVLMPGLNADEAP---ALLAWALAEGYELRFIEQMPLDAQQGWKRAGMITADDILTSLRTRYTLTPEPGAERGSAPAERWLVDGGPGGVIGSVTRPFCAACDRTRLTADGQIRTCLFATEETDLRALLRSGADDETLAEW 367
165 0.000e+00UniRef50_A0A1I7RRQ5 Uncharacterized protein n=1 Tax=Bursaphelenchus xylophilus TaxID=6326 RepID=A0A1I7RRQ5_BURXY  ali  16  15......................................KTATAPQNHALVDSFGRFHSYLRISLTEKCNLRCTYCMPEDGTQKLLTKDEIIKLVKLFAQNGVDKVRLTGGEPTIRRDLEEIIREIRETNM---IKEIGITSNGIVLKRKLKNLVDAGLNRINLSLDTLDENKYMIITRRNGFKKVMEAIEEALPL----FDRVKLNCVVTRGVNDMEVVDFVEMT---RDKNLDIRFIEYMPFGGNN-FNSKKMVSFKEMMIGISKKYDQVIRL-KDKPNDTSKAFQVNGFKGGFITSMSTPFCSTCNRLRITADGM............................. 288
166 0.000e+00UniRef50_UPI00085CC6C6 GTP 3`,8-cyclase MoaA n=1 Tax=Cellulosilyticum sp. I15G10I2 TaxID=1892843 RepID=UPI00085CC6C6  ali  16  1................................................MMDSYGRDISYLRVSITENCNLNCKYCMPDKKSEKTLSLNETYQIIKTFHKLGITKLRITGGEPLIRKGVIPFIEKVTKL---EHLKDIAMTTNAVLLEEKAEALADAGLKRVNVSLDTLDAKKYHLITGGGDIQKVLRGIEAAKAKGLS---PIKVNTVLIKGFNEDEIEAFAKWSDASGV---EVRFIELMPIGEGINWSREKYISADQ----ILENMPKLQRLEHTKG-GTAVPYTLKGAKIGFITPMSCKFCNACNRMRLTSEGKLKGCLHSDIEIDLKTALR........... 279
167 0.000e+00UniRef50_A0A125NXQ4 GTP 3`,8-cyclase n=3 Tax=Nitrospirae TaxID=40117 RepID=A0A125NXQ4_9BACT  ali  15  2...............................................QLTDNFGRSIDYIRISVTDRCNLRCVYCMPDDGKDSILTYEEIVRFVDVAATLGIKKIRLTGGEPLVRNSIDELVKGI---KEIPGIEELSLTTNGQRLAGMTSALAQSGLDRVNISLDSLRADRYAEITKGGDFDKVMAGIRAAEAA---ELLPVKLNMVPMVGINDDEIEAFVRFGIQTGC---QIRFIELMPTVVNEHLFNKGFIGTDEIKRRI-EREFHITPL-KLRKHGPARYFSVTDHAIGIISAVTCRFCSQCNRLRLTADGRLRPCLYSNIEVSLFDALRHNASKEEL... 303
168 0.000e+00UniRef50_UPI00099B7131 GTP 3`,8-cyclase MoaA n=2 Tax=Streptomyces rimosus TaxID=1927 RepID=UPI00099B7131  ali  13  566.................CRLSDPSRRLKDELIGLGHGGRSALGQGAAVLIDTYGRVATDLRVSLTDRCNLRCTYCMPEEGKPDLLTDDEIVRLIRIAVDLGIEEVRFTGGEPLLRPGLVGIVERVAALEPRPQM---SLTTNGIGLERTATALRDAGLDRVNVSLDTLRPDVFRALTRRKRHEDVLRGLEAARAAGL---TPVKVNSVLMPGLNDDEAPDLLAWAIA---HDYELRFIEQMPLDAQHGWKREGMITAGDILASLRTRFTLTPEGQEERGSAPAERWLVDGHRVGVIASVTRPFCRACDRTRLTADGQVRTCLFATEETDLRAALRSTAPD...... 887
169 0.000e+00UniRef50_A0A1H5MV18 GTP 3`,8-cyclase n=2 Tax=Actinobacteria TaxID=201174 RepID=A0A1H5MV18_9MICO  ali  14  10..............................................HPMVDRFGRVHRDLRISLTDKCNLRCAYCMPPEGKNNILTTDELVRVAEVAAVLGIEEVRLTGGEPMLRQDAVDVVRRMAAIEGPSGPLEVSMTTNGMALPKHAADLAAAGLARVNISLDTLSKERFHELTHRDRLSDVLAGIDAALAAGLN---PVKINAVAMRDVNDDELVDLVRFAARSGC---EMRFIEQMPLDAGHVWSRVRMVRGEEILESLEQA-FELTPL-PGRGAAPAERFLVDGGTVGVIRSVTKPFCGACDRVRITADGQLRNCLFAREESDLLTVLRSGGSDD..... 303
170 0.000e+00UniRef50_A0A1H6GEZ8 GTP 3`,8-cyclase n=45 Tax=Firmicutes TaxID=1239 RepID=A0A1H6GEZ8_SELRU  ali  18  1................................................MYDNLGRRIEYVRISVTDLCNLRCRYCMPEEGHEDILSYEEILRLVRCFAKLGARKIRLTGGEPLVRAGILDLIK---EIKCIPGIEIVVLTTNGVLLPQMAEKLKAAGLDYINVSLDTLDETAFFRLTRRRDLPAVREGLKALKEAGFRH---TRINCVPLRGMNEADIPKLAELARNEE---INVRFIELMPVGCAYEAGLER-IPMAEVRQILQSSFGTLQEAQRESLWGPAEYVRPAGFKGGFIDAMEHKFCSSCNRLRLTAEGFLKLCLHSSAGLDLRTLLRHGITDEDLIE. 295
171 0.000e+00UniRef50_A0A1H0AJ01 GTP 3`,8-cyclase n=1 Tax=Dendrosporobacter quercicolus TaxID=146817 RepID=A0A1H0AJ01_9FIRM  ali  15  1.............................................MAELRDLFGRRIHYLRVAVTDRCNFRCRYCMPQDPDHSMLSDQELVLLIHMFASLGVDKVRFTGGEPLMRAGVADL---LAQIKAVDGINEVNITTNGKLLPEYALSLKTAGVDRVNVSLDTLNRKLFKALTGQDALEQVLNGIKQVLEAGFST---VKINMVVMKGVNSGELADFARLTLE---YPFQVRFIEYMPFNFG----ENYLMTAADMLEQLAATGITGLIAVPGQL-TTARIYRLPDAKGGFISPVSQHFCSCCNRVRITPDGFLKPCLLTNLEYPLRD.............. 279
172 0.000e+00UniRef50_A0A191HU32 GTP 3`,8-cyclase n=1 Tax=endosymbiont `TC1` of Trimyema compressum TaxID=243899 RepID=A0A191HU32_9FIRM  ali  17  3.......................................................TIDYLRIAVTDRCNLRCVYCMPEEGHDEMLSIEEVEKLVKSVAPMGIKKIRLTGGEPLVRKNIEILVKKIAS---VEGVEHITMTTNGILLGSMAKALKVSGLNRVNISLDTLKADKFKAITRWGDLNDVLAGIDASLKFGL---TPVKINVVAMKGFNDDEIIDFVELAIKKRV---QVRFIELMPIGESDEKARIEHISIDAI-KAIIEEKYKLISTDDIVTDGPASNYFIEGHPGGFIGSLSNHFCGRCNRLRVTADGKVRLCLHKDVEFDLREGKSE.......... 285
173 0.000e+00UniRef50_Q9HXD6 GTP 3`,8-cyclase 1 n=1888 Tax=root TaxID=1 RepID=MOAA1_PSEAE  ali  18  5.................................................IDGQGRQIDYLRLSVTDRCDFRCVYCMAEDPRQQVLTLEEIERVARLFVAGGVRKLRLTGGEPLVRPGIVGLCERLAAL---PGLRELCMTSNGSQLVRYARPLYDAGLSRLNISLDTLDPLRFRAITRNGELDKVLAGIDAAQAAGFR---RIKLNAVVMKGRNADEVPALVDFAIARG---LDISFIEEMPLGQVGRERGESFCSSDEVRALIAQRHALLD--SAEQSGGPARYVRLVEHRIGFISPHSHNFCATCNRLRLTVEGRLLLCLGHEHSLDLRALLR........... 286
174 0.000e+00UniRef50_T1J5S9 Uncharacterized protein n=3 Tax=Opisthokonta TaxID=33154 RepID=T1J5S9_STRMM  ali  17  1...........................................................................MPAEGKERLLTTSEIVTLAKLFINEGIDKIRLTGGEPLIRSDIEEIV---GDLKKIPGLKWLAMTTNGIVLKRKLSALRQAGLDALNISLDTLVPVKFEFITRRNGWKKVIEGIDCALELGYD---PVKINCVVMRGLNEDEINDFVAFTKDKKV---DVRFIEYMPF-DGNKWNDKKMVPYQEMLGIIKSKYPDIKRLEDKD-NDTSKAYKVDGFAGGFITSMSEHFCGSCNRLRITADGNLKVCLFGNSEVSLRDALRSGVSEDELLS. 266
175 0.000e+00UniRef50_A0A2A5CPA1 GTP 3`,8-cyclase n=15 Tax=root TaxID=1 RepID=A0A2A5CPA1_9BACT  ali  15  18..........................................LPANPPIVDRFGRTFNYLRIALNEQCNLRCIYCMPEEGEDKLLTTKEIFRIIQIAAEMGVSKIRFTGGEPLLRKDLPKLIQYANQTK---GVESTHLTTNGLLLGKYLSQLEDARLTGINISLDTLNPEKFKIITRRDGVNLVLAGFKKAIKSSIKT---VKINIVAMRDFNDDELMDFVTLTKEN---DITVRFIELMPFDSHQIWKTGKFYRAKQIVSDLKTLTVGLKPVEGSSTEHH--VFRIDGYKGKVIPAYSRSLCGACNRIRITADGKLMNCLYSQEESNLRDAMRTGKTDE..... 312
176 0.000e+00UniRef50_D2QPI7 GTP 3`,8-cyclase n=92 Tax=Bacteria TaxID=2 RepID=D2QPI7_SPILD  ali  16  1...............................................MIYDNHNRPISYLRLAVTDRCNLRCFYCMPEEGKHQVLTYEEMERLVRVLARLGVQKVRITGGEPFVRAGLMDF---LHRLAEIDGLNDISLTTNGVLTAPHIPALAALGVKSVNLSLDTLDRERFYKITRRDELPAVLKTLDALLEA----GIQTKINAVVMDGQNTQDLVPLTEMT---RTMPVDVRFIEEMPFNGEGSHYPVLNWTHRRIIDEIRAHFPDLQKL-PDPPFSTSANYQIPGHQGGVIAAFSRTFCGSCNRIRMTAQGTLKTCLYDNGVLDVRALLRSGASDEEL... 292
177 0.000e+00UniRef50_K1L1S5 Putative molybdopterin cofactor synthesis protein A n=16 Tax=Bacteroidetes/Chlorobi group TaxID=68336 RepID=K1L1S5_9BACT  ali  15  1...............................................MLIDQHNRIHDYLRISLTDSCNFRCAYCMPNEPQSRLMSTAEIDQIAGVFVEQGVKKIRLTGGEPLVRKAFPEILDRLSKYPV-----ELTMTTNGILVHKHIDQLKQVGMRTLNVSLDSLNRETFLKLTKRDQLDQVWNNIL----LLLKEGFRVKINAVALNGIIEKEILDFVALTKE---YPLHVRFIEFMPF-EGNHWKVDK-VITAKHMLDMVKEAYDVVKLQDEPH-ATAKKYMVPGHQGTFITTMSEHFCGDCNRMRLTADGKMKNCLFGKEEMDLLGTLRQGKD....... 284
178 0.000e+00UniRef50_Q8Y0K4 GTP 3`,8-cyclase n=1349 Tax=root TaxID=1 RepID=MOAA_RALSO  ali  16  2...........................................PAQGWLADTYGRRLHDLRISVTDRCNFRCIYCMPKDQHSELLSFEEIERMVRLFIEHGVEKIRLTGGEPLLRKDIERLVEMLARLNTRDGPLDLTLTTNGALLARKAQALKDAGLTRVTVSLDAIDDATF---RRMNDVDFAVAEVLHGIEVAQRVGLPLKINMVVKKGDNDDQIVPLARHFRNSG---IILRFIEYMDVGVTNHWEMASVVPSAEVIRRLSAA-FALEPLSANYAGETAERWRYADGAGGVISSVTQAFCHDCTRARLSTEGKLYLCLFATQGFDLRALLRGGASD...... 304
179 0.000e+00UniRef50_A0A2N6EW80 GTP 3`,8-cyclase MoaA n=2 Tax=Desulfuromonas TaxID=890 RepID=A0A2N6EW80_9DELT  ali  16  2...............................................RLVDPYQRTINYLRLSITDRCNLRCCYCQPHDPRNRLLTDKEIVFLAKQAIALGVEKIRVTGGEPLVRPGV---IALLNDLRALDGLKHLVLTTNGVLLTRHADELVSAGLSRINVSIDSLRQNRFYEITRGGSLVDWWRGVDAAEKA----GLAVKLNVVVMAGVNDDEVVDFVRFGSQRGW---TVRFIEYMPFAGEAYQPLDEQVL----RDRLDQAGFALTPVSGSQIAGPAREYAVAGGKVGFISARSCPFCHDCNRLRITANGEGRGCLFSSEGIDLR............... 276
180 0.000e+00UniRef50_A0A2H5WV47 GTP 3`,8-cyclase n=1 Tax=bacterium HR15 TaxID=2035410 RepID=A0A2H5WV47_9BACT  ali  12  2...............................................PLRDRFGRVIEYLRVSVTERCNMRCVYCVSPEPHGEQLSFEEIATVVRTLAPHGLRRVRITGGEPLVRPHIPELVGMLAQ---IPGITDLSLSTNGILLPRYADALKRNGLKRVNISLDTLQPLKFRQISPAGRWEDVWAGIEAALAVGLS---PVKLNCVLMKGINDDEILDLARLTLN---QPLHVRFIELMPIGNLAFYRQGHMLPISE-AKARCAQLGELIPVVQGEGGGPAEVFRLPGAQGGFIGACTANFCHRCNRMRLSADGYLYPCLGHGVRVDLK............... 284
181 0.000e+00UniRef50_A0A2W4MXB6 GTP 3`,8-cyclase MoaA n=1 Tax=Firmicutes bacterium TaxID=1879010 RepID=A0A2W4MXB6_9FIRM  ali  16  25.......................................PPGMPVKGPLVDQFGRVVRKLRVSLTDRCNFRCLYCMPDGPSEEILSVDEIERVVRICARMGVEKIRLTGGEPLLRPGVEEIVERIR---GIPGIRAVSMTTNGFLLEEKAAALKAAGLQGINVSLDSLDRDRFRQLTRRDELERVLAGIRAAARAGLE---PIKINAVVMRGINDGEIETFLRWAREQPVQ-LTIRFIEFMPLDGSNVWTRDLVYTADEILEQARRVAP--VEEVHNDPSDPARLYRFADGRGGIIASVSRPFCHACDRIRLTADGKIRNCLFAVEEYDLREMLRAGATD...... 323
182 0.000e+00UniRef50_A0L7R4 GTP 3`,8-cyclase n=1 Tax=Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1) TaxID=156889 RepID=MOAA_MAGMM  ali  14  2...............................................PLVDRFNRTISYLRVSVSEQCNMRCNYCRVPEQESQLLSFAELSRLLARFAQLGIGRFRLTGGEPLVRKDLAQLVAGLHQL---AGVEEISLSTNGLLLPRFAKALKEAGIARVNISLDSLDPSGFQKICGVGSPDEVKAGILAALEAGL---TPVKVNMVVMGGVNDHEIPHMVTFA---REHGLTLRFIETMPIGKAGQQVMGSYLSSDAILERVRQAVGALIPITGFKGPGPACYYRIGDAEVGVISAMSRHFCDTCNRMRLTADGHLVLCLGQQDRVDLREGASDAQLDEIIL.. 300
183 0.000e+00UniRef50_A0A2E5HLM7 GTP 3`,8-cyclase n=2 Tax=Bacteria TaxID=2 RepID=A0A2E5HLM7_9DELT  ali  13  1....................................MERQTQQSGAGGLVDRFGRRVSYLRLSVTDRCNFRCVYCMPEEGSRELLSYEEIERVVGALAACGVERVRVTGGEPLVRKELPRLI---ARLNAIPGIREVVMTTNGTLLRRDAAALREAGLRSVTVSVDSLNAARFAQITRGGDLGRVLDGIDAAEEA----GLSVRINTVVVRGVNDDE---LLELAGRALRRRWLLRFIEFMPIGAETIWSDRGGCVPAAEIRAVLGARWRLRELGMTTGAGPARYLNLDGPDVGIISAVTECFCSACNRIRLTPQGGLRACLADDRETSLRDLMRGGASDQEL... 315
184 0.000e+00UniRef50_UPI00093102B3 GTP 3`,8-cyclase MoaA n=2 Tax=Terrabacteria group TaxID=1783272 RepID=UPI00093102B3  ali  15  1................................................MIDQFNRKITYLRISLTDRCNFRCRYCMPEEGIDDIMSYEEILRIVRVCAGLGIEKVRISGGEPFVRKNPMDFLEKLAK---IQGIKDIGITTNGSLVLPYLDRLEKAGIKRLNFSLDTLKKDKFAYITRRGNFETTMQAIERAID----RGFKVKINCVLMGSFNTDEIDDFVYLTKDN---DIDVRFIELMPIGPAGAFKKEIFFKNSDLLDRLFKEYPGKEPLEEVETDGVAKMFKICGYKGRIISPISHSFCASCNRIRLTADGKIKPCLHSAKEYDLKGLEGE.......... 289
185 0.000e+00UniRef50_A7GU01 GTP 3`,8-cyclase n=161 Tax=Bacteria TaxID=2 RepID=MOAA_BACCN  ali  14  2.............................................HEKVRDSFGRPLQDLRISVIDRCNFRCTYCMPAEQEEFLLTFDEIERLAKLFAGIGVKKIRLTGGEPLLRKDLPKLIKRLASL---DGITDIGLTTNGIHLTKQAKALKEAGLQRVNVSLDAIEDNVFQKINGRNVSTKVLKGIIAA----KEVGLEVKVNMVVKKGMNDSQVLPMATCFKEQG---IPLRFIEFMDVGSTNGWNFEQ-VVTKQELIEMIGNVYPIEPAEPHYFGEVAKRYCYIGSEVGFITSVSESFCSSCTRARISADGKFYTCLFATEGTDLRALLRTNCSDNELL.. 301
186 0.000e+00UniRef50_W8F2M6 GTP 3`,8-cyclase n=190 Tax=Bacteria TaxID=2 RepID=W8F2M6_9BACT  ali  14  6.............................................SSVLFDNHGRPLEYLRLAVTDRCNLRCFYCMPEEGKQELLTYEEMERLVAIMAGLGVRKVRLTGGEPFVRRDLVPFMD---RLSQIPGIEELTMTTNGVLTAPHVPEMARMGLKAVNLSLDTLDRARFASITRRDELPRVLDTFYALLAA----GIRLKINAVVMDGQNTQDLLPLAELTRDL---PVDVRFIEEMPFNGGSHDAASLPWNHHRIREHLQLNLGELTP-VPTRSGDTASHYTVAGHQGGIIAAYSRTFCGTCNRIRLTAEGGLKTCLYDQGVLDIRALLRGGSSDEQIAE. 301
187 0.000e+00UniRef50_A0A1F8XHJ3 GTP 3`,8-cyclase n=3 Tax=unclassified Deltaproteobacteria (miscellaneous) TaxID=122706 RepID=A0A1F8XHJ3_9DELT  ali  15  1...............................................MLRDPYGRLVDYLRVSVTDRCDLRCVYCMPPEGIPEILTYDELIRTVRVAASLGVRKVRVTGGEPLVRRGIVSFVRRVAGIR---GIRDLGMTTNGTALSGMAVPLRQAGLSRVNISLDTIRRDRYAEITRRDALPKVIEGIEAAIRAGLS---PVKINVVLLHGLLRSEVDDFFTMA---REMPVKVRFIERMPIGC---SPSEGYVSAAGIRERILSL--PGVREERNGASSAAVTFEVPGFAGGIISPVSWKFCSDCNRLRVTADGRLRTCLFGRETLDLRGVLRSGRGDD..... 287
188 0.000e+00UniRef50_A0A2N7Q7A0 GTP 3`,8-cyclase n=1 Tax=Candidatus Aminicenantes bacterium TaxID=2052149 RepID=A0A2N7Q7A0_9BACT  ali  15  1................................................MKDRFERQINYMRISVTDRCNLRCFYCFSFIAHEEILTYEEILRLVRLALQLGINRFRLTGGEPLVRKGIEHLVQEINSL---DEVRDLSLTTNGVLLLNYLEKLKAAGLKRLNVSLDSLQPEKFKKITGFNKLQNVLEAIVRAVDLGFE---PVKINVVLLKGIND-EIENLLRLAYEL---PVHLRFIELMEFS-----PVDGYFVSGKKIYEQLAQKYKLEPVAVAGSGPARNYYRIKGMKGGFILPYSDHFCGSCNRLRLSADGKLQTCLFSNETTDLKGPLRGGATDEDIL.. 288
189 0.000e+00UniRef50_A0A010YZ07 GTP 3`,8-cyclase n=13 Tax=Clostridiales TaxID=186802 RepID=A0A010YZ07_9CLOT  ali  17  1................................................MKDSCNRTIDYIRISVTDRCNLRCLYCMPEEGHEDILTYQEIVRICEAGARLGIRKVKVTGGEPLVRKGIEVLIKELAE---IPGIEDVTMTTNGCLLKEKSAELKAAGLSSVNVSLDTLDPRRFARITRRDCFESVMEGIDSALAA----GLKVKINCAVMEDLTKEEVLAFARFSMERR---IPVRFIEMMPIGQGKNYKA---LENDDLAGILSEAFGELKESREVKGNGPAVYYTWGDETGGFISAVSHKFCHNCNRVRLTSDGFLKLCLDSPAGVDLKGPLREGISDD..... 287
190 0.000e+00UniRef50_A0A1Y2K6C0 GTP 3`,8-cyclase n=1 Tax=Magnetofaba australis IT-1 TaxID=1434232 RepID=A0A1Y2K6C0_9PROT  ali  16  3................................................LIDPFGRAITYLRLSVTERCNLRCHYCFNEREDDQVLSMAELTRLARLFVELGVERIRLTGGEPLLRQG---IVEMVAELTALPGLQEVNLSTNALLLERLAEPLKLAGLGRINVSLDTLRQPTFTQICGAGDPARVVAGIDAAIDVGLA---PVKCNMVVMGGVNDDEIGDILNFA---RQRGVTLRFIETMPIGEAGAQSMSRYIPAQEILSRVSTLLGDLIPATEHRGPGPARYFHIAGATVGVISAVSQHFCDSCNRVRLTSEGQLALCLGDVGRVDLRAPLRSGAQDE..... 294
191 0.000e+00UniRef50_A0A183EPV4 Uncharacterized protein n=1 Tax=Gongylonema pulchrum TaxID=637853 RepID=A0A183EPV4_9BILA  ali  16  14........................................SSLPESHKLVDAFGRQHKYLRISLVEKCNLRCRYCMPEEGSDKIMRLEEIVRLATVFAESGVKKIRLTGGEPTLRKDLVEIVE-------INGIEHVAMTTNGIAARRKLETLAKNGLRSVNISLDTLDPERYLEVTRRRGLNEVLRTIELAI----SIFGFVKINSVVIRDFNDDEVPAFVRLTQNKQNKNIEVRFIEYMPF-MGNNFTTKKLISYKELLKRLDGEFPQILKIANEPNS-TAKIYKVQGFRGGFISSMTEHFCGSCDRLRITADGNLKVCLHGSSEVSLRDILRSGGNEDIR... 332
192 0.000e+00UniRef50_A0A1J5E4B4 GTP 3`,8-cyclase n=5 Tax=Candidatus Desantisbacteria TaxID=1819803 RepID=A0A1J5E4B4_9BACT  ali  15  3...............................................MLIDNYQRQVNYLRISITDMCNLRCLYCQPEAGHREILRYEEIIKLASLMVQLGIKRIRVTGGEPLIKKDVLLLIKGLAR---IDGLEELTLTTNGTKLAQFAEQLKENKVDRINISLDSLNRERYSSITGGGNLEDVLAGIDEALSVGL---VPLKINMVVMKGINDDEVESFARLTLD---KPVIVRFIEFMPISQQGVEWDERYLPAYILKQRLSSNFPKGREDNSVHGNGPAEYYQIKGAVGGFISPISDHFCVSCNRLRLTPDGHLRLCLGQDAEVDLKLPLRQGATDEEL... 310
193 0.000e+00UniRef50_A0A254WUI2 GTP 3`,8-cyclase n=1 Tax=cyanobacterium TDX16 TaxID=1503470 RepID=A0A254WUI2_9CYAN  ali  17  114......................................................RAVRTLRISVTDRCNFRCVYCMPEDPRETLLDFEEIRAIAAAAVRHGITAFKITGGEPLVRHEVPRLIAMLRAL---PGVTELSMTTNGALLDEYAVALKAAGLDRLTVSLDTLDRERFRGITRGANIDDVWRGIRAAVAAGFKHP---KINCVAMRGINDDEYADFARLTIET---DVTIRFIEYMPLGRTALEYEARFISESQIRSHIESSFGPLEPASPDSGHGPAKVWRVHQAAGGFISAMSKPFCETCNRLRLTAEGQLRSCLFDGGEVELRPLLRESASDGDLL.. 403
194 0.000e+00UniRef50_Q1III4 GTP 3`,8-cyclase n=60 Tax=root TaxID=1 RepID=Q1III4_KORVE  ali  18  12................................................LTDKFGRTINDLRLSITDRCNYRCVYCRSGNNGPSELRFQDYVRIARVFVSLGITKIRLTGGEPLLRRDLLELVRELRALKTLDGEPDIAITTNGHLLADLAQPLKEAGLNRVTVSMDAVDPELFAKITRVNGFEKVVQGVRAAKAAGL---TPVKVNCVLLRGFNEEQIVPFGVFAREEGVV---VRFIEFMPLDEDRHWSPEIVVPLNEVVARL-NTYMPLRHL-DHGHSETARRYVFEDGRGGIIAPVSLPFCGACSRIRVTSDGKIRTCLFSVREHDLASLILEGASDEEIAD. 306
195 0.000e+00UniRef50_UPI000A05CA01 GTP 3`,8-cyclase MoaA n=1 Tax=Hippea sp. KM1 TaxID=944481 RepID=UPI000A05CA01  ali  18  1................................................MIDRFGRRINYLRISITDRCNFRCIYCMPKDGIEEILSYEEIALFVLVAAELGINKIKLTGGEPLVRKGIDGLVSM---LKSINGIDEISLTTNGSLLKKYARGLKEAGLDRITISLDTLKPDRFRLITRLGNIEDVLEGFDVLDELGFK---NTKINTVVMRGVNDDEVLDLMEFALNRGV---DIRFIEFMPTDVVKDW--QRYFISINDIKSIIETRYTLKPADK-KSNGPSVYYSVGDGFVGFITPLSKTFCSVCNRIRLTSDGAILPCLGHPDRVSIKEAARKGDKDRLK... 288
196 0.000e+00UniRef50_A0A0B2UNN5 Molybdenum cofactor biosynthesis protein 1 n=2 Tax=Ascaridoidea TaxID=33256 RepID=A0A0B2UNN5_TOXCA  ali  17  26.......................LEVQQLRRPVLADEFAPSAENTVEGLVDAYGRRHTYLRISVAEKCNLRCTYCMPEEGVPKLLSADEIVRIATIFAANGVTKIRLTGGEPTLRKDIVDIV---GRLSVIPGIEQVGMTTNGIALPQKLEALVDNGLKKLNISLDTLNEAKYMIMTRRNGFKKVIKSIN----LAESMFDQVKINNVIIRGINDDELIDFVALTQYRK---LDIRFIEYMPFG-GNKFEVRKMVPYREMLKVIDKSFPMIIKL-KDQPNDTSKAYSVHGFRGGFISSMSEHFCSSCNRLRVTSDGNLK........................... 316
197 0.000e+00UniRef50_V7I2I7 GTP 3`,8-cyclase n=2 Tax=Clostridiales TaxID=186802 RepID=V7I2I7_9CLOT  ali  16  1................................................MIDQYGRSIEYLRISVTENCNLKCIYCNPDDKGANYLSPVEIEKIVKAMAKIGIRKIRITGGEPLVRPDVCEIIERIAK---VPGIEDISMTTNGINLDTMAEKLKAAGLNRLNISLDTLKADKFSYITGGGDITRTLRGIDKALELGL---IPVKLNTVLIKDINDDEIDDLIALAKD---KPIEVRFIELMPIGFYGEKNKDKIMYSDE----VIEARPYLKFLKKTDKGAPATYYGIDGYLGGFISPMSHKFCGDCNRIRLTSDGKIRPCLGHNGEIDIRG.............. 278
198 0.000e+00UniRef50_Q8NR60 GTP 3`,8-cyclase n=1003 Tax=Bacteria TaxID=2 RepID=MOAA_CORGL  ali  17  42................................................LVDRFGRIARDLRVSLTDRCNLRCTYCMPAEGTEQTLNDAEVLRLIRIAVKLGIRQIRFTGGEPLLRKNLEDIIAGTAALRTDEGEKHIALTTNGLGLDKRIAGLKEAGLDRVNISLDTIDAERYVSLTRRDRLSGVLASIDAAVAAGLH---PVKINAVVMPGVNEVDIVPLAEYCISKGS---QLRFIEQMPLGPREQWKRGDMV-TAEEILARLEEKFTLSPAKEPRGAAPAALWNVVDGQIGIIASVTHPFCGDCDRSRLTTDGTIRNCLFSRTETPLRDALRDGASDDEL... 343
199 0.000e+00UniRef50_A0A2E0FLZ7 GTP 3`,8-cyclase n=4 Tax=cellular organisms TaxID=131567 RepID=A0A2E0FLZ7_9FLAO  ali  14  3...........................................ERQKILQDSFGRIHDYLRISLIERCNLRCFYCMPEEGRSEFMRNEEVLELAEQFVGLGVKKIRLTGGEPLIRKGVEDIIEGLAKLPV-----ELTLTTNAVRVNEYVHVFKDADIKQLNVSLDSLDRERFRSITRRDYFDQVMNNI----ELLLMEGFKVKVNAVLMRGENEDEILDFVRWTEQT---DIHIRFIEFMPF-DGNKWNWEKKVSFQEILDKVTGAYGDGVVQLPTEKNATARNFRLLNGKGGVISTLTNPFCDSCNRIRLTADGKIKNCLFSNQEVDLLGPLRSGQSVEPLI.. 298
200 0.000e+00UniRef50_A0A0X1U8R2 GTP 3`,8-cyclase n=2 Tax=Clostridiales TaxID=186802 RepID=A0A0X1U8R2_CLOPR  ali  18  1................................................MQDNFGRQIEYLRLSVTDRCNLRCRYCMPESGHETILRNEEYLQIVETMATLGIKKVRITGGEPLVRRGLPSLIQEIKR---IEGIKDISLTTNGILLESQVEELKEAGITRMNISVDSLVPESYQQLTRGGNLASVLRGIEKARELGLS---PIKINVVLIKGFNDHEVEHFLNYFDPS----IEVRFIELMPIGEAAAWNKDRFLNLNE----FLLNRLDLTPEPNHGNGGPCRYYRHTGRWVGIINAISDHFCLSCNRLRVTADGMLKTCLHSTTEVDLK............... 276
201 0.000e+00UniRef50_N2AFM8 GTP 3`,8-cyclase n=9 Tax=Clostridiales TaxID=186802 RepID=N2AFM8_9CLOT  ali  17  1................................................MKDQYQRVVDYIRISVTDRCNYRCQYCMPREGHSEVMTYDEILRLVKAAAGAGITKVKITGGEPLVRKGVCGLIRNIR---LVPGIESVTVTTNGALLCRFLPELAAAGVSGINISLDTLDKDKFHRLTRRGEFSEVWEGIRQTILA----GIPVKVNCVPMVGINEDELVDMAALAWK---YPITVRFIEMMPIGLGSGYTA----VTQDEIKKLLEAQFGYMELVKESGNGPAVYYQLPEFRGGFISALSRKFCRSCNRIRVKADGTLKLCLNYEGHINLKQEMRNGIDDREL... 289
202 0.000e+00UniRef50_I4C3W1 GTP 3`,8-cyclase n=3 Tax=Bacteria TaxID=2 RepID=I4C3W1_DESTA  ali  15  2.............................................SNSLMDAYGRTIQYLRVSITDLCNLRCIYCRPPEGHEEILRYEEILAIVGIFRDLGIKKIRVTGGEPLVRRGVREFIARLAAMK---GIEDVGLTTNGVLLASMAKDLRAAGLKRVNVSLDSMDRENFRRITGSDKLELVLKGIREALAVGFS---PVKINVVLLQGINETDVAEFARLTI---HEPVYVRFIERMPFGSESLPSSPDSFSAHRVLEMIRKEVGELKIMDREPLDGPATMYTLKGAAGGIIDPVTGHFCGTCNRMRLTARGTLRPCLLGSAEIDVKTPLRHGA........ 292
203 0.000e+00UniRef50_A0A212KC55 GTP 3`,8-cyclase n=3 Tax=Desulfovibrio TaxID=872 RepID=A0A212KC55_9DELT  ali  18  29...............................................PLCDGHGRVVRYLRLSVTDRCNLRCTYCRSEIPHPKVLRYEEMARLVGMMAALGVSKVRLTGGEPFARKGCDELLHMLHTRYPSLDLR---LTTNGTLLEPHISLLRSVGVSAVNLSLDSFDRETFARVTGRDLLPAVLASLDGLLQA----GIRVKINAVAMRGVNDGQMDDFV---HAVRTMPVDLRFIEFMPMGSGTLWGPETFWSAADIRAEAERRVRLDPVQDSSAEAGPAKMFAVQGGKGGFITAVSCHFCGTCNRLRLTSDGNLRTCLFDDREYHLRGLLRN.......... 314
204 0.000e+00UniRef50_A0A2E9QMB7 GTP 3`,8-cyclase n=2 Tax=Bacteria TaxID=2 RepID=A0A2E9QMB7_9DELT  ali  14  1...............................................MLQDAYGRTIRDLRISVTDRCNYRCFYCKPVHSRAGIMTYEEIIRLANVFVHLGVNKLRITGGEPTIRRELPFL---LKELASIPGVDDLAMTTNAHFLAKQAQMLKDTGLHRLTVSLDSLRQDRFKEVTGVDGLKKVLHGIEVAQQVGFD---PIKINVVVIRDVNDDELLDFAHYARETGN---IVRFIEFMPLDADKQWDHKR-VVTQAEMLQRLQEIETLEPINRSYTSETANKFRFADGKGGIIASVSAMFCGQCSRMRLTADGKLRPCLFSEKEYDILSVMRAGCSDEELID. 295
205 0.000e+00UniRef50_UPI000B9822BD GTP 3`,8-cyclase MoaA n=1 Tax=Clostridiales bacterium SK-Y3 TaxID=1792311 RepID=UPI000B9822BD  ali  20  1................................................MEDCHGRTINYLRLSVTDLCNLRCRYCMPAQGHKDILKLEEIELLAQEFVALGIDKIRITGGEPLVRKGILTLIEKVAS---IDGLKDFSMTTNGTLLKKFAKDLKAAGLKRLNVSLDTLNDEKYSYITRGGSLKHVLEGIEEAQKAGLN---PIKMNVVVIKNFNEDEIDNFINLT---RYINMDIRFIELMSIGEAARWSNNRFLS----NTKILDKRKELIKMAKEDPASPADYYKLPDGIGRIISPISCKFCQSCNRIRLTADGRLKHCLHSDDEINLKELL............ 280
206 0.000e+00UniRef50_A0A1Y3XFF0 GTP 3`,8-cyclase n=1 Tax=Gemmiger sp. An50 TaxID=1965639 RepID=A0A1Y3XFF0_9FIRM  ali  13  1................................................MIDSYGRRITYLRLSVTERCNLRCRYCMPEEGISEMLTEDEMIAAVQAAASLGITKLRITGGEPLVKRNIVSICRRA---CAVPGIQDVAVTTNGLALPALAKPLRQAGVNRVNISLDTLDPEKYRHITRIGRLDQALAGIRAALDAGFD---KVKINVVLIGGFNDDEIVPLANLT---REYPVDVRFIELMPMNSSPEFGPAAYLPSRIVLEQLPDA-----SALPES-DGVARLYRLPGALGGLISPVSNHFCAQCNRIRLTADGKLKPCLHSAVEYPVKGLSSAEMLEQFR... 287
207 0.000e+00UniRef50_A0A2A4TZ04 GTP 3`,8-cyclase n=1 Tax=Elusimicrobia bacterium TaxID=2030800 RepID=A0A2A4TZ04_9BACT  ali  16  5.................................................VDNFGRTARKLRISVTDRCNLRCVYCMPEHPKKEILTFEELTRIASIAARHGVDRLRVTGGEPLLRKDLSVFINM---LKGIAGIREIALTTNGLLLPQQARALYAAGLDRVTVSVDSLHRERVLKLARRDVRDGVLAGIEAARAAGFE-GERLKINVVVMRGRNEEEVGDITAWAREQN---LHLRFIEFMPLEGDKIWSRSLLVPAEEIISRVKERFP--LNVGVRKPGETAETYSFIDGKGGVIASVTQAFCGDCDRVRITADGGFRTCLFAASGTDLRGPLRSGVSDEGLAEY 298
208 0.000e+00UniRef50_Q7UT69 GTP 3`,8-cyclase n=23 Tax=Bacteria TaxID=2 RepID=MOAA_RHOBA  ali  18  30................................................LVDRFGRRHDSLRISITDRCNIRCFYCMPEHPRSGVLTFEEIERLAGLLVKCGVRDIRITGGEPLVRRDCVDLIRMLAR---IDGLEDLSMTTNGMLLRDHAADLRSAGLKRLNVSLDTLDEATFVKIARRPGVDRVIDGIDAAIEAGFES---IKLNALAIRGLSESELVGLVRFSIE---KSVTLRFIEFMPLDSDRAWKSKDVLSGDACLKLLSEAFGDVTPTGRENPSAPAETFRCDGREGGIIRSVTRPFCGDCNRLRLTADGGLRNCLFSQSETPLRDAMRSGCDDDKLI.. 326
209 0.000e+00UniRef50_A0A1F5RET2 GTP 3`,8-cyclase n=1 Tax=Candidatus Edwardsbacteria bacterium GWF2_54_11 TaxID=1817851 RepID=A0A1F5RET2_9BACT  ali  16  1...............................................MLSDQFGRKVNYLRVSVTDRCNLRCRYCIPQDGHDDMLSFEEIETIVRAGVELGINKVRLTGGEPLLRKGFPELVK---KLAAIEGLKDLALTTNGILLGPLARELKQAGIKRVNVSLDTLKPERFKQMTGSDQWQQAKEGFEKALTAGFE---QVKLNVVAIAGYNDDEVEDFVKYAMD---KPIQLRFIEFMPVG-NKFWEKGKQLNSKQLIERI-SKITAIVSLPPLKNS-VAEEYQIVGATLGFISPLSHSFCRGCNRLRLTADGFLKPCLASKYEVNIK............... 279
210 0.000e+00UniRef50_A0A2A4ZYS5 GTP 3`,8-cyclase n=10 Tax=Bacteria TaxID=2 RepID=A0A2A4ZYS5_9BACT  ali  14  26.................................................TDQFGRTFNYLRIAVNEKCNLRCIYCMPEEGKNEILTTEEILRVVKVVSDLGVNKIRFTGXEPLLRGDITKLV---GKSXSTPGIESVHLTTNGVLLDRYAGDLKESGLAGVNISIDTLNIEKYIQITRRDELXRAMEGLEAA----KTAGIPIKVNAVALRGFNDSEIVEFVELTKD---YPLTVRFIELMPFDAHQIWKTGKFFSAEHIQKELKDHFPNIKITT-----GTATIFQVPNYAGKVIPSYSRNLCGNCNRIRLTADGNIRNCLYAHNEFNLKELMRSGGTEEELKE. 317
211 0.000e+00UniRef50_S0G7P4 GTP 3`,8-cyclase n=2 Tax=Desulfotignum TaxID=115780 RepID=S0G7P4_9DELT  ali  17  5.....................................................GRPINYLRISVTDRCNFRCRYCVPASPHNEIARYEEILRITRLACDMGITKVRLTGGEPFVRKNILSFIQ---QLCAINTLKDISITTNGSLLTEKIQALLDMGIRRLNFSLDTLVPARFEAITRRNRFDHVWESIMTAHELGMA---PIKINTVVIRGINDDEVADLAALTLNF---PFHIRFIEYMPMGESHL-EKQQQVLTAEIRQNIETRLGPLQQIPHRANDGPSKNFQLSGGSGGFITPISSHFCSECNRLRLTSRGYLRPCLLNDYEKDLREGATDEQLKEII... 296
212 0.000e+00UniRef50_A0A074YWL7 Uncharacterized protein n=2 Tax=Opisthorchis viverrini TaxID=6198 RepID=A0A074YWL7_9TREM  ali  16  4..................................QAVALGLRLFPVRQLVDKCNRIHDYLRISITENCNLKCNYCRPSCTKQQFISAEHILFLAAYFVRRGVSKIRLTGGEPLMRKDLPEIIESLNGLRKYNGLKNISMTTNGIAFAKRAKQFKELGLDSVNISLDSLKPERVKQLTGSPVLKHAYTSIYSALGSGYN---PVKLNCVVIRGFNDDEICDFVGLTK---HLPIELRFIEFMPFGGNN-WDTEKLVSYKEMLNTIRKVYPDLYPLPVPFSN-TAKLYRVNDWPGGFITSMTENFCSNCSRLRLTADGHLKTCLHGEEEVDL................ 299
213 0.000e+00UniRef50_A0A0S7WMZ8 GTP 3`,8-cyclase n=1 Tax=candidate division TA06 bacterium DG_24 TaxID=1703770 RepID=A0A0S7WMZ8_9BACT  ali  16  5.................................................TNPRGAPIDYLRVSITDRCNLRCIYCMPPEGHESILTYEEICMVVRVGVQCGIRKVRITGGEPLVRRNV---LGCVTSLGQISGLQEVSMTTNGVSLCDFAADLRIAGVDRINISLDTLDREKFKRITRRDSLVSVLRGIDAVLRLGFE---PVKINVVAMKGLNDDEIGAFGKLTID---RPLHVRFIEFMAVGGLAQRQSGLFFP-AEAVKKRLETIGALEQAGRIRGNGPARYFSYRNALGTVISPLSNGFCEACNRLRLTADGNLRSCLLSDDEIDVKGPLRSGSSEK..... 293
214 0.000e+00UniRef50_E6U3C7 GTP 3`,8-cyclase n=9 Tax=Firmicutes TaxID=1239 RepID=E6U3C7_ETHHY  ali  18  7......................................................RVVDYLRVSITDRCNLRCRYCMPDKGHSETLRYEELLRVVACAARAGIQKIKVTGGEPLVRRGVLGFLEKLRGIK---GIRQVTMTTNGILLPQFLPQLAQIGVEAVNVSLDTLNPETFRAITRRDGLADVLRGIDAALTL----GLRIKINAVPIAGLNEDELPALAELAKD---KPLDVRFIELMPIGCGAAFTP---VKTDEVRHRLEQAFGPLMPWEGRRGNGPARYVSVEGFAGGFISPLSHSFCRTCNRLRLTATGLLKPCLASGNAVLLRTGAGD.......... 286
215 0.000e+00UniRef50_A0A2G6E2T6 GTP 3`,8-cyclase n=2 Tax=candidate division KSB3 bacterium TaxID=2044937 RepID=A0A2G6E2T6_9BACT  ali  16  2...............................................SLQDAFGRTIASLRVSVTDRCNLCCRYCMPAEGHDEILRYEEIERLIRVALALGVARVRLTGGEPLVRKGLLDFI---CRLKALEGLKALTMTSNGILLERYAESLKKCGVDSLNISLDTLNAEKFRLMTGFNQLESVLRGIAKAREAGFSL---IKINVVSLRAFNDDELFDFIEFAD---HGDFILRFIEYMPF-PGNDWHQKGFLSSKELRAKIEQRY--TLQPYDGDPSAAAKLYEIQGGKIGFISAVSESFCDRCNRLRLTSDGFLKPCLHGPLEIDLKSPLRRGAQDSELM.. 293
216 0.000e+00UniRef50_A0A1F3QDQ6 GTP 3`,8-cyclase n=186 Tax=root TaxID=1 RepID=A0A1F3QDQ6_9BACT  ali  15  3.............................................SKNIIDQHHRIHDYLRISLTERCNLRCVYCMPEEGNSKYMSKAEIIQLANVFVSLGVKKIRLTGGEPLIRKDVAEIIKELSKLPV-----ELAITTNGILIDTYLNTFIESGLRSINVSLDTLKKDKFNTITRRNYFDKVMANIQLLIKN----NFHVKINAVIIKGQNDDELIDFIEFTKT---QPVHFRFIEFMPF-DGNKWNWDKGVSYQDILKLTSEKYGNELKRLEDKKNDTAKSFKIKNYLGTFISSVTNPFCDTCNRIRLTADGKIKNCLFSDSETDLLTALRSGEN....... 290
217 0.000e+00UniRef50_N1JHW7 Putative molybdenum cofactor biosynthesis protein 1 B n=2 Tax=Blumeria graminis TaxID=34373 RepID=N1JHW7_BLUG1  ali  15  51........................................NSSNFSSSLTDSFHRRHDYLRISLTEKCNLRCLYCMPEEGPSKLLTTPEIYIISSIFISEGIRKLRLTGGEPTVRKDIIPLIHQIGTLRS-QGLQELCITTNGISLHRKLDEMKLAGLTGINISLDTLDPWKFQIITRRKGLQAVMKSIERITEMNKGACFKLKINCVVMRGVNDMEITSFVELT---RDQDLEVRFIEYMPF-DGNKWNYEKMLSYVEMKEKIRLKYPGIIKIRDQD-NDTSKTYKISGFVGGFITSMTHNFCGTCNRLRITSDGNIKVCLFENTEVSLRDIIR........... 347
218 0.000e+00UniRef50_A0A1V5CZT3 GTP 3`,8-cyclase n=4 Tax=Syntrophorhabdus TaxID=513557 RepID=A0A1V5CZT3_9DELT  ali  18  2..................................................DKFNRIIDYVRISVTDRCNLRCRYCVNEAPHTEVLRYEEIIRFVRICAELGVTKIRLTGGEPLVKLDIEFL---LKEINAIDGIEDISLTTNGVYLGKKVRQLKEAGLRRVNISLDTMQPERFTYITGVDAYKEVLDSIEKAKDMGLN---PVKINTVIIRGFNDDEILDFARFAKA---WDVEVRFIEFMPFGESTLWDSTKIIPSREI-EELIRKTYALSPSLSTHK-GPAKMFNMVGSLGGFISPVSTHICKECNRLRLTSNGMIRPCLFSDTEFDVKQLLRNNAGDDELKE. 291
219 0.000e+00UniRef50_T2G9U0 GTP 3`,8-cyclase n=3 Tax=Desulfovibrionales TaxID=213115 RepID=T2G9U0_DESGG  ali  16  17..............................................SRLVDDHGRSINYLRLSITDRCNFRCKYCRPLIPHADVLRYEEMLDLITVVSELGVRKVRLTGGEPLLRRNLPWFLGAIRERTAGLESPDVRITTNGSRLAAMAGDLARLGVQWVNVSLDSLNPQTFHEITGVDCLGDV----RRGIDACLQHGIRIKVNAVAMAGVSEAELPGFIDFAKATGS---EVRFIEFMPMGENSQWSEANYLPSRLLLDQARELVSLTALDRKDTGGGPAKVFRIDDARLGFISPMSSHFCGSCNRLRITSDGRLRTCLFSDKEYRLRPALRH.......... 307
220 0.000e+00UniRef50_UPI000362203C GTP 3`,8-cyclase MoaA n=1 Tax=Sporichthya polymorpha TaxID=35751 RepID=UPI000362203C  ali  16  1.............................................MLKLADTYGRVATDLRVSLTDKCNLRCTYCMPAEGKPQLLTDEEIVRLIRIAVKLGVEEVRFTGGEPLVRNGFVGIVSEVAKLDPRPKM---SVTSNGLGMERLAQPLKDAGLDRVNISLDTVDPELFHKLTRRDRWHDVERGLAAARDAGL---VPVKVNAVLMRGQNDEHPEDLLQFCLDRG---YELRFIEQMPLDAQHGWNRADMITADEILEKLQRRFDLTPEPSSVRGSAPAERWYVDGATVGIIASVTRPFCGDCDRVRLTADGQVRNCLFAREESNLRDAMRAGTDAELAVRW 301
221 0.000e+00UniRef50_M5TB14 GTP 3`,8-cyclase n=3 Tax=Rhodopirellula TaxID=265488 RepID=M5TB14_9PLAN  ali  16  1...............................................MLTDRFGRIHRSLRISVTDRCNLRCTYCMPEHPRSEILTFEEIVRFVKIAVSLGVDDVRLTGGEPLVRSQLNLLVQ---KLNEIDGLRKISLTTNGVLLQDQLAELFAAGLRHVNVSLDALDEESFKGATRRGGLDKVVGGIDAAQRA----GMVVKVNSIAMRGLTDHQIVAFGEFTRRTG---IPVRFIEFMPLDSDGNWNTSAVLSGTEIVEMFSSQIRPLVPIER-NGSSPSADYRFDDGIGGVIASVSKPFCDSCDRFRLTADGQLRNCLFGEDSGDVRALLRGNASDE..... 290
222 0.000e+00UniRef50_A0A1T9BNQ3 GTP 3`,8-cyclase n=93 Tax=root TaxID=1 RepID=A0A1T9BNQ3_9MYCO  ali  16  1.............................................MTPLIDSFGRIATDLRVSLTDRCNLRCTYCMPAEGSNALLTAEEYIRLIGIAVELGIRSVRFTGGEPLIYKDLERIVTAVAALSPRP---DIALTTNGIGLDRKAAALRDAGLDRINVSLDTLDADRFAAITRRDRLTDVLAGLEAASAAGL---TPTKINAVLTPEQYKEDSVELLRFSLERG---FELRIIEQMPLDAGHHWSRAHMVTADEVHAAL-SREFTLSADPAPRGSAPAQRWLVNGATVGIIASVSRPFCGDCDRTRLTADGQVRNCLFATTETDLRGLLRSGADDDV.... 295
223 0.000e+00UniRef50_A0A1W9LYY0 GTP 3`,8-cyclase n=3 Tax=Desulfobacteraceae TaxID=213119 RepID=A0A1W9LYY0_9DELT  ali  15  1.............................................MSNLTDRYNRHLNYLRISVTDRCNLRCVYCLPRNPHQDILTYEEILRIVRVAVPLGISKIRITGGEPLVRKGICDFLYHLSEIK---GLSDISITTNGVFLKENIKSIRSAGVKRINISLDTLNRKKFKEITGQDCFDKVWESILLAEEAGFD---PVKINVVALRGINDDELADIAAL---SFSHPFHIRFIEYMPIGKAAYRHSDKGMLAPEIIDRL-SRLGKLLPVANGVNDGPAERYRFEGAKGEIIRPLSHHFCYKCNRLRLTASGQLRTCLLSDRQEDIKTPLRKGCSDSVLAD. 297
224 0.000e+00UniRef50_A0A2M7G2F8 GTP 3`,8-cyclase n=2 Tax=Bacteria TaxID=2 RepID=A0A2M7G2F8_9BACT  ali  20  5...............................................QLKDQWGRVARKLRVSLTDRCNLRCQYCMPEAGREEILSFEEIFRLLTIFAELGIEEIRLTGGEPLLRKDLEILLSQIQSLHF----KKVSLTSNGILLPEKMPALYQAGLRSFNISLDSLLPERFAKITRRDDYQRVLAGLNCLDRY---PDLEIKLNTVMIRGFNDDEALSFARLARERNWA---IRFIEFMPLGQGDGWLPQEVVKGAELKAQI-EAEFRLVAVEAAGKNPASRWHFADGSPGGFINAVSEPFCHSCNRIRLTADGYLRNCLFSSQELNLRQQATSTELTNLICDW 303
225 0.000e+00UniRef50_A0A1Q7ZBA9 GTP 3`,8-cyclase n=6 Tax=unclassified Acidobacteria (miscellaneous) TaxID=305072 RepID=A0A1Q7ZBA9_9BACT  ali  18  14................................................LVDRFGRVVRSLRLSVTDRCNLRCQYCMPEGPKERILTFEEIERVARHLALLGVAEIRLTGGEPLLRRDLPVLVRLLSR---IEGIEDLAVTTNGLLLEEMAGPLLRAGVRRFNVHIDSLDPASFAALSRRNGLPRVLAGLSELERLGA---IPVKINVVLVRGVNDDQIERFVDLALS---RPYQVRFIELMPLGGGEPFEMDRLVPGREVKRRIESMKP-LLPIGRDRPSAPANVYRLADGLGGFINPVTEPFCGDCDRIRLTADGKIRNCLFARAETDIAALLRDGSPDE..... 303
226 0.000e+00UniRef50_A0A143XQP1 GTP 3`,8-cyclase n=7 Tax=Clostridiales TaxID=186802 RepID=A0A143XQP1_9FIRM  ali  18  1................................................MRDQYGRKIDYMRISITDKCNLRCRYCMPEGPMSHLLTFEEVVQVCTAAAELGIRKIKVTGGEPLVRRGAPALIGMLRD---IPGIDSVTLTTNGVLLKKYLPDLLANGLKSVNVSLDTMDWTLYRQITGQDAFLQVMESIEAAVDA----GLQVKINTVLLKGVNEDGWEQMIAYA---RSHPVDVRFIEIMPIGAGKTYSG---VSNEELLRRIREKYPALKEDISIHGNGPACYYSIPGFAGGFISAMHGKFCNHCNRIRMSAQGEIKPCLCYGTSVDLRRALRK.......... 281
227 0.000e+00UniRef50_A0A2G9XGM6 GTP 3`,8-cyclase n=6 Tax=Deltaproteobacteria TaxID=28221 RepID=A0A2G9XGM6_9DELT  ali  14  1................................................MIDKYNREINYLRVSVTDRCNLRCVYCTPREGHDDILRYEEISRIIRMAVKIGVAKVRITGGEPLVRHGIVDFI---ASLKTIEGIDDISLTTNGTFLEAFAERLFDAGMKRINISLDSLHAGKYARITRGGDLDAVLRGID---KVCRIGFSPIKINTVAIKGFNDDEILDFTRLAL---YKPYQIRFIELMPIGQAGMENNGKYL-SNDIVKERISRFYRLEPVQGAGGSGPAQIFRIAGGVGGFISPVSRQFCRSCNRLRLTADGHLRACLLSEAEVDLKGPLRNGCSDEEL... 309
228 0.000e+00UniRef50_A0A1F2PHY9 GTP 3`,8-cyclase n=6 Tax=Firmicutes TaxID=1239 RepID=A0A1F2PHY9_9FIRM  ali  16  1................................................MLDQYGRKIEYMRISVTQKCNLKCIYCDPKDSKDDSLTPREFEKVVRSMVEAGIKKIRVTGGEPLLRRDICEII---YRISEIDGIEDIGMTTNGIQLLKMAADLKAAGLHRLNISLDSLKPEKFKFITGGGDLKKTMAGIDRALSLGM---TPVKINTVLIKGINDDEVDDLIELT---RDRPIEVRFIELMPMGSFGEDNRDKIIHNDD----LIATRPGLQYLERTDKGSPAVYYQMAGYTGGFISPMTHQFCSDCNRIRLTSDGKIRPCLGNNGEVDIREAL............ 280
229 0.000e+00UniRef50_A0A1H4A222 GTP 3`,8-cyclase n=1 Tax=Desulfuromusa kysingii TaxID=37625 RepID=A0A1H4A222_9DELT  ali  17  2.............................................KTYLYDSCHRKINYLRLSVTDRCNFRCQYCMPAGGHSEVLSFEELLQLAKTAVSLGVEKIRVTGGEPLLRKGILDF---LAEIKSIPGLKYLAVTTNGHNLLQTAPRLQQIGLTSLNVSVDSLDPDTFATVTRTGELKPVLDGI----RYAHALGIPIKLNVVVMRGINDHEIVNFATLANDYNW---SVRFIELMPSSPCN---ANLKGVSADEIYQTISKQYLLEKLNNNELSGPSQDYKLVGGKGGVISAMSCPFCSSCNRIRITSTGGMKNCLFNEEETDLK............... 281
230 0.000e+00UniRef50_A0A1V5GZR4 GTP 3`,8-cyclase n=2 Tax=unclassified Deltaproteobacteria (miscellaneous) TaxID=122706 RepID=A0A1V5GZR4_9DELT  ali  17  1.............................................MKPLIDEYNRQIHYVRISITDRCNFRCRYCMPSSGHEHIMRYEEFLRVLRICIARGVDKVRITGGEPLIRKGVVPFIRCIREM---QGLRDLSLTTNGVMLDTMAGSLKKAGLNRLNISLDTLDREKFAHITRVDAFERVITGIRRAFDAGLS---PIKINVVAIRGFNDDEIPAFAEMT---RRSPVEVRFIELMPMGCATRYGEYELIGAPEIREKIEERFGTLEPV--EYNHGPAKVYRIRGAQGGLIGALSEHFCGRCNRIRITANGHLRPCLFSGEEIDLRQGISD.......... 292
231 0.000e+00UniRef50_A0A2M6ZJF9 GTP 3`,8-cyclase MoaA n=1 Tax=Deltaproteobacteria bacterium CG07_land_8_20_14_0_80_60_11 TaxID=1973972 RepID=A0A2M6ZJF9_9DELT  ali  16  25.......................................................QINYLRVSITDRCNLRCFYCTSWEGAPEILRYEEMLRLAGVAAGVGIKKLRVTGGEPLLRRGVLEFIHLLHQ---VPGIEEVCLTTNGVRLAELAPDLLATGLRHLNLSLDTLRPERYREITGSDRFGDVMAGLERAAALGFN---PVKINCVVLKDLNDDELLDFARLT---RDHPFQVRFIEFMPTVDEARW-RRHFLPMAEIRRRLAG-LGPLDAVTSPATAGPARTFRVPGFRGGFISSVSDHHCPTCNRLRLTAAGSLRPCLFAAPELDIKGPLRQGASD...... 305
232 0.000e+00UniRef50_A0A023X2G4 GTP 3`,8-cyclase n=3 Tax=Actinobacteria TaxID=201174 RepID=A0A023X2G4_9ACTN  ali  16  2......................................ETKGTRRLAQLTDSYSRKMDYLRISVTDRCNFRCQYCMPEDDKSEILSLEEMLTFAEAALMLGVTKVRVTGGEPLVRRGVVKFVSWLKDL----GFEEVTMTSNGFLLEENLEGLVEAGLDRINISLDTLQPEKFRFITRRNHFEKVWRSIMAALETPLS---PVKINAVAMRGVNDDEIVEMARLTQR---YPLHVRFIELMPLNGDTDRFRSLFISGKEILSRAQAELGDLMPVEKDDPAAPADEFTFEGAPGGVITPVSEPFCARCSRLRLTADGKIHPCLLTDLDIPVKHAIRS.......... 297
233 0.000e+00UniRef50_D4J8E2 GTP 3`,8-cyclase n=152 Tax=Bacteria TaxID=2 RepID=D4J8E2_9FIRM  ali  17  1................................................MIDGFNRTIDYIRLSVTDRCNLRCRYCMPPDGISEILTYEEIEHLCRIFAALGIHKVKITGGEPFVRKNICHLI---RRIKQIPGIDSVTLTTNGTLALHHLEELKAIGIDGINFSLDTLKPAVFQQITGGRGLENVLVAINKAVSL---QIPNIKINCVPVRDFNLSEIPDIAALAEN---YPIHVRFIEMMPIGLGKDF---QMISESEICHLLKDTYGSLEPIDGIFGNGPAHYYHIPGFKGGFISAMSHMFCDGCNRIRLTTDGQLKTCLFYENGIDLKSLIRNCSDEELR... 291
234 0.000e+00UniRef50_A0A1V9YDJ9 Molybdenum cofactor synthesis 1 n=1 Tax=Achlya hypogyna TaxID=1202772 RepID=A0A1V9YDJ9_9STRA  ali  17  467.................................RALVTQLQEAEKEDNLVDTFGREHTYLRISLTERCNLRCQYCMPEEGQDDLLTTDEIIRLATLFARSGVTKLRLTGGEPLLRKDIGPLTQALH---AIPGIASVGVTTNGIALPKHTAALAVLG-TRLNISLDTLDATKFARITRRNGFTRVI---AAIDGAIAASSVQVKLNCVVMRDFNLDEVVDFVRLTLS---KNVDVRFIEWMPF-DSNRWRDDVFVPYAEMLAAIMEAFPGRVHRLTDDAHDTSKAYALDGAMGGFITSMSEHFCGGCNRLRLTADGNLKVCLFGNTEVSLRDALRAGFSDDDLL.. 773
235 0.000e+00UniRef50_A0A090L164 Molybdenum cofactor biosynthesis protein 1 n=4 Tax=Strongyloides TaxID=6247 RepID=A0A090L164_STRRB  ali  14  5................................IKKCIVPLNFIRKNHVLTDNFGRHHDYLRISLTERCNLRCKYCMPEEGVPNLLTNDEIITLVKIFEKNGVSKIRLTGGEPTIRSNLAKLI---YDIRSIEGIKSVGITTNGITLSRQLPDLVKSGLTHVNISLDTLDPNKYMILSRRNGFSKVIKSI----KLAQNFFPYVKLNVVVMKGINDNEVVDFVKMTKNEN---LDIRFIEYMPF-EGNNFNINKMVPYKELLIMIDKEINEMIVKATDDKNDTSKGYYVDGWKGGFISSMSEHFCGTCNRLRITADGSLKVCLHENTEVSLRKLLRENSSTEII... 311
236 0.000e+00UniRef50_E1QKQ1 GTP 3`,8-cyclase n=3 Tax=Desulfarculaceae TaxID=453228 RepID=E1QKQ1_DESB2  ali  13  7......................................KSRFIQPDEMLVDGHGRMLNYLRVSLTDRCNFRCIYCMPPGGHDDILSLEEIARVARVAVAMGVDKIRLTGGEPLLRRNLPVLLDKLSSIQPRP---DIRLTTNGFFLSAALPWLLAGGVSAVNVSLDTLRPDRFAAISGPRALDAVLGGIRAAVA---QGGLRVKVNTVPLAGLNDDEVADFARLAAQLGVA---VRFIEYMPVGRLTRYRPERFISSDEVLGRL-AALGSLAAIDHDPADGPAQRFALPGGRGGVISAISSHFCATCNRLRLTADGRLAPCLFSDETIALR............... 302
237 0.000e+00UniRef50_A0A1V5D6D7 GTP 3`,8-cyclase n=10 Tax=Deltaproteobacteria TaxID=28221 RepID=A0A1V5D6D7_9DELT  ali  15  17.........................................ALEQKADLTDRHHRTINYLRLSVTDRCNLRCVYCMPDEGHREILTYEEMLHLVELCVANGIRKIRLTGGEPLVRRG---IISFIDRLNRIENLKEITLTTNGVLLKEFARDLRKYGICRINVSMDTLKPEKFNAITRRPFFEKVWEGIEEAESVGMA---PIKLNVVAMKGFNDDEILDFARLTYR---KPYHVRFIEMMPIGAADAR-MKGFISSGEILERI-STLGPVRRVESESMAGPAEMYILEGARGRIIGALSHHFCETCNRLRLTADGQLRGCLFSDRETDLKTPLREGREGPYL... 314
238 0.000e+00UniRef50_A0A2E4HJG1 GTP 3`,8-cyclase n=1 Tax=Nitrospinae bacterium TaxID=2026769 RepID=A0A2E4HJG1_9BACT  ali  16  5...............................................QLFDKYGRGHNDLRISVTDRCNFRCFYCMPEEGHDEVLSYEEILRVVRITTDLGFDSFHITGGEPLLRKDLSLLISGMLKIQPE---MDLALTTNGILLPAVAKDLYQAGLRRINISLDTLDEEKFLFMTRRNQLKQVMEGIKSASDMGFS---PIKINAVAIKGLTEEEIPRFADWARETGH---IVRFIEYMPLDADKTWGKDKVLSAEEILDGLSKNCA--LELVSGNISDPATRYRYQDGKGGVIPSVTKPFCEDCNRMRLTAEGMIRTCLFSNDEHDLKKLLRGNERDEVIKKW 299
239 0.000e+00UniRef50_A0A2G2J8R3 GTP 3`,8-cyclase MoaA n=8 Tax=cellular organisms TaxID=131567 RepID=A0A2G2J8R3_9FLAO  ali  15  7...............................................ILTDSHGRTHNYLRISLTEKCNLRCTYCMPHDGRAHLMTADEIEAIAKIFVANGVDKIRLTGGEPLVRKDFSAILERLASLPVK-----LSITTNALLTHRFIDDFKRFGLNAINVSLDSLNPEKFKFITRRDEYKQAFDNINQLLD----EGFNVKLNAVLMKDFNEDEIVDFVALTKDRN---INVRFIEFMPF-DGNLWNKNKLVSQAEILNRVNDHFGALQPLPTEQNF-TARNFRIEGYRGGIISSVTNPFCDSCNRIRLTADGKLKNCLFSNAETDLLKPFRAGENLETLIN. 299
240 0.000e+00UniRef50_A0A2G6ME17 GTP 3`,8-cyclase n=1 Tax=Desulfobulbus propionicus TaxID=894 RepID=A0A2G6ME17_9DELT  ali  15  10...........................................ENKSRLVDLFARTISYLRLSLTDRCNLRCLYCDPEDEHCEMLSYEELLRIVGVAVGMGISKVRLTGGEPLVRSNVIDFI---RAMGKIEGLTDVRLTTNGVLLEQYAEDLFQAGVTKVNISLDTLKPERFKRITGVDCFDKVWRGVLKALEVGFS---PVKVNVVTMRNVNDDELKDFIRLAKKL---PLQIRFIEFMPIGDATRWSTNTYISCDEIKERLV-AFEKLVPLDRKETDGPAQVYRLTGSQGGFISPMSHKFCDRCNRLRLTSAGTLRACLLYDQETDLKNIIRNGASDE..... 310
241 0.000e+00UniRef50_A0A1V9XYH5 Molybdenum cofactor biosynthesis protein 1-like n=1 Tax=Tropilaelaps mercedesae TaxID=418985 RepID=A0A1V9XYH5_9ACAR  ali  13  16.........KLKVHETRITKGKGLNVGPSARFSTASKDSGNQIPNENSLYDSYGRVHNYLRISLSERCSFRCCYCMPDGGQDELLTTPELLHLIDIFASLGVTAVRLTGGEPLLRKDLPTIIRHIRTNYAH--IRKIGITTNGLVLERNLDNLIKAGLTHVNISLDSLVPYKFEEITRRKGFDRVLQAIFSAEKL-----LPTKINCVVMRGFNLDEIPAFVEMT---RDHNLEVRFIEYMPF-DGNRWSFDELVPQRELEDKIQRSVPDVLQLPTEPH-HTAKLFTSPAHRGGFISSMSQAFCSSCNRLRLTADGALRSCLFSSDELSLRDILRE.......... 341
242 0.000e+00UniRef50_A0A1V4QW93 GTP 3`,8-cyclase n=1 Tax=Candidatus Latescibacteria bacterium 4484_107 TaxID=1956171 RepID=A0A1V4QW93_9BACT  ali  16  1................................................MKDRFGRTISYLRISVTDRCNLRCLYCMPVQGHKDILRYEEIVRLVRIAAGLGFRKFRLTGGEPLVRKGIIGLVGTLTRNPFRGKSHSLAMTTNGVLLSEYARPLKTAGLGRINVSLDTLDRAKYQRITGFDAFDRVMAGIRKARAVGFE---PLKINVVAMRGINDDEVGDFVRLARE----GFEVRFIELMPFRVRAEGWSDRFISGAQIREKIAQT-FHIRRTDEGPAAGPARMYRAEDWPGGFIEPISSRFCSACNRLRLTADGFLKPCLLSDVEVDLKTPLRTGATDE..... 310
243 0.000e+00UniRef50_UPI0009E0AA5D GTP 3`,8-cyclase MoaA n=1 Tax=Candidatus Magnetobacterium casensis TaxID=1455061 RepID=UPI0009E0AA5D  ali  16  15...............................................QLCDTYGRVIDYIRISITDRCSLRCMYCTPTNDRAEVLTFEEILRFVRAASELGVKKIRITGGEPLMRRGLPELI---TEIKAIGGIVDLSLTTNGLMLPEYAQKLASAGLNRVNISLDSLLPQRYAHITGGGNLKKVLDGIQAAKNANL---TPIKLNMVPMKGINDDEIESFARMTLT---QDIHVRFIELMPTVVIGRQYKEMLISSSEIHQRL-QQISPLYP-VKIRLNGPARYYRFESAAGGIISAITCHFCQDCNRMRLTAIGKLKPCLFSSKLIDLK............... 294
244 0.000e+00UniRef50_X8J3X5 Molybdenum cofactor biosynthesis protein n=4 Tax=Rhizoctonia solani TaxID=456999 RepID=X8J3X5_9HOMO  ali  16  11................................RIASIDRDVARGTIPTLIDSFGRKHDYLRISLTERCNLRCRYCMPEEGVPNILTNEEVVRLARTFVHQGVNKIRLTGGEPTLRKGLPDLIRELRGL----GVQQIGMTSNGIALWKKLPELVHSGLTHLNLSLDTLDPHKFERMTLRRGHDKVLKSLHTALSLHASSQTPVKLNTVLIRNVNDSEIARFLALT---RSNPMSVRFIEFMPF-AGNQWDANAVVTSSELLQRARDWFDNDLPALPREPTDTARMYRIRGFTGGFISSMSDDFCAGCNRLRITADGNLKPCLFDQKETPLRDLLRSQS........ 341
245 0.000e+00UniRef50_A0A2N6EIL5 GTP 3`,8-cyclase n=2 Tax=Desulfuromonas sp. TaxID=892 RepID=A0A2N6EIL5_9DELT  ali  16  2...............................................SMNDSQGRTINYLRLSVTDRCNLRCQYCMPSDGIDDILRFEDFLRIVEAATTLGVRKVRITGGEPLVRKGVIGFIQQVAQ---TAGIDEVTLTTNGLLLCGQAHALKSAGAQRLNVSIDSLQEENYKAITRGGDLAKVFRGLAEAEA----VGLKIKLNMVVMRGVNDHEIIPFASLSQEKDW---SIRFIEYMPTIREPDW-KEKIVTSRDILTQLQNR-FDLQPLSSGRLSGPAKPYRIAGAPGGIISPMSDHFCGSCNRIRITSTGFAKSCLLDQGAVDLR............... 280
246 0.000e+00UniRef50_A0A068NUD3 GTP 3`,8-cyclase n=2 Tax=Armatimonadetes TaxID=67819 RepID=A0A068NUD3_9BACT  ali  15  1.............................................MPLLLDRFDRTIDYLRVSVTDRCNFRCVYCMPEEGKEEHLSAEEFARIIGVAAGLGMSKVRFTGGEPLLRKDLPEIVRAAR----DAGVVDLSATTNGHRLPEMAEPLAAAGLSRVNISLDTLRPDRFTAIARRGSLEIVLEGIRAAVEAGLA---PVKLNVVALRGINDDEAADFAAWTLRE---PVHVRFIEVMPMRWNDADMRRRFVPCEELMASIEAVHGKLEPA-DLRTNGPARTFRLAGAPGGFISQISNDLCSRCNRLRLTHDGFLRGCLMSDGELDLRNPIRSGATDEEI... 324
247 0.000e+00UniRef50_A0A1Q7HYA9 GTP 3`,8-cyclase n=3 Tax=Bacteria TaxID=2 RepID=A0A1Q7HYA9_9CHLR  ali  18  1................................................MFDQWGRRVKSLRISVTDRCNFRCVYCMPEEGKDKILSYEEIARLTGILVGMGVENVRLTGGEPLVRRDLPVLVRM---LSGIPGLRSLSLTTNGYFLKEMAGDLADAGLTRINVSLDTLQRDKFHEITRRDCLERVLEGLAECER--YPSLRPIKVNAVAVRGFTEEEIPAFAALA---RRAPYLVRFIEYMPIDGDAAWTRDRVLTGGEILSE-MRKLYPLEAVPIDDPAQTSRDFRFVDGAGGFINPVSEPFCEACDRIRLTADGQIRTCLFSVTETDVRGPMRAGADD...... 290
248 0.000e+00UniRef50_A0A242A4M0 GTP 3`,8-cyclase n=24 Tax=Bacilli TaxID=91061 RepID=A0A242A4M0_9ENTE  ali  15  2............................................KPYRMTDMYQRTHDYLRLSVTDKCSLRCTYCMPEDGDHCLLSTQEIIAMVDNFCQLGVDKVRLTGGEPLMRKDILEIVEGIHQLSA---VKDLSMTTNGLALKRLAQPLRDAGLHRLNISLDTFDQKRYRMVTRGGNLKQVLAGIEAAIAANFDE---IKLNVVVIQGQNDQELRDFLSYTFE---HDVTVRFIEYMPIGQANQKKWQDAYKGVERVFDICHQEEWTYRAIEMKGNGPAKNFQMDGAKGRFIHPISCQFCAACNRLRVTADGYLKACLFWEDEINLR............... 286
249 0.000e+00UniRef50_A0A1F8RE71 GTP 3`,8-cyclase n=2 Tax=Chloroflexi TaxID=200795 RepID=A0A1F8RE71_9CHLR  ali  17  1...............................................MALDRFGRDIHYLRISLTDRCNLRCVYCMPEDPRKELMQDDELLHLVRLFTELGFHKFRLTGGEPTVRANIVELVRGIARA---PGVRSLSMTTNGLLLKQLARPLAEAGLQRVNVSIDSLDPAKFKRLTRWGDVQDVWEGIVEAEAAGLA---PMKLNAVIVRGYNEDDVADLAALTLYHDW---QVRFIEMMPFGEVAGFQQAQVVAAQEMRAKIEAALGTLIPVDGGKLDGEARLYRLADGLGGFISSVTEPFCASCTRARLTADGKLRMCLLREYEVDL................ 280
250 0.000e+00UniRef50_A0A2S8STC8 GTP 3`,8-cyclase n=2 Tax=Abditibacterium utsteinense TaxID=1960156 RepID=A0A2S8STC8_9BACT  ali  14  1...............................................MLQDRFQRLISYLRISVTDRCNFRCVYCMPEAGREEILSFEEIARIARVGATLGLSKIRLTGGEPTVRRDLPTLVSMLR---AIPEIKEIAMTTNAALLDNLAIPLKNAGMNRLNISLDTLSHKKSREIARRDEFERVLAGIDAA----KCAGLGIKFNTVVMRGLNDDELPDLLEFA---RSYDAQIRFIEYMPMGMAR-FDERNRLVSATQMREILSSKFDLVP--EAENGDPARGYVCNGARAGFISSMSDHFCDSCNRMRLTALGGLRPCLHQNAEVDARAILRNGGSDEDL... 290
251 0.000e+00UniRef50_A0A0B7FR41 Molybdenum cofactor biosynthesis protein 1 n=1 Tax=Thanatephorus cucumeris (strain AG1-IB / isolate 7/3/14) TaxID=1108050 RepID=A  ali  16  11................................RIASIDRDLARGPVPALIDSFGRKHDYLRISLTERCNLRCRYCMPEEGAPDILTNEEVVRLARVFVQNGVNKIRLTGGEPTLRRGLPELIQELRGI----GVKQIGMTSNGIALWKKLPELVRSGLTHLNLSLDTLDPHKFERMTLRRGHDKVLKSLDTALSLHESSPNPVKLNTVLIRNTNDSEIARFLALT---RLNPLSVRFIEFMPF-AGNQWDSNAVVTASELLQHARESDPDGVVTLPREPTDTARTYRIRGFTGGFISSMSDDFCAGCNRLRITADGNLKPCLFDEKETPLRDLLRSQS........ 341
252 0.000e+00UniRef50_S9TAF8 Molybdenum cofactor biosynthesis protein n=1 Tax=Angomonas deanei TaxID=59799 RepID=S9TAF8_9TRYP  ali  17  2............................................RSSILTDTFRRTHHYLRVSLTERCNFRCQYCMPESGQENLLSVEETKQLLSLFSSLGVTKVRFTGGEPLLQTRIAEMVDFTRR---ECHITDIGITTNGVLLPRYMDALVESGLTRVNISIDTLQQDKFKYITRRNGLASVLKAIEAAKVYANEKRIQLKLNCVMMRGFNTDEVADFALLAKES---PIEVRFIEYMPFSENS-WEKEKVFTFMECLDTIEQTLNTKLHFTAGEKDGVAKLFRADGFQGGFISTMTTPFCGSCSRLRLTADGKLLNCLFDQEEVNLLEVLRH.......... 293
253 0.000e+00UniRef50_C0Q9H2 GTP 3`,8-cyclase n=27 Tax=root TaxID=1 RepID=C0Q9H2_DESAH  ali  13  2.............................................DSKLMDRYHRHLNYLRVSITDRCNLRCLYCIPDGSHEEILTYEEILRIVKTGSKMGISKVRITGGEPLVRKGACDFLSRLSKIK---GLLDISLTTNGVLLEKNIEQIKAAGIHRINVSLDTLQPKKYKQITRMNMFKRVWDGIMAAHAAG---FSPIKLNVVVMKGINDDEIEDLARLT---FTYPFHVRFIEYMPIGPESIESGR--ILSGEGILKRLSVLGELLPIENIRTDGPARRYRYKGAPGEIIFAMSNPFCSACNRLRLTASGQIRPCLLSDEQIDLKGPMRNGCTDEEL... 295
254 0.000e+00UniRef50_A0A085MT03 Uncharacterized protein n=2 Tax=Trichuris suis TaxID=68888 RepID=A0A085MT03_9BILA  ali  16  392................................................LRDSFGRFHNYLRISLIDQCNLRCQYCMPEEGSDKLLSKEEIVHLTSLFVRLGVTKVRLTGGEPTIRKDLTDIVD---SLSGIPGLKKIALTSNGLILGKVLPGLREKGLTHLNLSLDTLIEPKFQLITRSVGWKRVWKTIEIAEKL----FPIVKINCVVIRGVNDDELCDFVELT---RRRPLDVRFIEYMPFG-GNKWEHRKMVSYAEMMETIQRQFGNLRKLDNEMQDDTSK---VPGFHGGFITSMSQHFCATCSRLRLTADGCLKVCLHGNSEVSLVKALRSGASEEELI.. 680
255 0.000e+00UniRef50_Q9I3K7 GTP 3`,8-cyclase 2 n=113 Tax=Proteobacteria TaxID=1224 RepID=MOAA2_PSEAE  ali  17  3.............................................DSRLVDPFGRRITYLRLSVTDRCDFRCTYCMSEDPRDQVLSLEELYAVADAFIGLGVRRIRITGGEPLVRKGITGL---LARLGQRAELEDLAITTNGSQLRERAAELKAAGVRRLNVSLDSLQRERFAAFTRSDRLEQVLDGIQAAREAGFE---RIKLNCVVQKGRNDDEILDLVEYALANQ---LDISFIEEMPLGSITSHRRELTLCTSDEVRAIIERRWPLTPSLA-RSGGPSRYYQIGDSRIGFISPHSNNFCGDCNRVRVTAEGKLVLCLGHEGALDLRELLRSHPGDRERLS. 298
256 0.000e+00UniRef50_Q93KD1 GTP 3`,8-cyclase n=49 Tax=Bacteria TaxID=2 RepID=MOAA_PEPAC  ali  16  3............................................NKSVLLDGYGRRINYLRISVTDRCNLRCMYCMPQEGHHDIMTLEELQEVAVALVELGIDKIRITGGEPLVRKGIVGLVRELSKC---EGLNEITLTTNGLLLSEYARELKAAGLKRVNISLDTLNPQKFEYITRGGSLEKVLEGIKEAQSVGL---TPIKLNTVLIGGFNDDEIEDFVALTVDNE---IDVRFIELMPYRTGSLWSLEKFISSDSVLKKV----PSLEKIKSEDISSPAEYYRIPGALGKVINPITCKFCENCNRLRLTSDGKLKLCLHSDSEIDLAGPLRRGED....... 292
257 0.000e+00UniRef50_UPI000DAE7A8F GTP 3`,8-cyclase MoaA n=1 Tax=Bradymonas sediminis TaxID=1548548 RepID=UPI000DAE7A8F  ali  14  3..........................................QPTFPDFKDRYGRKVTYLRVSITERCNFRCVYCMPAEGSKEYLSYDEIAELVEIFAAQGVTSVRITGGEPLVRADVPDLV---AKLRAIDGIERIAMTTNGFLLDRYAQALKDAGLDSLNISLDTLDPERFKRITRVGDLDRVLQGIDAAQKAGFKS---VKLNAVIVAGFNEDEMLDLVRFATE---RAMIMRFIEFMPIGDGAGRSNLGYCVPAKTMRAEIAKHYRLEVDPKRYGTGPARYWRLHGPDFGIIAAVTECFCDLCNRVRLTASGGLRACLADDDEINLR............... 312
258 0.000e+00UniRef50_A0A1V4IWT1 GTP 3`,8-cyclase n=32 Tax=Firmicutes TaxID=1239 RepID=A0A1V4IWT1_9CLOT  ali  15  1................................................MFDSYGRKINYLRISVTDLCNLRCKYCMPEKGHKEILTLEEIEAITESFVELGVDKVRITGGEPLVRKNILKLIDGIGKIG---GVNDLAMTTNGILLKDYAKDLKNAGLNRLNISLDTLNEEKYSQITKVGKLKDVLQGIEAAKKSGL---TPIKLNVVLIKDFNENEIEDFINLTKYE---DIEIRFIELMPIGTLKHWSSNKYISND----TVLEKMPELIEIESADISSPARYYKLPNAKGKVINPISCKFCENCNRIRLTADGKLKSCLHSNAEVDLKKLLREGKD....... 285
259 0.000e+00UniRef50_A0A1F9PIT7 GTP 3`,8-cyclase n=3 Tax=Deltaproteobacteria TaxID=28221 RepID=A0A1F9PIT7_9DELT  ali  18  7......................................................RQINYLRISITDRCNLRCVYCWEKQPPAEILRYEELLRLAAVAAEAGVRKIRITGGEPLVRRG---LVGFLQELKRLPGIDQVCLTTNGVLLRELAPAIYNAGVHHLNVSLDTLKRDRYRRITGSDNLPAVMAGLQQAASLG---FHPLKINCVALRGINDDEVLDIARLA---REYPLQVRFIELMPT-TSQTWWQRHFLSMAEVRRRL-AVLGPLEPLIREATAGPARNFRVTGFQGGFISPMSEHHCPTCNRLRLSSDGKIKPCLLGSQELDLKEPLRQGGSDSFI... 291
260 0.000e+00UniRef50_Q747W9 GTP 3`,8-cyclase n=32 Tax=Bacteria TaxID=2 RepID=MOAA_GEOSL  ali  15  3................................................LIDSFGRRINYLRLSVTDRCNLRCSYCMPAEGHGDILSYEDLFRIARAAVAIGIEKIRITGGEPLVRKG---IVPFLARIAAIEGLRQLVLTTNGLLLPEMAADLRSAGVQRLNISLDSLRADTFRAITRIGELQRVLDGIAAADAAG---FPPPKINMVVMRGVNDGEVADFARLTID---RPCTVRFIEYMPATRENNW--QSLTVPGREILDRISASYELEPVEKGACAGPSRDFRIRGAAGGVITAVSGHFCGDCNRVRVTSTGMAKSCLFSDEGFDLR............... 281
261 0.000e+00UniRef50_A0A0S2TAG6 GTP 3`,8-cyclase n=1 Tax=Candidatus Tenderia electrophaga TaxID=1748243 RepID=A0A0S2TAG6_9GAMM  ali  17  1................................................MQDRFGRTFDYVRIAVTEKCNLRCTYCMPEEGKEKILHSEETLRIIGVLARMGVKKVRFTGGEPLVRKDIVDLIEGSV---ATPGIKAVHLTTNGLLFDRYAQRLRDAGLTGVNISLDTLDADKFVRITRREGLEKVKDSIKLALDMG---FPRVKVNVVLMRGFNEDELKDFTEMARDHR---LTVRFIEFMPFDGHQIWETGGHFASAELVKQIETLYPGIQPAPGTRTEHH--IFQGNDHQGKVIPAFTRSMCGNCSRIRVTADGNIRNCLYSDKEYSLRELIRSGCKDDEIAD. 294
262 0.000e+00UniRef50_A0A1I2SJX5 GTP 3`,8-cyclase n=81 Tax=root TaxID=1 RepID=A0A1I2SJX5_9CORY  ali  15  64.............................................KRQLIDRFGRVARDLRVSLTDRCNLRCTYCMPAEGREDTLNDEEVCRLINLAVKMGIRQVRFTGGEPLLRKGLEDILRYTKTLRTDEGIPGTALTTNALGLHRRAQVLKGAGLDRVNISLDTIDPQLYAQLTRRDRLGDVLKGIKAAAEAGLH---PVKVNAVIMPGFNDSGIVELATWCLTHKV---QLRFIEQMPLGPRDKWDRSKMVTADDILAELHTE-FHMSPAIAPRGSAPAALWDTEGGQIGVIASVTHPFCGDCDRTRLTTDGAIRNCLFSRSETNLRDLMRAGASDDEVMEW 375
263 0.000e+00UniRef50_A0A2H5XA55 GTP 3`,8-cyclase n=9 Tax=cellular organisms TaxID=131567 RepID=A0A2H5XA55_9BACT  ali  17  20...............................................PLVDRFGRVARKLRLSVTDRCNFRCHFCMPLNPKEHLLTYEEMVWVARLLAGMGVTKIRLSGGEPLIRRDVDALVAMLA---AIPAVESVTMTTNGFYLLEMAARLKAAGLSGVTVSLHSLKPDRFEGIVGRR---EVFDRVMAGIAEARRVGLPVKVNVVITRGCNDDEILDFTELARRTG---MTVRFIEYMPFDGQKLWSSERLVSGAEILERIGER-YLLVPLPREPGSTAQVYRFADGAPGEVITSMTLPFCDDCDRIRLTADGKIVPCLFSRDEYDLRPLLRGGADDVEL... 311
264 0.000e+00UniRef50_A0A2E8QVH0 GTP 3`,8-cyclase n=11 Tax=root TaxID=1 RepID=A0A2E8QVH0_9BACT  ali  15  3.............................................DNAMIDQFGRRVEYLRISVTDKCNLRXVYCMPMEGREELLTYEEIAQIVRTMTGMGLRRVRITGGEPLVRRDLPDLVRMISE---VPEIEDLSLSTNAVLLAEQADALRNAGVQRLNVSLDSLRPDRVDSISRRPGYPKIMEGLDAAEAAG---FAPIKINVVLVRGQNDDEIEDFAEITRERPWH---VRFIEMMPTGANLDLSANQF-ISCTEALRRIEXIEAIEPVQGPFGNGPARYYQFKGAPGGVITPMSHNYCDRCNRMRLTADGQLRPCLFGAIQTNLRAPLRAGED....... 294
265 0.000e+00UniRef50_Q65DY5 GTP 3`,8-cyclase n=87 Tax=Bacteria TaxID=2 RepID=MOAA_BACLD  ali  16  4............................................NSEQVLDQKSRPLRDLRISVTDRCNLRCTYCMPAEPKGELLSFEELERLAKLFVQFGVEKIRLTGGEPLMRKDMPELVGKLAGIK---GIRDIAMTTNGVLLPVYADKLKKAGLKRVTVSLDSLDDERFKSINGRGVS---VSKVLAGIEAAKKAGLGVKINMVVQKGVNEKDILPMARYFKEKGH---ILRFIEFMDVGNTNEWNRQSVVAKADI-IRIINEDMPIEPIDPNYEGEVAKRYRYLDGSGGFISSVSDAFCTTCNRARLSAKGELFTCLFASSGFDLRTLIRSGQTDQELAE. 306
266 0.000e+00UniRef50_A0A2N9MRB4 GTP 3`,8-cyclase n=50 Tax=Bacteria TaxID=2 RepID=A0A2N9MRB4_9BACT  ali  16  6...............................................PLRDSFGRVHDNLRISVTDRCNIRCFYCMPETGRREILDFEEIERFARIAAGMGITKIRVTGGEPLVRRDLPVLI---RRLAAIPGIHDLALTTNGVLLADLAASLYDAGLRRLNVHLDTLDRERFFQITRRDDLPKVLEGLAAAKRTG---FAQIKLNAVAVKNLVEDDIVPLALFARENG---FEVRYIEFMPLDAQNLWDRGKVLLADDIIAALSRAISPLTPIPDPDPRAPATEYAYADGGGGFIASVSRPFCLNCNRIRLTADGKLRYCLFAIEEDDVKGLMRSGASDE..... 297
267 0.000e+00UniRef50_A0A1Q8B907 GTP 3`,8-cyclase n=14 Tax=unclassified Acidobacteria (miscellaneous) TaxID=305072 RepID=A0A1Q8B907_9BACT  ali  17  17..................................................DVLQRPMHDLRISVTDRCNFRCTYCMPFDGRQEVLSFEEIERLARIFVGFGIQKIRLTGGEPLVRKGLPGLVKRLAKL---DGLGDLSLTTNGAFLSEQAEALYSAGLRRINVSIDTLKPERFRALTKRGNLDEVLSGLFAAKKTGMS---PIKINAVVIRDTNDDEILDLVQFARANG---FEMRFIEYMDVGNSNAWSLEKTVTKKEILDTVNSR-FPVREIGHANGSAPAVDYEFLDGAGGIIGSVTEPFCSTCTRVRLTADGKLVTCLFAESGFDLKRLLRSGASDEEI... 306
268 0.000e+00UniRef50_D3F5R6 GTP 3`,8-cyclase n=13 Tax=Bacteria TaxID=2 RepID=D3F5R6_CONWI  ali  17  3..............................................EQLKDGHGRLIGDVRISVTDRCNFRCQYCMPADGREEILTFEEIARLVGLLASMGVHDVRLTGGEPLVRRDFPRLVEMLA---AIPAVHDLSITTNGYLLERDAAALVAAGANRFNVSIDSLQRDRFFEMTRRDALPRVLRGLEAL--AAFPQAHPIKVNAVALRGFTEQEAIPFAEFA---RSHPYEVRFIEFMPLDADHAWSRDQ-VLTGDEVRAAIDAVYPLEPEPRE-PSATARVYRFADGRGGFINPVSEPFCGDCNRIRVTADGNLRTCLFSAGETSLRDPLRAGAGDDEL... 296
269 0.000e+00UniRef50_A0A1W9IT93 GTP 3`,8-cyclase n=5 Tax=Bacteria TaxID=2 RepID=A0A1W9IT93_9PROT  ali  17  14..................................................DTFGRPLKSLRLSVTDRCNLRCKYCMPEEPRETLLSFEEIYALTDLFTELGVDKVRLTGGEPLLRRDLPALIRMLRS---HARITDLALTTNGILLNEQAEALRDAGLHRLTISLDTLKPERFKTLTRRDTLAQVLDGIEMALGVGFQG---LKLDTVVMRGFNDDELADLIEYGRRFRA---EVRFIEYMDVGGATDWSLAKVYSRDAMLETLGRRYGRIEPIV-EVSSAPAQRYRLPDGTFGIIASTTAPFCATCDRSRLTADGLWYLCLYAKDGTDLREPLR........... 294
270 0.000e+00UniRef50_A0A2P5QBF3 Uncharacterized protein n=5 Tax=Mesangiospermae TaxID=1437183 RepID=A0A2P5QBF3_GOSBA  ali  14  16..................PFRNLNFFMVDKERNFGSKPTKEPINNEEMLIDGFGRKHTYLRLSLTERCNLRCQYCMPAEGSPKLLTHNEILRLANLFVTYGVDKIRLTGGEPTVRKDIHDICSDLSSLK---GLKTLAVTTNGITLAKKLPMLKQ----------YTLVPSKFEFMTRRKGHHKVIESINAAIDLGYN---PVKVNCVVMRGFNDDEICDFVNLTVD---KPINVRFIEFMPF-DGNVWDVKKLIPYSEMLDTVAKKFPTLKRLC-DHPTETAKNFQIDGHVGTFVTSMTEHFCAGCNRLRLLADGNLKVCLFGPSEHS................. 318
271 0.000e+00UniRef50_F4R4B6 Uncharacterized protein n=1 Tax=Melampsora larici-populina (strain 98AG31 / pathotype 3-4-7) TaxID=747676 RepID=F4R4B6_MELLP  ali  18  45............................EKLKLIDQDSKVDHPKVSPNLIDTFGRKHTYLRISLTERCNLRCQYCMPENGTSKLMTTPELLNITEILVRHGINKIRFTGGEPSLRSDLPDIIHKVNQLN---GIKSIGMTSNGILLKRRLKSLIDAGLTNLNLSLDTLDPFKFELLTRRKGHHVVLDCLDQALNYLKSALDSVKLNVVVIRGLNDDEINDFVSLTEK---KAVQIRFIEYMPF-EGNAWSNKKMVPYSEMLASIKSIFPDLLTLE-TDVNDTTKHYQVPGFKGGFISSMSDHFCGGCNRLRLGADGKLKVCLFGPPKLSLRD.............. 368
272 0.000e+00UniRef50_A0A174B8G0 GTP 3`,8-cyclase n=1 Tax=Turicibacter sanguinis TaxID=154288 RepID=A0A174B8G0_9FIRM  ali  18  1................................................MRDQYQRKIDYVRISITDRCNLRCTYCMPGEEHEKLLSTEEILKIVKAFEELGVTKVKITGGEPLVRKDIIELIASIKKM---AGIQEVSITTNGVLLEKMIDDLEQAGLDSINISLDTLKPAQYALMTRRNQFDIVMRGIQCAI---KSSIPKVKLNCVLIKEINGDEILDLVELAHQTRVH---VRFIELMPIGYAKNLTP----ISEDEVLDLLSKHYEVKPFEGKLGNGPAHYYEIEGFLGGFISAMSHRFCSTCNRVRVTSEGYLKTCLHFKKGIDLK............... 278
273 0.000e+00UniRef50_G8T808 GTP cyclohydrolase subunit MoaA n=8 Tax=Bacteroidetes TaxID=976 RepID=G8T808_NIAKG  ali  13  1...............................................MLIDQFNRAHDYLRISLTDNCNFRCFYCMPEEPASKLMQANEIEAIAKTFVDQGVKKIRLTGGEPLVRKDAADIILALSKLPV-----TLTMTTNGARLHEFLPILKQAGITSLNVSLDTLQADKFHLITRRDQFQRVYDNIH----LLLENDIRAKVNVVAMKEFNDHEINDFVRWTKDT---PVHVRFIEFMPF-QGNKWTSNK-VLTWQQILQIVESEFSFLPLKDE-GNDTAKKYIVPGHAGTFISTMSAPFCGTCNRMRLTADGKMKNCLFSKEETDLLTAFRNGQD....... 284
274 0.000e+00UniRef50_A0A2H0JS16 GTP 3`,8-cyclase n=2 Tax=cellular organisms TaxID=131567 RepID=A0A2H0JS16_9BACT  ali  17  10..............................................EPLTDTFGRRHTYLRIALTERCNLRCTYCMPADGRHHLLTFEEILRLAGLFAGLGVTRIRLTGGEPLVRKDAP---ALAAALARLPGVETLAITTNGLLLHRHLDLLQSAGLAKLNISLDTLREERFLSITRRTGLETVIRNIDLALASGFDT---VKLNCVVMRDVNDGELIDFAHFVED---RDMEVRFIEYMPFG-GNGWNHDAFVPYATMLDTLQSVFPDMYRL-DDGPHETAKTWQIPGFRGGFITSMSEQFCGGCNRIRLMADGNLKVCLFGRGEVSLRDAMRDGATDEEL... 302
275 0.000e+00UniRef50_A0A2N3LDW2 GTP 3`,8-cyclase n=6 Tax=cellular organisms TaxID=131567 RepID=A0A2N3LDW2_9BACI  ali  17  1...............................................MITDQFNRPLHDLRISVTDRCNFRCQYCMPAESKNEVLSFEEIERLAKLFADLGVKKIRLTGGEPLLRRGLPELIEKLTR---IEGITDMGLTTNGLLLSRLAEDLYDAGLRRLNISLDALDDNIFKKLNGRGVSSR---EILAGIDKACEMGFEVKVNMVVQRGVNDQEIVPMAAYF---REKGISLRFIEFMDVGNSNGWNMEK-VITKKEMYEILSSHFELEPVDAAYFGEVAKRYRFKNAEVGFITSVSESFCSSCTRARISADGKLYTCLFASHGTDLRAFLRDRSSDE..... 295
276 0.000e+00UniRef50_X4ZQK9 GTP 3`,8-cyclase n=1 Tax=Paenibacillus sabinae T27 TaxID=1268072 RepID=X4ZQK9_9BACL  ali  16  1.............................................MELLTDPFGRVHDYMRISVTDRCNLRCIYCMPAEGHDEIMSYEEIASVVKALAPAGLRKVRLTGGEPLVRKDLERLVAMLSS---IPGIEDLSLTTNGLLLPAKAAALKAAGLSRVNISIDSLRQDRFSMITRGGEVAKVLKGIEAAEAAGLS---PIKLNVVLMKGINDDEIKDFIALT---RNSPLNVRFIEYMPIGSATDAWRQTYLPLERVLEACREAGWETEEAQPPAGNGPSQDRRVIGAKGTFIHPVSEHFCDNCNRLRLTADGHIKACLYWSDEYNVRPLAGD.......... 289
277 0.000e+00UniRef50_A0A1G1PGI1 GTP 3`,8-cyclase n=2 Tax=unclassified Candidatus Omnitrophica TaxID=1047005 RepID=A0A1G1PGI1_9BACT  ali  17  1.............................................MEELTDKFNRRIDYLRVSVTDRCNLRCVYCMPQCGVSEILAFEEISRIVKLAIGMGIDKIKVTGGEPLVRKGLPRLLHLISSL---AGLKDLSLTTNGMLLARYSKELKAAGLKKLNISIDTLDSQKFAHIARFGKLDNVLAGIDAA---GKEKFL-IKLNVVMMKGLNDDEILDFVRFAQD---RQIIVRFIELMPMAGNSILS-EDLYMSGEEIKQRLTALGNLKRLYAKFGHGPAQYYKIEGAIIGLISPMSCKFCFSCNRLRLTADGMLKPCLVSEQGLDLKRPLRFGEEEEV.... 293
278 0.000e+00UniRef50_A0A0E4CXF8 GTP 3`,8-cyclase n=36 Tax=Paenibacillaceae TaxID=186822 RepID=A0A0E4CXF8_9BACL  ali  15  7................................................LADSFGRIHNYVRISVTDRCNLSCEYCRPDAFSPEPLTFDEIATVVSVLADMGVTKVRLTGGEPLLRPHLEELVARLH---AVSGIERIGLTTNGILLASKARVLREAGLTDVNISLDSLQPERFARITGGGDVGRVLHAIGSSLNAGFE---RVKVNMVVMKGINDDEIESFLQLTLK---YPLDIRFIEYMPIGRGTEGWQAGYMPLGGILERCSRAGWAYEPVCSDDPSGPARYYRIKGAAGQFIDPVSRHFCMTCNRLRITASGHIKPCLYWNDEWNVR............... 302
279 0.000e+00UniRef50_A0A1I8C5M7 Uncharacterized protein n=2 Tax=Ecdysozoa TaxID=1206794 RepID=A0A1I8C5M7_9BILA  ali  17  1....................................MLTRIFTRRSSTLVDSFGRHHNYLRISLTEKCNLRCTYCMPEEGRKDILTNDEIVKLVTLFREEGVNKIRLTGGEPTLRKDLVQLVKDINSVG---GIESIGITTNGIVFNRYAEDLVKAGLTHVNISLDTLDPNKYAILSRRNGFEKVIKNI----EFSRSLFKTVKINNVVMRGINDNEVVDFVRMT---RDKNLDVRFIEWMPFGGNN-FNSKKMVSYKESLAKIDEEIPRNIIKINDSPNDTSKGYKIQGWTGGFISSMTDNFCGTCNRMRLTANGHLKVCLHDNAEVSLKDMLRNNSSDD..... 302
280 0.000e+00UniRef50_C7NK92 GTP 3`,8-cyclase n=255 Tax=Actinobacteria TaxID=201174 RepID=C7NK92_KYTSD  ali  16  6................................................LVDRFGRVHTDLRISLIDKCNLRCTYCLPAEGKDELLSREELRAIAAVAVASGITEIRLTGGEPLLRPDLEDLVADLASLEGEDGPVELSMTTNGIGLHHRAHRLADAGLARVNISLDTVDPETFRTMTRRPRLDAVLAGVDAALAADLR---PVKINAVLMRGQNDHQAVDLLTWAVERGV---ELRFIEQMPLDAGHTWERGDMVTRAEVMAALEQR-FTLTPL-PGRGAAPAERFLVDGAVVGLIASVTAPFCGACDRLRVTADGQLRSCLFARSETDLRGPLRAGAD....... 295
281 0.000e+00UniRef50_A0A0Q4GH97 GTP 3`,8-cyclase n=156 Tax=Bacteria TaxID=2 RepID=A0A0Q4GH97_9SPHI  ali  15  1...............................................MIADSFGRIHDYLRISLTDNCNFRCFYCMPEEPASRLMQTDEIIKLAEIFVANGVKKIRLTGGEPLVRKDAAEIIAALGKLPV-----ELVITTNGTRIAEMLPVLKEAGIKTINISLDTLQPEKFFMITRRD----VFHQVRSNIELLLQHKIKVKVNMVVMKGLNDNEINDFISWTK---HNPIQIRFIEFMPFS-GNKWTSNKMFSLDEILA-VVEKDFTVLPVKGEPH-DTAKSFMIPGHEGSFISTMTNPFCDTCNRMRLTADGKLKNCLFSDSETDLLTALRN.......... 281
282 0.000e+00UniRef50_A0A2E7UQ22 GTP 3`,8-cyclase n=2 Tax=Deltaproteobacteria bacterium TaxID=2026735 RepID=A0A2E7UQ22_9DELT  ali  16  4....................................LLPTPTLTRRQPLVDRLGRVHTYLRVSVTDRCNFRCVYCMPPEGREDLLTYEEIGRLVGVFAEMGVQKVRLTGGEPTVRSDIEALIAQIASCK---GILDLAMTTNGHTLARLAPRLARAGLNRINVSLDTLRPERFGRVTRGGQLTRVLEGIEAARQAGI---TPIKINVVLMKDENDDELFELVEYF-AQWAQDTELRFIEYMPFGKRRHGT----VPSHSLRDRLSQQYTLCAQPQHGTSAGPASTWTLAENKVGFISPLSEHFCATCNRLRLMCDGHLRTCLAHDDTPSLRDLLRSGATD...... 303
283 0.000e+00UniRef50_A0A1G1MXD0 GTP 3`,8-cyclase n=4 Tax=root TaxID=1 RepID=A0A1G1MXD0_9BACT  ali  15  1................................................MIDSFGREIDYLRISVTDRCNLRCVYCMPAHGPSDILSFEQIYSIVKAAVGLGIRKVRITGGEPLVRKDLPALI---AELKTINGLKEICLTTNGIYLSEYALAIKEAGLDRINISLDSLNKEKFRKITQGGNLEMVLSGIDRALAAGLA---PLKINNVLLKDFNTDEIADFANLTKA---RPLHVRFIEYMPTGGLGHGSYDDIFLSAQEAKNICRSVGELEPVEQ-GTADTAEVFKIRGFLGGFISPISRPFCASCNKLRLTSEGRLRNCLHSSKTIDLKKA............. 291
284 0.000e+00UniRef50_A0A1G1PNG7 GTP 3`,8-cyclase n=7 Tax=Bacteria TaxID=2 RepID=A0A1G1PNG7_9BACT  ali  15  1.............................................MTKLIDKYNRQINYLRISVTDRCNLRCVYCMPAGGHQEILSFEQIYKFVRVAAGLGIEKVRITGGEPLIRKDLPLLI---AQLKTIGGLKEIALTTNGMNLSEYAFILKKSGLDRINVSLDSLDADKFQEITRGGSLKAVLKGIDSALEAG---FPSLKINTVLLKGFNSDEILSFAGLTKA---RPINARFIEYMPTDFNYFSYNELFF-SAQEAKTLCSGLGELKPLDGA-GGATARIFRLEGFCGGFISAVSRPFCSSCNKLRLTSDGRIRNCLHSSRTLNLKALLDRNASEEEL... 294
285 0.000e+00UniRef50_UPI00041C4E8B GTP 3`,8-cyclase MoaA n=1 Tax=Desulforegula conservatrix TaxID=153026 RepID=UPI00041C4E8B  ali  16  5................................................LTDRHGRQISYLRLSVTDRCNLRCVYCVPPEGHDEILRYEEMLRIVNILAVRGIHKIRITGGEPLVRKDLPCLVREIKK---IPGIREVCLTTNGVLLADMTDDLKQAGIDRINISLDSLKSEVFHSITGMDRLPSVLSGIDSALKAGMS---PVKINAVPMTGINNEEIESLAEL---SFQKNIHVRFIEEMPVGIG---YSEKLLSSAAIRERLESRWGSLIPVFPSSLDGPARRFQIPGAKGGFISSMTRHFCGTCNRIRLTAVGEIRPCLLNDATVDIKKPMRNGADD...... 293
286 0.000e+00UniRef50_A0A1F7TF74 GTP 3`,8-cyclase n=8 Tax=Nitrospinae/Tectomicrobia group TaxID=1802340 RepID=A0A1F7TF74_9BACT  ali  16  4...............................................QLFDSYGRGHDDLRISVTDRCNFRCFYCMPEEGHEEVLSYEEIARLVRITTELGFVSYHLTGGEPLLRKDLDRLVRM---MLQIQPGMDLALTTNGVALPQMAGKLYAAGLRRINISLDTLDAQKFFLITRRDVFGQVMAGIEAAARAGFS---PIKINAVAVKGLTEQELPRFARWARETGH---IVRFIEYMPLDADRSWERGKVLAAEEILEGLSAE-GELE-LTSGHPSDPATRYRYRDGKGGIIASVTRPFCQACNRLRLTAEGMVRTCLFSNVEHDLKALLRGGASDAEIETW 298
287 0.000e+00UniRef50_C4FA49 GTP 3`,8-cyclase n=5 Tax=Coriobacteriia TaxID=84998 RepID=C4FA49_9ACTN  ali  17  3..............................................RELHDGFGRGINYLRISVTDKCNFRCVYCMPEKGHGELLTAEEIARFVRIVAQEGITRVRLTGGEPLVSHRIVPLIEEIRSISE---IEDISLTTNGALLPRMAADLRAAGLDRVNISLDTLDPARFSQITRLGRVEQALAGIDAALEYG---FTPVKVNTVVVRRM-DQDVLNLARLSVD---RPVHVRFIEYMPIGGGDLWDASDVVPSTELRERISSEAAAAGLGALEPGAGPARYWAFPNAAGGFISAMSNHFCESCNRLRLTADGTIRPCLFSDAEYPVREALRSGDEDAVR... 334
288 0.000e+00UniRef50_A0A2E8DCU6 GTP 3`,8-cyclase n=8 Tax=Planctomycetaceae TaxID=126 RepID=A0A2E8DCU6_9PLAN  ali  17  5...............................................KLIDSLGRIHNNLRISVTDRCNIRCFYCMPDEPRNEILTFEEIVRFARVAAQQGVNKLRLTGGEPLVRAGLPKLI---RQLATIPDIDDIALTTNGILLAEHVDALKRAGLRRLNISLDGLKEETFERIARRKGLDRVLQGIFAAKAAGFE---RTRLNAIAIRGITESEIVPLGEFA---RQHGLELRFIEFMPLDAEGNWSDDQVLSGEDIRQTLQEAFGPLVPTVRPDPSQPAMDYRFADGVGGFINPVTQPFCSDCNRLRITAEGNIRNCLFSIAEWDARKIMRCGGSDDDL... 298
289 0.000e+00UniRef50_M1E611 GTP 3`,8-cyclase n=9 Tax=root TaxID=1 RepID=M1E611_9FIRM  ali  19  1................................................MTDLYGRNIDYARISVTDRCNYRCVYCMPEEGHKEILSFEEIVRIIKILKELGIKKIRLTGGEPLVRKNIVELVGKITKI----GLDDVSLTTNGSLLKIYAEDLFKSGLRRLNISLDTLNCERFANITRKGTLIDVLEGIEKAIAVGFN---PVKLNVVVMKGINDQD--DLIALANLTIDKEIHVRFIEIMPIGDN---DQKDKFISCEEIKDNISKFFKLESTKGPFGNGPAEYYKLKNSKGGFISPLSKHFCAKCNRIRITSDGMIRLCLFSDVEYNLKERLRSNLTDDEI... 290
290 0.000e+00UniRef50_A0A1I6HP25 GTP 3`,8-cyclase n=8 Tax=Gammaproteobacteria TaxID=1236 RepID=A0A1I6HP25_9ALTE  ali  19  2............................................PNSKLTDRFGRTVNYVRLSVTDRCDFRCVYCMAEDPRQQVLTLEEIARLARTFTELGTEKIRLTGGEPLVRRDILELVREIGS----YGLRDFAMTTNGSQLPTMADDLRRAGMHRLNISLDSLDPDRFRRITRTGKLSQVLDGIDASREAGFRG---IKLNTVVLKGRNDDEVPELVDFA---RRKGVDITFIEEMPLGEITEHDRSVAFCSSDEVRGIIRQHHDLVPAT-EDSGGPARYYRMPGSQVGFISPHSHNFCSTCNRVRVTVEGRLLLCLGNEHSVDLR............... 283
291 0.000e+00UniRef50_A0A1I8D3V4 Uncharacterized protein n=1 Tax=Rhabditophanes sp. KR3021 TaxID=114890 RepID=A0A1I8D3V4_9BILA  ali  17  1....................................MLARIFTRRSSTLVDSFGRHHNYLRISLTEKCNLRCTYCMPEEGKNDILTNDEIIKLVTLFREEGVNKIRLTGGEPTLRKDLVQLVKDINSVG---GIESIGITTNGIVFNRYAEDLVKAGLTHVNISLDTLDPNKYAILSRRNGFEKVIKNI----EFSRSLFKTVKINNVVMRGINDNEVVDFVRMT---RDKNLDVRFIEWMPFGGNN-FNSKKMVSYKELLAKIDGEIPHNIIKINDSPNDTSKGYKIQGWTGGFISSMTDNFCGTCNRMRLTANGHLKVCLHDNAEVSLKDMLRNNSSDD..... 302
292 0.000e+00UniRef50_A0A1Y0MP78 Cyclic pyranopterin phosphate synthase MoaA n=24 Tax=cellular organisms TaxID=131567 RepID=A0A1Y0MP78_9FLAO  ali  15  1.............................................MEALKDTFGRAHNYLRISLTERCNLRCTYCMPEHGRAQLMTADEIFALAQQFVKLGVTKIRLTGGEPLVRKDFEEILSRLSGLPV-----ELTITTNAVLIDRYITQLKSAGIKTINVSLDTLHPEKFRSITRRDDFAAV----KRNIKLLLAEGFKVKINCVLIKGFNDEEIVDFVAYTET---MPVSMRFIEFMPF-DGNRWNKDKLVAEQEILKSVFDRWTSQVERLTDSMNDTSRNYKVKGYAGSFISTVTNPFCDTCNRIRLTANGRIKNCLFSNAEVDL................ 280
293 0.000e+00UniRef50_A0A1H7YZQ6 GTP 3`,8-cyclase n=3 Tax=Clostridiales TaxID=186802 RepID=A0A1H7YZQ6_9FIRM  ali  17  1................................................MFDLQNRNIDYLRISVTDRCNLRCVYCMPAEGHDEVLTYEEILKVCRCAAALGICKIKLTGGEPLARKGTAELI---RSLKAIEGIEQVTMTSNGILLYEQLPALAKAGLDAVNISLDTLDPDRFERITRRRGLDTVLKSIDLALEL----GLRVKINCLPVREFNGDHLMQMAELA---RTRPVDVRFIELMPIGYGKDLTP---VPSCEIQEQLRQTYGELAPCNKKLGNGPASYFSIAGFQGGFISAVSTGFCGTCNRIRLTSTGFLKLCLHYNKGVELREYLRKGIED...... 286
294 0.000e+00UniRef50_A0A1M6M6U9 GTP 3`,8-cyclase n=3 Tax=Firmicutes TaxID=1239 RepID=A0A1M6M6U9_9FIRM  ali  16  1...............................................MLKDKFGRKINYLRISLIDRCNLRCKYCMPPNGHDKILTYEELLLIIKAAAELGINSIRLTGGEPLIRRGLIPFIKTVS---NIDGIDDIAITTNGVLLEEMADDLKKAGVNRLNISLDTLNKDKFKEITGRDQFEKVFKGINKSIEVGFE---PVKINVVMLKNFNEGEILDFVKLTKD---KPLHVRFIEMMPLGESKNNWTAGYMPWND-ALELVKREFEVRESSGPKGSGPAKYYTIPGFLGGFITPVGEHFCHQCNRIRLTSDGFLKTCLFGNNEVNLK............... 281
295 0.000e+00UniRef50_A0A1F9U2V5 GTP 3`,8-cyclase n=9 Tax=unclassified Elusimicrobia TaxID=1797919 RepID=A0A1F9U2V5_9BACT  ali  14  1...............................................MLTDSFNRKIDYLRLSLTDRCNLRCVYCMPKDPREEMLSDAEILKLLSCFAQLGISKIRITGGEPLVREG---IVSLVREISGIRGIQDISLSTNGLLLDKMALDLTRAGLKRVNISLDSLNAEKFNQITRYGKLETVLSAIESALSAGLA---PVKLNVVVARGMNDDEIADFVKLTKKN---PLHVRFIELMPMGETGFFSKEKWVSMNEILQK-AQPLEEMEKEDWPRGEGPARYFRRPGARGGVISALSCGFCSSCNRMRLSSQGVLVPCLDAAEGTDLKALLRSGTSSRELKE. 295
296 0.000e+00UniRef50_A6TVF9 GTP 3`,8-cyclase n=40 Tax=Bacteria TaxID=2 RepID=MOAA_ALKMQ  ali  18  1................................................MKDTFQRSINYMRISITDLCNLRCQYCMPEKGHQDILTLEEIEQIVRIGAENGINKVRITGGEPLVRKGVIGLIKNIS---NIPGIQDIALTTNGLLIKKYGEALKDAGLKRINISIDSLRPDRYKEITRGGDLSQVLEGIQEALRLGM---TPVKLNVVVIGGYNEDEIEDFANLTVDD---PIDVRFIELMPIGEASGWAKDRFLSNEEVKSKIE----GLVPIITDATS-PARLYRLPGAKGGFINPISSHFCESCNRIRVTSDGKLKPCLHSNHEIDL................ 275
297 0.000e+00UniRef50_B1I2J4 GTP 3`,8-cyclase n=2 Tax=Firmicutes TaxID=1239 RepID=B1I2J4_DESAP  ali  17  1.............................................MRIVRDNFERRITYLRVSLTERCNLNCFYCRPGEQKTDGLPLESLMRVIRAGARVGIRKIRLTGGEPLVRPDVIPVVAALNE---IPQIDDIALTTNGSLLAPRAQGLRAAGLKRVNISLDTLRPDRFRSITRNGELSAVMNGLEAALAQDLH---PVKLNMVVMRGINDDEIDDFVRLTED---RPLHIRFIELMPIGVSSHWASEYYVPADEIRRNIDQRYGPLQTVRPAGGDGPARCWKIPGFIGGFIAPLSGYFCPSCNRLRLTAAGTLRPCLYKEDEIDLVEPLARGVNDDEL... 294
298 0.000e+00UniRef50_UPI000C07A0A1 GTP 3`,8-cyclase MoaA n=2 Tax=Firmicutes TaxID=1239 RepID=UPI000C07A0A1  ali  17  1................................................MIDSYQRRINYLRISVTDLCNLRCRYCMPNEGHSDVLTLEEIETIAKVFVELGVDKIRITGGEPLVRKGMLGLIENIGKL---EGLKDFAITTNGIMLKKHAKELKDAGVNRLNISLDTLDEEKYEYITRGGQLKDALDGIKKAQEVGLS---PIKLNTVLIKGFNDDEIQDLVDFTNS----GIDVRFIELMPMGEARNWAIDNFISNEYVLEKI----NGLKEVKRDDINSPANYYKLPSAKGGFINPISCKFCSNCNRVRLTSDGKLKLCLHSNEEVDLKTPLRN.......... 281
299 0.000e+00UniRef50_A0A0C4E5Z7 Uncharacterized protein n=2 Tax=leotiomyceta TaxID=716546 RepID=A0A0C4E5Z7_MAGP6  ali  16  55.....................DTVSPPVAPSRPRRNSLR-DARPFSDFLTDTFSRQHDYLRISLTERCNLRCVYCMPEEGVPELLTTPEVVLLSSVFVSQGVTKIRLTGGEPTL-----------------------CLTTNGISLHRKLEAMVEAGLTGVNLSLDTLDPWQYQIMTRRNGLDAVRRSIDRILELNRAAGVKLKINCVVMRGLNDAEIVRFVDMT---RDADVEVRFIEYMPF-DGNRWSEGKMFGYREMLDRIREAHPGLHR-VAGHKNDTSKTFQVPGFRGGFITSMTQNFCGSCNRLRITSDGNLKVCLFGEAEVSLRDILRK.......... 348
300 0.000e+00UniRef50_A0A2M7AK95 GTP 3`,8-cyclase n=1 Tax=Armatimonadetes bacterium CG07_land_8_20_14_0_80_40_9 TaxID=1973916 RepID=A0A2M7AK95_9BACT  ali  16  1.............................................MSGLIDPWGRKISYLRISVTDRCNLRCSYCLPPDGKGELLSYEEIERVVRVAISLGITNFRITGGEPLLRKDISSLIQRLSKIG---GIGDLSLTTNGVLLANYAQDLVSAGLKRVNISLDTLDRESFKLITGEDKFEEVLEGIKVAQEVGLS---PLKLNVVIMRGVNDKEIPDFIRLAKE---HSLYLRFIEFMPLNHRSSSWQEKFLPSKEIIREI-RREGELVLSPATRGSGPARYYKLRGNKGGVIDSVSNPFCSACNRLRLTSEGKLKPCLFSSREVDVK............... 292
301 0.000e+00UniRef50_Q2H9E4 Uncharacterized protein n=10 Tax=leotiomyceta TaxID=716546 RepID=Q2H9E4_CHAGB  ali  15  77........................................DAKPFSDFLTDTFHRQHDYLRISVTERCNLRCLYCMPEEGVPELLTTPEIVMLSSLFVSQGVTKIRLTGGEPTVRRDIVPLMQQIGALRAH-GLRELCLTTNGLSLHRKLEPMVEAGLTGVNLSLDTLDPWQFQLMTRRAGFNAVQKTIDRIFELNRGAGIKFKINCVVMRGLNDREILPFVELT---REKDVEVRFIEYMPF-DGNKWNEGKMFSYQEMLDLIRSRYPGLERVQGHKND-------------------TSNFCGTCNRLRITSDGNLKVCLFGNAEVSLRDIVRK.......... 354
302 0.000e+00UniRef50_A0A1Q6RDD1 GTP 3`,8-cyclase n=9 Tax=Bacteria TaxID=2 RepID=A0A1Q6RDD1_9FIRM  ali  18  1................................................MIDQYGRTIDYLRLSVTDLCNYRCQYCMPADGVEKVLSVEEYGEIARAAVKLGIRKIRLTGGEPLVRRGILDICRTLR---TIPELKELCLTTNGSLLPELAKPLREAGVDRLNISLDTLRAERFREITRRGDLEDAFAGIRAAEDAG---FQNLKLDTVLMGGVNDDEIEDFLNLTKEHPW---EVRFIELMPMGPCAAWPKERFLPVTE----ILNRFPALEEIEP---NGVARRYRLPGAMGGLITPMSHEFCGACRRIRVTADGKLKGCLHSREEISLRGL............. 276
303 0.000e+00UniRef50_A0A2V8LUI2 GTP 3`,8-cyclase MoaA n=3 Tax=Acidobacteria bacterium TaxID=1978231 RepID=A0A2V8LUI2_9BACT  ali  18  15...............................................ILKDSYGRAIRDLRVSLTDRCNFRCFYCLPHAPKEQMLSYEEIEYLCDIFVELGIEKIRLTGGEPMMRRDIETIIRKLAKLKQHRGLRDLALTTNGYFLPDRAEGLKAAGLDRITISLDSLKRNVFKQMTGVDVLDRVLEGIEAARHAGLQ---PIKINAVIVRGHNDDEVADFAAFARERDVK---MRFIEFMPLDSGHEWSRDDVISGREIRERIEAR-FPLVPLDLHRGSETASRYRFADGEIGIIAPVTEPFCGACSRIRLTADGQIRTCLFSTVEHSLRDVLRDGAPRAEIID. 341
304 0.000e+00UniRef50_T1JPP1 Uncharacterized protein n=2 Tax=Tetranychus urticae TaxID=32264 RepID=T1JPP1_TETUR  ali  16  37............................................KPRFLQDSFGRKHDYLRISLTERCNLRCSYCMPENGKESLLQRDEIIRLAKLFASLGVKKIKLTGGEPLVRSDCIQIVADLTALKA-SGLLNIGITTNGLVLGRSIKKLVESGLDSVNISLDTLRPEKFEFITRRKGFSAVFNSIER----CLEADLPVKINCVVMRGLNDDEILSFVELTQ---HKKLEVRFIEYMPF-DDNKWSYGKMFPAHEIMATIKSK-YEVKSLPKDHPSDTAQLFQVNGFQGGFIGSMTQNFCGACNRLRIAANGNLKVCLFGSEEVSLRDPLRSGWSDQEII.. 336
305 0.000e+00UniRef50_A0A1G5CQ50 GTP 3`,8-cyclase n=1 Tax=Desulfoluna spongiiphila TaxID=419481 RepID=A0A1G5CQ50_9DELT  ali  15  5................................................LTDSYNRTIDYLRISVTDRCNLRCSYCFAHMNHTDILSYEELIRLVRVGISLGIRKVRLTGGEPFARKG---LIGFIRELSALEGLEDLAVTTNGTLIADEMKNLKEAGLTRINISLDSLRPERFAKITGKDLFAEVKRTIEGALKTGLN---PVKINTVLLDGINGDELEDFARLTFD---HPVHIRFIEYMPIGEGSGPAHSELLAPA--ITRRLEALGPLTPVHRSAHDGPAQRFKIKGAKGEIISPMTNHFCATCNRLRLTADGHLRPCLLSDAKVNLMDAVR........... 287
306 0.000e+00UniRef50_W2T4R8 Molybdenum cofactor biosynthesis protein A n=2 Tax=Strongylida TaxID=6308 RepID=W2T4R8_NECAM  ali  15  7.......SVPADLWKASRRFQSVAPLLKPKRDAIRALINQIEKEKKLPFVDTHGRVHSYLRISLTEKCNLRCLYCMPEEGPSNLLTSDEIVRLVELFASHGIDKIRLTGGEPTIRRDIVEIVERIR---NIDGIVDIGLTSNGIVLAKKLRQLKEAGLTKVNISLDTLVDHKFTLMTRRNGFAKVMKSIDLAEAL----FPTVKINTVVMRNINDDEVNDFVNLTKNRHFQRLDVRFIEYMPFG-GNHFSTKKFIDFKALLAIINQKYNGLVKRLQDAPHATTKAFKIAGFKGGFITSMSDHFCGTCNRLRITADGNLKVCLHGNAEVSMRDLLRRHASSDEI... 367
307 0.000e+00UniRef50_A0A1V4MJU8 GTP 3`,8-cyclase n=1 Tax=delta proteobacterium ML8_D TaxID=1775672 RepID=A0A1V4MJU8_9DELT  ali  18  2..........................................KKEKNILVDRYGRQLTYLRVSVTDRCNLRCKYCMPRLPHDKILTYEEILKVCRAFAAIGITKIRLTGGEPLVRRDLTNLAERLTE---IDGLKKICITTNGVLLEEYADALFKTGIRHINISLDSMSPERFAYITGFNLFEQVWRGIKKALE---KGFSPIKINSVIIKGINDNEITALAELSLK---YPLQIRFIEFMPFGHDIFWNPARFVSCDKIRNQIEQAFGKLRPLPDKSKSGPASVYALDKGPGGFIGALSHPFCKSCNRLRLTAEGRLRLCLFSDEEVNVKKALRQGQNE...... 298
308 0.000e+00UniRef50_A0A1W9VX88 GTP 3`,8-cyclase n=4 Tax=Bacteria TaxID=2 RepID=A0A1W9VX88_9BACT  ali  17  1.............................................MNKLIDNFGREISYLRVSITDRCNYRCIYCQSEKPHQEILRFEEIVEIVQEAVNLGITKVRITGGEPLVREGIVNFIKQLRK---IDRLEDISLTTNAFFLSEYAEKLKEAGLNRVNISLDSLQEEKYKKITRGGSLGKALKGISSALKAGL---LPIKINTVLIRGINDDEVEDFVRLTLD---RPLNIRFIEFMPSGEEVINEFESKFISVQEIKEKLIKKYLLDPVKISTANGPAKYYQIKGGQGGFITALSQHFCKTCNRIRLTSEGKLRPCLFSNTEVNIKQAIRK.......... 289
309 0.000e+00UniRef50_A0A174AVC7 GTP 3`,8-cyclase n=22 Tax=Collinsella TaxID=102106 RepID=A0A174AVC7_9ACTN  ali  17  8..................................................DGFGRDINYLRIAVTDKCNFRCIYCMPADGHDELLSAEEIARFVRLVAGEGIRRVRLTGGEPLVSRRIIPLIRDIR---AIPQIEDISLTTNGALLPKLAPQLKDAGLNRVNISLDTLDPTLFGKITRLGRLEQTMAGIDAALAWGFE---PVKVNCVVVRRLNQD-VAALARLTVD---RPIHLRFIEYMPIGDERLWDASDTVPSDELRTRINAGLGELEPLDINDGAGPARYWHFPGAAGGFISAMSNHFCANCNRLRLTADGNVRPCLFSDAEYSVREALRRGDD....... 318
310 0.000e+00UniRef50_A4A2Z3 GTP 3`,8-cyclase n=9 Tax=Bacteria TaxID=2 RepID=A4A2Z3_9PLAN  ali  17  3............................................PQTPLADRFGRVHTSLRISVTDRCNIRCFYCMPLEPRAELLTFEEIERVARLAVSLGVRKFRLTGGEPLVRAQLHELIQ---RLAAIPGVEDLALTTNGVLLADQAAALHDAGLRRLNVSLDGLSEEMFRRITRRQGVDRVLQGIAAAQAVGFQG---IRLNAVSIRGLTESEIVPLARF---SREHDLELRFIEFMPLDADKNWGEAQVLSGAEVREVISRDVAELSPACRADLSQPAVDYEYADARVGFINSVTEPFCGDCNRLRITAEGQLRNCLFSTAEWDVRALLRSGATDEV.... 298
311 0.000e+00UniRef50_A0A0F2Q7F5 GTP 3`,8-cyclase n=1 Tax=Clostridiaceae bacterium BRH_c20a TaxID=1629719 RepID=A0A0F2Q7F5_9CLOT  ali  15  2...............................................NLEDNYGRKHDYLRISITDRCNLRCIYCMGEDGHNEILTYEEIVGFVKVLSPLGLRRLRITGGEPLVRKGVENLI---GSLSGIAGIEDIALTTNGELLEPMLDKLMDNGLKRVNISLDSLKPDLYKKITRVGNLDKVLKGINSALRKGL---TPIKINVVLMAGVNDQEIYEFLKLTLDD---PIHVRFIEYMPLDGHDQMWSKRYLPLNAVKEKAAGLGFRLNPEEGLVGNGTAETWRIHGAQGGFINPVSCHFCSSCTRLRLTADGKFKPCLYWQEEINVRKALKN.......... 288
312 0.000e+00UniRef50_A0A1V4MCU0 GTP 3`,8-cyclase n=1 Tax=Firmicutes bacterium ML8_F2 TaxID=1775675 RepID=A0A1V4MCU0_9FIRM  ali  14  2...............................................SLIDAYGRKHDYLRVSVTDRCNLRCIYCMSEEGHNEIMCYEDMLKVIRAGTEMGITKIRVTGGEPLVRLGIVEFIREIAAL---PGVSDLAMTTNGILLPRYAAGLKTAGLKRINISLDSLKSSVYNSITRCGKLEDVLAGISAALENDLQ---PVKINVVLMKGINDGEVEDFLQLA---REKPLHIRFIEYMPIGDHDHSYGNHYLPLSFVEETAKKAGLPLTPVPTYRGPGPADYYTLPGGKGGLIHAISKHFCSTCNRLRLTSEGNLKACLYWQEEKSVRSVIDD.......... 288
313 0.000e+00UniRef50_A0A132MNZ1 GTP 3`,8-cyclase n=81 Tax=Bacteria TaxID=2 RepID=A0A132MNZ1_9ACTN  ali  16  29..................................................DQYRRRLRTLRISVTDRCNLRCQYCMPEEEREDLLSFEEISRLTDVFISLGVEKVRLTGGEPLLRRDVSELVRQLASK---QGIRDLAMTTNGVRLAEHAESLREAGLHRVTVSLDTLRPERFRALARRDSLSAVLEGIRSLARVG---FTGTKIDTVVIRGVNDDELTDLIEF---GRQVPAEVRFIEYMDVGGATGWSWEKTVSRDEILATLTRYYGSVEPVMDDDESATADRFALPDGTFGIISSTTQPFCGSCDRARLTADGMWYLCLYALIGIDLRTPLRQDATDDEL... 318
314 0.000e+00UniRef50_A0A2B4S549 Molybdenum cofactor biosynthesis protein 1 n=2 Tax=Eukaryota TaxID=2759 RepID=A0A2B4S549_STYPI  ali  16  40.................KPMEDDNVQNIKSSRQRKYFKDQEIRPLSDFLTDKFGRHHTYLRISLTERCNLRCQYCMPEEGNSELLTTEEIVSLAKLFVGEGINKIRLTGGEPLVRKDIVELCE---ELGRIEGLETLAMTTNGITLARKLPQLKRVGLNLLNISLDTLVPQKFEFVTRRKGWHKVMESIDCALELGYN---PVKVNCVVMRGLNEDEVCNFVEMTQN---KAIDVRFIEYMPF-DGNKWNFKKFVPYSEMLESISKTWPNVEK-VSDHPNDTSKAYKVPGF---------------------SADGNLKVCLFGNSEVSLRDSLRAGTSEEELLE. 340
315 0.000e+00UniRef50_M7WY68 Molybdenum cofactor biosynthesis protein n=6 Tax=Microbotryomycetes TaxID=162481 RepID=M7WY68_RHOT1  ali  18  84................................................LTDSFGRKHDYLRISLTEKCNLRCTYCMPETGNPNLLTTPEIERVARMFVRQGVRKIRLTGGEPTVRKDLVDVVERLGRL----PLTSLGMTSNGVALPRKLPSLVSAGLTHLNLSLDTLDPLKYELMTRRRGFERVIECLEMAEEM---EGLDVKLNVVVIRGLNDMEVPQFVEMTKDKK---ITVRFIEYMPF-EDNRWSTTKLVPSASLLSTLTALHPTLTH-VPTHKSDTTRHYAVPGWKGGFISSMTDHFCGGCSRLRVGADGGMKVCLFGPPVLSLRPLLR........... 366
316 0.000e+00UniRef50_G2LLG5 GTP 3`,8-cyclase n=32 Tax=Bacteria TaxID=2 RepID=G2LLG5_CHLTF  ali  16  15................................................LRDAHGRVIRDLRISITDRCNFRCTYCMPDEGVEELLTVDEILALARVFVGLGIEKIRLTGGEVLLRDDVVALTRALRQL---PGVKDLALTTNGYRFEQYAAALAEAGLQRITISLDSLREETFHRLTRVRALDRVL----RAIELAHRYRLPVRVNCVLMRGVNDGEIEDFADFA---RAWDVSLRFIEYMPLDGPGEWQPTLVVPGREVRARIQARYP-LIPIAGQSPSETARRYRFADGEIGIIAPVTEPFCGACSRLRLTADGKLRTCLFSVVEYDLRDALRAGA........ 302
317 0.000e+00UniRef50_UPI000B78B2A6 GTP 3`,8-cyclase, mitochondrial-like n=1 Tax=Hevea brasiliensis TaxID=3981 RepID=UPI000B78B2A6  ali  15  62.......................................PNVNSVSDMLIDSFGMKHTYLRISLIERCNLRCQYCMPAEGSPKLLSQNEIVHLANLFVSSGVDKIRLTGGEPTIRKDIDEICLQLSNLK---GLKTLAMTTNGIALARKLLKLKECGLTSVNISLDTLVPAKFEFMTGRKGHQRVMESINAAIDCGYN---PVKVNCVVIRGFNVDEICDFIELT---RDKPINIRFIEFMPF-DGNVWNVKKLVPYLEMLYRVAKKFTELKRLQ-DHSTDTAKNFKIDGHLGTFITSTTEHFCAGCNRLRLLADGNFKICLFGPSEVKVR............... 349
318 0.000e+00UniRef50_Q31JB9 GTP 3`,8-cyclase n=43 Tax=root TaxID=1 RepID=MOAA_HYDCU  ali  13  3................................................LIDPFNRKIDYLRVSVTDKCNYRCGYCMPEQGHTEYLDYDELARIIKAFVDLGVTKVRITGGEPLVRKGLPGFIEEIQ---PYEGLEEIALSTNAHHLDKHAVALKKAGLSRANVSIDSLQPEKFNKITRGGNLEKVLAGVDAGLAAGLN---PIKFNMVVMKGTNDDEIEAMVDYGIEKGV---EVRFIETMPIGEAGISLMDQHYPMEKIMARVRAHVGDLIPATGKSHDGPSKNFHIKGAKIGVISAVSQHFCESCNRVRLTARGVLALCLGQEDSVDLRTPIREGISDE..... 295
319 0.000e+00UniRef50_A0A1G1E2D7 GTP 3`,8-cyclase n=1 Tax=Nitrospirae bacterium GWA2_42_11 TaxID=1817752 RepID=A0A1G1E2D7_9BACT  ali  17  3.........................................NETQKTQLVDAFNRKITYMRISVTDRCNLRCVYCVPSCGTNELLSFDEILRLVKVASKMGLNKVRITGGEPLVRRGVIEFVAALNK---IDGINDIAMTTNGVLLKNYAQALKKAGLRRLNISLDTFDPKKFKAITKGDCFDKVWEGILEAERVG---FQPIKLNVVPSKGCNDDELVDFGKLTLT---KPFHVRFIEFMPVDDWDGW-KKSFISKAEMMEKIEAGLGKLEPVRDEDKTGPAKNYRLHGAPGGFISAISEHFCDTCNRIRLGADGKIKHCLFSESYIDFREPLRNGCDEKE.... 302
320 0.000e+00UniRef50_UPI00097740CC GTP 3`,8-cyclase MoaA n=1 Tax=Desulfatitalea tepidiphila TaxID=1185843 RepID=UPI00097740CC  ali  16  8...............................................PLSDHRHRVISYLRVSVTDRCNLRCRYCMTSHPKGHILTLEEIHRMVRIAVGLGITKVRLTGGEPLYRKGIVGLVQ---KLAAEPGIEDLSMTTNGTLLAEKASALKAAGLKRINISLDTTDPQGFAELTGRDLFSAVWQGIMTAREVG---FTPIKINAVVLRGCNDDQIEALADL---SRRYPFHVRFIEYMPI-ATDPHEAEHFFFPITEIAQRLEKMGRLLPVAHERLDGPAQRYRFADAPGEIIGSMSSHFCDTCNRMRLTADGHLRPCLLSDEEVNVIDALRQGAGDEEI... 299
321 0.000e+00UniRef50_E6W5C5 GTP 3`,8-cyclase n=3 Tax=Chrysiogenaceae TaxID=189770 RepID=E6W5C5_DESIS  ali  19  3..............................................QQLLDSQGNPITYVRISVTDRCNLKCFYCVPEDGKDQLLTPEEIIRVLNLLHGLGVSKVRITGGEPLARRGIGKLIRQISAIGFS----DIAMTTNGVLLPRFAGLLRECGLKRVNISLDSLHPERFASITGVDSFEQVWKGIQAAQENGL---VPIKINAVAIRGINDDEIADFVALTE---HEDISVRFIEYMPVGIRDRYNTDQLVSVAEMLSQVKNR-FSIEPLDQERYS-TARMFRIVGGRGGFISPMTEHFCHTCNRLRITADGKIKTCLFSKQEHDLRQQ--NCSDAELR... 296
322 0.000e+00UniRef50_A0A250WPM6 Uncharacterized protein n=1 Tax=Chlamydomonas eustigma TaxID=1157962 RepID=A0A250WPM6_9CHLO  ali  17  122............................................KNDVLTDQFSRRHTYLRISLTERCNLRCVYCMPPEGVQSLLSTSELLRLASLFVEAGVNKIRLTGGEPTVRPDLIELCRHLSMLS---GLKTLAMTSNGIKLERQLPELKAAGLNALNISLDTLKAERFEVLTRRKGHDRVIKSIATAVNLGYN---PVKVNVVVMRGVNDDEISDFVMLTKD---RPINVRFIEYMPF-DGNIWRDTKMVTYKEMLERVEQSISRLMNRLTDPKGEVAKNFKIEGFQGTFVTSMTSLFCGDCNRLRLLADGSLKVCLFGANEVSLRDAMRGGASDDIRL.. 441
323 0.000e+00UniRef50_A0A192WT06 GTP 3`,8-cyclase n=1 Tax=Acidobacteria bacterium Mor1 TaxID=1660251 RepID=A0A192WT06_9BACT  ali  18  3................................................LVDGFGRQHDDLRVSVTDRCNLRCAYCMPEEPRERILSFEEIERLVRLLVADGVRKVRITGGEPLVRSGIESLVGMLA---AIDGVEDLSLTTNGVLLDRLAEPLRRAGLRRLNVSLDTFRADRFAELTRRDQLDRVLAGLVAARDAGFE---RIKINTVLMPGVNDDEVEEIVERSRREG---YEVRFIEFMPLSNGS-WDPARVLSGDKVRERIEARWP-LTPDPAGDPHAPATRYLFTDGAGGFINSVTAPFCSNCSRLRLTSDGHFRVCIYDNNEVDLKTPMRAGASDE..... 290
324 0.000e+00UniRef50_A0A1E3P7T4 Uncharacterized protein n=2 Tax=Saccharomycetales TaxID=4892 RepID=A0A1E3P7T4_WICAO  ali  15  3...............LRRLYSTAIRPSLSETSAKRWDAVKNAKPITHFLTDNFNRRHDYLRISITERCNLRCLYCMPEEGDSQILSTDEIIQIAEMFVKQGVKKIRLTGGEPTVRKDILEIME---SLNQIEGLNEICITSNGIALNRKLPKLAKSGLTSLNLSLDTLVEGKFTLITRRNGLSNVLKSLETALKLGI---PKVKLNVVIIRGLNDDEILNFVKLAQ---YYPLEVRFIEYMPF-DGNKWEVEKVISFKEIIDIIKTKHPIIEQLTHKYG-ETSKIFQIPGFKGGFITSMTSDFCGDCTRLRITSDGNLKVCLFGNDEVSIKNLLRAGVDESEILE. 328
325 0.000e+00UniRef50_A0A1M4MA29 GTP 3`,8-cyclase n=9 Tax=Bacteria TaxID=2 RepID=A0A1M4MA29_9FIRM  ali  16  1................................................MKDSFGRSINYLRISVTDLCNLRCKYCMPEKGHKDILSLEEIYEIAKVFVSLGINKIRLTGGEPLTRKGFVNLVE---KLGNLDGIKDLAMTTNGILLKKYARDLKSAGLNRVNISLDTLDEEKYSQITRGGRLKDVLDGIDVAKSVGL---TPIKINTVLIGGFNVNEIEDFVNLTRADE---IDVRFIELMPVGEASKWAEENFVS----NEVILDKVNTLKSVERLDPSSPAVYYKLPGAKGGIINPISCKFCDYCNRVRLTSQGKLKLCLHSNEEIDLKDKLRQGEDIEKII.. 290
326 0.000e+00UniRef50_A0A0C2X228 Uncharacterized protein (Fragment) n=1 Tax=Serendipita vermifera MAFF 305830 TaxID=933852 RepID=A0A0C2X228_9HOMO  ali  17  6........................................NSTTVSKPLIDTFNRKHTYLRISLTDRCNLRCNYCMPPSPSSSILTTPEILRLATLFVQQGVNKIRLTGGEPTIRRDIIPLVTELSRNLRPAGLRTLAMTSNGVVLRRKLPELVENGLTHLNLSLDTLDPKTFTLVSNRPSHAAALSTLQTALSLSPAL-QSLKLNVVVMADMNLHELPAFAALTQD---HPITVRFIEYMPFS-GTTWRANQMIPSRVVLDRLKGKFPGIAPIVPEHESGTAKEYRIPGYKGGFISSMSDHFCASCTRLRITADGQLKVCLFDPREVSLRDMIRNGASDESLLE. 323
327 0.000e+00UniRef50_E8R2S4 GTP 3`,8-cyclase n=14 Tax=Planctomycetales TaxID=112 RepID=E8R2S4_ISOPI  ali  16  17.................................................IDGFGRIHNNLRISVTDRCNIRCVYCMPETPRAEILSFEEIERVVRVAVGLGINKLRLTGGEPLVRRDLTKLV---ARLTAIPGIQDVGLTTNGLLLGPLAQPLWDAGLRRINVSLDTLDPVSFRELTRRDGLEQVIEGILAAKRAGFD---PVKINAVAIKGVTESQVVPLARFC---REHHLEMRFIEYMPLDAENRWERDKVLFAEEILNLLTEAFGPLRPSPNQDPRAPAQDYDYLDGGGRVIASVSRPFCASCNRVRLTADGKLRHCLFALEETDLRALLRGGADDE..... 305
328 0.000e+00UniRef50_C7M1B9 GTP 3`,8-cyclase n=23 Tax=root TaxID=1 RepID=C7M1B9_ACIFD  ali  16  5..............................................TPLIDPFGREITDLRVSITDRCNFRCTYCMPEEGRGELLSFEEITRIARVMAAFRLQSVRITGGEPTVRAQVPSLIEQLAQVRRPDGGLELSMTTNGATFALLADDLVSAGLARVNISLDTLRPERFAQITRRTRLERVIEGIDAAIRVGLS---PVKLNTVVMRGVNEDELPDLVHFAVDRG---IEVRFIEFMPLDGDGHWSPRD-VVSEAEMLELLAAHFSFHPL--ARSSAPATTYELDDGSGRFIPTVTHPFCDACDRVRLSADGRLRTCLFALDEHDLRPLLRGGAGDDALAE. 303
329 0.000e+00UniRef50_A0A2H3DYZ4 Molybdenum cofactor biosynthesis prote n=2 Tax=Armillaria TaxID=47424 RepID=A0A2H3DYZ4_ARMGA  ali  18  45...........................................PFSPALIDTFRRRHDYLRISLTERCNLRCFYCMPEEGESHLLTNEEVLRLAALFVKSGVTKIRLTGGEPTVRKGLNEIIGGLNELRP-YGLRSIAMTTNGLALPRRLPTLIDQGLTHLNISLDTLDPFKFEFMTRRRGHEAVLKALDAALASPALVSVKLN--VVVVKGLNDSEVLDFIEMTKG---QVLSVRFIEFMPF-TGNAWDKRKMVPSSVLFGKIMLHHPDVERISDE-VNDTARSWRVPGYKGGFISSMSDHFCSSCNRLRITADGQIKVCLFDAKEISLRDAMRKGATDDELL.. 344
330 0.000e+00UniRef50_G7E107 Uncharacterized protein n=2 Tax=Mixia osmundae (strain CBS 9802 / IAM 14324 / JCM 22182 / KY 12970) TaxID=764103 RepID=G7E107_MIXOS :  ali  17  50..............................SSRLAQMRRKLAASPREPLVDRFGRRHDYLRISLTEKCNLRCTYCMPEQGAPHLLSTPEIARIARLFVANGVRKIRLTGGEPTLRPDLLDLMAQLDSMH---GVESIGITSNGIKLLRQLPALISNGLTHLNISLDTLDPFKFTLMTRRQGHSRVLQAIEGAVALLHKPDQTVKVNVVVIRGLNDDEVLDFAALAARL---PVQIRFIEYMPF-DDNHWEQKKLVPSAELLDRLRQVYPSLTRRPAQ-MSDTSRDYTVAAWRGGFISSMTDHFCSGCSRLRLNADGGVKVCLFGPPKLNLREKIREGHSDARLLS. 375
331 0.000e+00UniRef50_A0A2H6ADR4 GTP 3`,8-cyclase n=4 Tax=Bacteria TaxID=2 RepID=A0A2H6ADR4_9BACT  ali  17  22...............................................PLVDTFGRLHTNLRVSVTDRCNLRCTYCMAEDDRQELLSFEEIVRFVRLLVPLGVNKIRLTGGEPLVRRDLDKLVAM---LCAIPGITDLSLTTNGILLAEQAERLYRAGLRRLNISLDTLRPEVFRQLTRRQGLERVLEGIRVARQLGFR---PIKLNAVSIRGITEEEVVPLARFA---RENDLELRFIEYMPIG-ADHWERSKVYFAEEILQQLARAFGPLRPVPVGDGTAPAQEWEYPGGRVGIIASISRPFCHHCNRLRLTADGKLRHCLFALEETDVKSLLRGGANDK..... 310
332 0.000e+00UniRef50_A0A0N4ZRW2 Uncharacterized protein n=1 Tax=Parastrongyloides trichosuri TaxID=131310 RepID=A0A0N4ZRW2_PARTI  ali  16  500........................................SIPQNSQILTDTFGRRHEYLRISLTEKCNLRCNYCMPEEGKNNILTNDEILILVKLFEKHGISKIRLTGGEPTLRKDLSHLIKNIHSFK---GIKSIGLTTNGITLSRQLPELVSSGLSHVNISLDTLDPNKYMIMSRRNGFIKVMDSI----KLAQNFFPYVKINTVIMRGVNDDEVVNFVKLTESEN---LDIRFIEFMPFG-GNKFDNKIMVPYKELLEKIKKSFKEKVIKLEDNKNDTSKGYFVDGWKGGFISSMSEHFCGTCNRLRITADGSLKVCLHGNTEISLRDLIRSGKDEKYL... 798
333 0.000e+00UniRef50_UPI00045615DB hypothetical protein n=1 Tax=Anthracocystis flocculosa PF-1 TaxID=1277687 RepID=UPI00045615DB  ali  16  2..............................................................SLTERCNLRCLYCMPEEGKDHLLSTDEVQRIASLFVDQGVNKIRLTGGEPTVRRDLLDIVSSFNQLKHK-GLHQIGITSNGISLARKLDGLVASGLTHLNVSLDTLDPFKFEFMTRRRGFDAVMKSIDRALELGVQS---LKLNVVVIKGLNDHDVLDFVEFT---RDKPVTVRFIEYMPF-DGNKWQVKKLVSYRDLVETIRSKYPDFARLPKDDANDTSKHWQVPGHKGGFITSMTDNFCGTCNRLRVTADGNLKVCLFGNAEVSLRDAMRHG......... 277
334 0.000e+00UniRef50_A0A101EX67 GTP 3`,8-cyclase n=33 Tax=root TaxID=1 RepID=A0A101EX67_9BACT  ali  18  5..................................................DRFGRKISYLRISVTDRCNFRCVYCMPPRGHGEILRYEEIVRVVRAAATLGIRKVRLTGGEPLVRRGLADLV---RELSEIPGIEEVVLTTNGALLSENAEALAAAGLSRVNVSLDTLRPERFREITRLGRLEDVWEGILAARKAGL---VPIKLNAVVLRGVNEGEVAEIAALARE----GFKVRFIEWLPLGGVGEADPGWFVPWEEVRARVEGALGPLRPLGVQ---GPARVFSLPGGEVGFIAARSAPFCPSCNRMRITADGKLRPCLLSPLEIDLKGPLRAGATQDEL... 290
335 0.000e+00UniRef50_B5YJ09 GTP 3`,8-cyclase n=34 Tax=root TaxID=1 RepID=MOAA_THEYD  ali  16  1................................................MKDNFNRNIDYLRISIIDRCNLRCIYCMPEEGHHEILSYEEILKIVEIGVDLGITKIRITGGEPLLRKGIVSFIERLAR---IEGIRDIGMTTNGVLLKKFAKDLYNAGLKRVNVSLDSLDENKFRAITRVGLIDDVFEGIDEAKNAGLQ---PVKVNVVVMKGINDDEIEKFALWSKKVE---YQIRFIEFMPVGQ-NAWKKELFISKDEIKERIENKIGKLIP-VQMKKSGPAEYFMLAGAKGGFISPMTTHICVRCNRLRLTADGKLRPCLFSDKEVDIKKILRSGASTEEI... 292
336 0.000e+00UniRef50_B5EIK8 GTP 3`,8-cyclase n=18 Tax=Bacteria TaxID=2 RepID=B5EIK8_GEOBB  ali  18  3................................................LIDAYGRRINYLRLSVTDRCNMRCSYCMPAQGHKEMLSYEELYRVAGACIAQGIEKIRVTGGEPLVRKGIVPFLERLAR---VPGLKELVLTTNGLQLEEMAQPLKRAGVARLNISLDSLRPEVFARITRGADLKRVLSGIEAAEKAG---FANLKINMVVMRGVNDDEILDFAALSIE---KPYTVRFIEYMPTLQDEGWNAQSM-PGSEILARIAERYP-LLPMVGAEMAGPARNFKIEGAAGGIITPVSGHFCESCNRIRVTAAGRMRGCLFSDQGVDLK............... 281
337 0.000e+00UniRef50_A0A2K3D1A8 Uncharacterized protein n=1 Tax=Chlamydomonas reinhardtii TaxID=3055 RepID=A0A2K3D1A8_CHLRE  ali  17  314...............................................MLTDTFSRVHTYLRISLTERCNLRCTYCMPDEGVAQLLTTPEIMRLARLFVEAGVTKVRLTGGEPTLRRDILDLVGQLGALRXXRGLSSLAITSNGIVLARQLPALKEAGLTAVNISLDTLRPERFQQLARRPGHGRVMEAIATAARLGFD---PVKVNVVVMRGVNDDEVADFAALT---RHQPVNVRFIEYMPF-DGNVWSDSKMVPYRELLTRLRAAFPDTPERLDDPRGEVAKNFRLRGHVGSFITSMTQHFCHDCNRLRLLADGNLKVCLFGSSEVSLRDALRGGASDDDL... 654
338 0.000e+00UniRef50_V9WF21 GTP 3`,8-cyclase n=46 Tax=Paenibacillaceae TaxID=186822 RepID=V9WF21_9BACL  ali  13  6.................................................TDRYGRNHDYLRISVTDRCNLRCVYCMPAEGEDRLLSFDEIIEFVRVAARMGISRLRLTGGEPLVRKHLSVLIRRLAE---IPGIQDIALTTNGMLLAKQARVLKEAGLTRVNISLDSLRPDRFRQITRGGEVSRVLDGIRSSCEAGLS---PVKLNVLLMKGRNDDEIADFLRMTID---HPVEIRFIEYMPIGTRNEEWREGYIPLQVVKERALQAGYDFTGTDKGIGSGPAEYYRIQGAAGTFIHPVSEHFCKTCNRLRLTADGNLKPCLYWSDEWNVR............... 285
339 0.000e+00UniRef50_Q1AX93 GTP 3`,8-cyclase n=3 Tax=Terrabacteria group TaxID=1783272 RepID=Q1AX93_RUBXD  ali  18  1.............................................MTQLIDSYRRKIDYLRISVTDRCNFRCQYCMPEDDKSHILTLEEMLTFAEACLALGVTKVRVTGGEPLVRRGVVKFVGWLKELGFD----EVTMTTNGYLLKENLEGLVEAGLDRINISLDTLQPEKFAFITRRNHFHRVWEAIMAALKTPLS---PVKINAVAMRGINDDEIPEMARLTLR---YPMHVRFIELMPLNGDTDRFRKLFVPGEEILERAQAELGELHPVEKEDPAAPADEFKFEGAPGGVITPVSDPFCARCSRLRLTADGKIHPCLLTDLDVDVKGAIRS.......... 289
340 0.000e+00UniRef50_UPI000B939BC4 GTP 3`,8-cyclase, mitochondrial isoform X1 n=4 Tax=Aphididae TaxID=27482 RepID=UPI000B939BC4  ali  16  8.............................NNKWSVKSISTKKSLVNEVLTDTFGRKHNYLRVSLTERCNLRCEYCMPLKGQSKLLSNDEIVRLVSLFANQGVDKIRITGGEPTVKKDIIHIVESLRSIK---KLKTIAMTTNGLTLTKHLVDLQRAGLNALNVSLDSLQQNTYGNITRRDGLKRVLAGIDLALQLGFS---PVKVNCVLMKGVNFDELGDFVEMTRDRK---INYRFIEFMPFSMND-WEENRMVPYKEAIREIMKSHPNFEPCDNEPNS-TSKMYRVPGFAGGFISSMTDDYCDSCNRLRLMADGNLKACLFQNNEISLRDPLREGASDEELLD. 321
341 0.000e+00UniRef50_A0A2S5BJE9 Uncharacterized protein n=1 Tax=Rhodotorula taiwanensis TaxID=741276 RepID=A0A2S5BJE9_9BASI  ali  18  38..............................SRQQARLKIQAQDAVSPHLIDSFGRRHDYLRISLTEKCNLRCTYCMPEQGNDSRLTAAEIERVASVFVRNGVRKIRLTGGEPTVRSDLVDIVERLGRLRQ---LDSLGITSNGIALKRKLPALVDAGLTHLNLSLDTLDPFKYELMTRRRGFDRVVEVLDLAQRLGRGSPLRVKLNVVVIRGVNDDEVADFVALTRDQN---ITVRFIEYMPF-EDNRWSTRKLVPSADLLATLESKHPDLVKL-RDSANDTTRAYAVPGWRGGFISSMTDHFCGTCSRLRIGPDGGVKVCLFGPPVLSLRPLLRGSSSAD..... 348
342 0.000e+00UniRef50_A0A1I4SS80 GTP 3`,8-cyclase n=2 Tax=Deltaproteobacteria TaxID=28221 RepID=A0A1I4SS80_9DELT  ali  18  6.................................................IDAHGRTVDYLRISITDRCNLRCIYCMPEEGHEDVLSYEEIIRILNVAGSIGISKVRVTGGEPLVRKGVVEFC---RSLVEIVGRGCVSITTNGVLLEEFAWDLWNAGIRRINVSLDTLKRERFAEITRRDYFNRVWNGIMTAYRIG---FHPVKLNVVVIKGLNDDEIEDLAALTFE---YPFHVRFIEFMPFGSGEWSS--RFVSSDEIVERL-KNVGELLPAVSLNSNGPAKYYAFRGALGGIISPISHHFCATCNRLRLTADGKLRTCLFATKETDLRAILRSSEDDEKLKE. 296
343 0.000e+00UniRef50_A0A175VSA3 Molybdenum cofactor biosynthesis protein 1 n=1 Tax=Madurella mycetomatis TaxID=100816 RepID=A0A175VSA3_9PEZI  ali  15  45......................................KAIQPTVSDSLMDTFGRRHTYLRISLTERCNLRCKHGVPLTPDANLLTTDEIIKLSSLFVSQGVNKIRLTGGEPTIRKDIIHIVEQLNSLRDK-GLKKICMTSNGVSLDRKLEKLAAAGLTHLNLSLDTLVPAKFEFITRRKGIDKVLSSLHRAVDL----GLTVKLNCVPVKGFNEDELVDMARLAEKL---PIDVRFIEFMPF-DGNQWNEAKMVPSSAILDNFRTIFPGISAEVTEKPR-TSDSYSVPGFRGGFISSMTDAFCGTCNRIRLTADGHLKVCLFGNSEVDLKTVLREESR....... 337
344 0.000e+00UniRef50_D9S0C9 GTP 3`,8-cyclase n=15 Tax=Bacteria TaxID=2 RepID=D9S0C9_THEOJ  ali  16  1................................................MKDRFGREIDYIRVSVTDRCNFRCIYCMPEGGVADILRFEEIARFLEAIVPLGISTVRITGGEPLVRKGIADFVRMVRR---IPGVKDIAMTTNGSLLAGMAADLKSAGLNRVNISLDSLRPERFGRVTRGGDLKSVLKGIDAALENGLE---PVKINCVVIKGFNDDEIMDFAKLTIERN---LTVRFIELMPVGESKKARMN-FVPAGRISRSL---GGELEPVEPEEGKGPAVYYRLPGAKGGFIAPMTRHFCAECNRVRLTSDGKLKVCLDSEEEFDVKAALRGGASGEDL... 290
345 0.000e+00UniRef50_A5G480 GTP 3`,8-cyclase n=41 Tax=Bacteria TaxID=2 RepID=A5G480_GEOUR  ali  17  3................................................LIDSYGRRINYLRLSVTDRCNLRCSYCMPAEGHGEMLSYEDLYRVACESVALGIEKIRVTGGEPLVRKG---LVQFIGRLADIPGLKELVLTTNGLLLGELAIPLRQAGAQRLNISLDSLKPETFARITRGGDLRKVVDGIAAAEEAG---FPPVKINMVVMKGINDDELLDFAALTI---HKPYTVRFIEYMPTLRDKGWNSQCMAGS--EILERIGRHYPLLPLVGNEMAGPSRNFKIRGSAGGIITPISGHFCDSCNRIRVTASGLLRGCLFADNGVDLK............... 281
346 0.000e+00UniRef50_A0A1B9F8K4 GTP 3`,8-cyclase n=3 Tax=Bacteria TaxID=2 RepID=A0A1B9F8K4_9DELT  ali  15  1................................................MKDRYGREIRYLRISVTDRCNLACTYCNPERPSNELLTLEEIEFVARAFSRLGLKKIRLTGGEPLLRKGIVDL---AKKLYSIQGIEEVCITTNGVLLLDYADSLYDVGVRHINISLDTLRPERFKEVSGKDALHRVLAGIERVIELG---FFPIKINTVLIKGINDHELFDFARLTMEN---VLEWRFIEYMPIGSKCSWQEGEVITTDTAKKRLEEQFGPLEEVFPNGKHGPAKLFRIKGAKGGFISPMSHHFCDTCNRLRLTPDGKLRLCLFSDNEVDLKTKIREGMSIE..... 292
347 0.000e+00UniRef50_J9K129 Uncharacterized protein n=4 Tax=Macrosiphini TaxID=33386 RepID=J9K129_ACYPI  ali  16  8.............................KNKWSVKSISTKKSSFNEVLTDTFGRKHNYLRVSLTERCNLRCEYCMPLKGQSKLLSNNEIVRLVSLFAKQGVDKIRITGGEPTVKKDIIQIVESLRDIR---KLKTIAMTTNGLTLTKHLVDLQRAGLNALNVSLDTLQENTYGKITRRDGLKRVLAGIDLALQLGFS---PVKVNCVLMRGINFDELGDFVEMTRDRK---INYRFIEFMPFSMND-WEEKRMVPYKEAIREIMKSYPNFEPCDNEPNS-TSKMYRVPGFAGGFISSMTDDYCDSCNRLRLMADGNLKACLFQNNEISLRDPLREGASDEELLD. 321
348 0.000e+00UniRef50_A0A212FEK0 Molybdenum cofactor biosynthesis protein 1 B n=3 Tax=Papilionoidea TaxID=37572 RepID=A0A212FEK0_DANPL  ali  14  20................YQTFSLKRFINSDLKPNIKETANLLLRNDVPPLVDLYGRKHDYLRISLTEKCNLRCQYCMPAEGRDKILSNEEVLRLARVFAALGINKIRLTGGEPTLRKDLVNIVQELTNLH---GITTVAMTTNGIALTRKLPSLQRAGLSALNLSLDSLKPERFERMARRPGLPHVLASMDLALQLGFKS---VKINTVLMKGFNDDEICDFIELT---RDRDMDIRFIEFMPFSGNRWEKGERMVSEKDAISAAIERYGDLIPLPPT-PCRTATLWQVPGYTGGFISSMTKPFCSTCNRLRLTADGNLKVPL---RETNLRDAIRAGVNDD..... 342
349 0.000e+00UniRef50_A0A1G1DXW0 GTP 3`,8-cyclase n=4 Tax=Bacteria TaxID=2 RepID=A0A1G1DXW0_9BACT  ali  15  1...............................................MLSDSFERQIDYLRISITDRCNYRCLYCMPANGRHQLLSYEETLTIVELFVKLGLSRFRITGGEPLIRKGLVELIGAISQIK---GVADLALTTNGTLLARYARALKGAGLKRINISLDSLNPQKYYEITRGGNIHEVLAGIDAALDLGFS---PIKLNTVVIRGINDDELIDFVRFASA---KPLEIRFIEFMPLGKEGIWSPEKFIPGKEIRARITREIP-INPITDTRGGGPAEYYQIKGSPGGFITSLTENICQRCNRVRLTADGYLRTCLLADREYDVKALIREGASEEEILS. 297
350 0.000e+00UniRef50_B5EED9 GTP 3`,8-cyclase n=11 Tax=Deltaproteobacteria TaxID=28221 RepID=B5EED9_GEOBB  ali  20  3................................................LIDTYGRRINYLRLSVTDRCNLRCRYCMPEEGHSQVLSYADLLRISTEAVAAGIEKIRVTGGEPLVRKG---IISFLERLGALPGLKELVLTTNGLLLKEMAQGLREAGVQRLNISLDSLKPETFAAITRGGELKRVLDGLEAAEKAG---FPPHKINVVVMRGVNDDEILDFVELTMK---RPYAVRFIEYMPTCGDADW-RELCVPGAEIRERIGER-YLIEEVSNSELSGPSKNFKVQGAQGGIITAMTGHFCNGCNRLRVTASGIAKGCLFSGDGVDLR............... 281
351 0.000e+00UniRef50_A0A075KAH5 GTP 3`,8-cyclase n=5 Tax=Bacteria TaxID=2 RepID=A0A075KAH5_9FIRM  ali  15  1.............................................MDGLYDIVGRRIHYLRVAVTDRCNFRCQYCMPSDGHDNILRYEELLRIIHAFTSLGIDKVRITGGEPLVRKG---LIPFLKKVTAIAGIKEVVLTTNGSMLEEYAPLLKKAGVKRVNVSLDTLYPERFKQITGQDALHQVLAGIKKAQAVGL---TPIKINMVVMKDFNSDELADFANLAMEN---PYQIRFIEYMPFC----SDKNYLFTAAEIKQQLITAGFT-TMLPEVSNNSPAQVYRFPQSQGGFITPVSQHFCSSCNRIRLTPDGNLKPCLLSNQEYSLRDVLRAGISDQELLD. 293
352 0.000e+00UniRef50_A0A1Y0H3E8 GTP 3`,8-cyclase n=1 Tax=Armatimonadetes bacterium Uphvl-Ar1 TaxID=2004467 RepID=A0A1Y0H3E8_9BACT  ali  16  20................................................LTDRFGRFHDYLRVSITDRCNFRCVYCMPEEGREDILTFEEIERLARFFVERGVRKIRLTGGEPSLRKGYLNLVEALA---AIPGLRQLALTTNGTRLAQDAVALKAAGLASVNVSLDTLRQDRFLEITRRDELPRVLQGIEAA----HAAGLKIKVNVVVLPGVNEDEIIHFGEFACE---HSLTVRFIEFMPFLD-NGWSAERVVTSAEIRARLSNQFE--LQLLASGASDLAREYAINGSEGRFVSSVTESFCSGCNRLRLTADGQLKSCLFLPPSVSLRDLIRGGAPDAEL... 308
353 0.000e+00UniRef50_B9XSN7 GTP 3`,8-cyclase n=6 Tax=Verrucomicrobiales TaxID=48461 RepID=B9XSN7_PEDPL  ali  18  2...........................................IRAKVLVDSHGRTLRDLRVSITDRCNFRCMYCLPEQPKSKLLTFEEIERVVRIAAELGIQKIRLTGGEPLLRKDVEQLVSLIAK---VPGIEDLAMTTNGFLFPEKGKALRDAGLKRISFSLDSLDRANFQKMTGRDGLTEVLESIRFAQELGMN---PVKVNAVIIRGINDHEIEALAAFA---RERDLSMRFIEFMPLDSAHAWKKEFVMPGREILERLQRSH-QLQPIVSDNPAETARRWRFSDGRGGLISPVSEPFCGHCNRLRLTADGKIRTCLFSVTEHDLRERLRSGASDDELNEY 321
354 0.000e+00UniRef50_A0A136M2B8 GTP 3`,8-cyclase n=1 Tax=Omnitrophica bacterium OLB16 TaxID=1617433 RepID=A0A136M2B8_9BACT  ali  16  4...............................................PLIDRFGRRHTYLRISVTDRCNLRCTYCMPEEGHFDLLTFEEISRVLQIFAEMGINKVRLTGGEPLLRKGLPNLISSISQTS---GIDKVGLTTNGILLTDYAEPLRNAGLKSVNISLDTLNQDRFLQITRVGRIEKVLEGIEAAIA---GAFSPIKINMVVMKDFNDDEISDFIEYFFE---KPVHLRFIEFMPF-RSNGWNRQKLIPAAAI-RQIIGERFSFMPAGSEEPDQVARPYQIEGMKGGIISSMTEEFCESCSRLRLSATGGVKTCLFGPEDGNVRNLLRDGATDVEI... 295
355 0.000e+00UniRef50_A0A194S9S7 Uncharacterized protein n=2 Tax=Rhodotorula TaxID=5533 RepID=A0A194S9S7_RHOGW  ali  16  38.........................SDSALSRARTRIANRDHVQVAPPLVDSFGRKHDYLRLSLTEKCNLRCTYCMPEQGKDDLLTADEIERVARVFVDHGVRKIRLTGGEPTIRRDIVDIVERLGRLS----LSSLGMTSNGIALKRKLPALVSAGLSSLNLSLDTLDPFKYELVTRRRGFDAVMDSLDIAQGL-KPKGLKTKVNVVVIRGLNDHEVPDFVELT---RERDITVRFIEYMPF-EDNRWSTAKLVPSSELLSLISARHPSGLDKLQDAASDTTRAYRVPGYAGGFISSMTDHFCGGCSRLRIGADGRVKVCLFGPPVLSLRPLLRS.......... 347
356 0.000e+00UniRef50_A0A1Z5J6I2 GTP 3`,8-cyclase n=2 Tax=Fistulifera solaris TaxID=1519565 RepID=A0A1Z5J6I2_FISSO  ali  14  26VFETQSIEEFPRLQALREQLQRDQPVIHRTKQRLTTLQPTDDPLPTTILQDSYGRFHNYLRLSLVERCNLRCTYCMPPEGSDNLLTSEEVLRLAAHFVSRGVNKFRLTGGEPTLRKDLTEIIQGLHALRP----KQIGITTNGVVLTRKLNEFIDAGLTSINISLDTLQADKFEQLTRRPYFTKVWESIVAAHQAASEAHLTVKVNCVVMRGVNDEEVPNFIKLTEQFPH--LQMRFIEYMPFS-SNGWDWSKCVPYQELLTD------DLTPVPSPDPSDTTKWYQTPGATVGFITSMSEHFCGSCNRIRLTADGQLKVCLFDGREVNLK............... 359
357 0.000e+00UniRef50_A0A2D3UXE8 Uncharacterized protein n=1 Tax=Ramularia collo-cygni TaxID=112498 RepID=A0A2D3UXE8_9PEZI  ali  13  114........................................NAAPFSAFLTDTHSRQHNYLRISLTERCNLRCTYCMPSEGDRDILTTPEIVYLSSLFVNQGVTKIRLTGGEPTVRKDILPLMQQIGALR-RTGLKELALTTNGISLHRKLEGMVEAGLTGVNISLDTLDPLQFPLLTRRNGFEAVMRSIDRVKDLNRAAGIKLKINIVAMRGVNDDQILPFVAMTESE---DLEVRFIEYMPFG-GNKWSQKKMLPYEQIRQRIQDKWPTFERMRDER-NAVSKTWRVPGFVGGFITSMTEDFCGTCNRLRITSDGNLKVCLHGNTEVSLRDLLRAEGDGE..... 416
358 0.000e+00UniRef50_R7R6Y8 GTP 3`,8-cyclase n=3 Tax=Lachnospiraceae TaxID=186803 RepID=R7R6Y8_9FIRM  ali  17  1................................................MQDSFGRKIEYLRVSVTDKCNLRCRYCMPQEGHDDILRLEEWARIIKIMQELGITKVRFTGGEPLVRKNLIQLIRDVHAL---DGIRQIAMTTNGILLGEQAADLREAGLTHVNISLDTLNPRTFEEITRVDALNQVLSSIEKALQA----GLQVKINCVPCQEWNGEDLTDIAALA---RQYPLDVRFIELMPVGCGSQYHG---ISSDRVLEKLEQQYGRAVPVQADNKGGPAKYYDFAGFQGGVISAMSHQFCGSCNRIRMTAEGRLKLCLHYQDGIELRPLLRKGRTDDEI... 290
359 0.000e+00UniRef50_U5HE94 Uncharacterized protein n=4 Tax=Microbotryum TaxID=34416 RepID=U5HE94_USTV1  ali  17  72.......................LSTRAKAQARIARVDSTSPSKVSPFLIDSFGRKHDYLRISLTEKCNLRCTYCMPETGRDDLLTTDEIERTAKIFVTNGVTKIRLTGGEPTVRKDLIDVVTRLGRL----PLDSLGMTSNGISLKRRLPQLVEAGLTHLNLSLDTLDPFKYELMTRRRGFSAVMESLQVARGLA-SQGLKTKINVVVIRGLNDDEVPHFVELIKD---MDITVRFIEYMPF-EDNRWSTTKLVPSAQLVAKLQTIHPTLEKLI-DPHSDTTRSWRVPGYRGGFISSMSDHFCGECSRLRIGADGRVKVCLFGPPVLSLRPLLRSETTDQDLME. 391
360 0.000e+00UniRef50_A0A0D1E6V9 Chromosome 1, whole genome shotgun sequence n=1 Tax=Ustilago maydis (strain 521 / FGSC 9021) TaxID=237631 RepID=A0A0D1E6V9_USTMA  ali  14  67....................SNLASHQRARQRISDIDAQLEPPSPSHFLRDRHSRQHTYLRISLTEKCNLRCLYCMPEDGHANLLSTSEVQRLATLFVSQGVNKIRLTGGEPTIRSDLPQIVTSLNTLKQH-GLEQIGITTNGIALRRKLDTLVNNGLTHLNVSLDTLDPFKFEFMTRRRGHQAVMDCIERALALGVSS---VKINVVVIKGLNDKDVADFVRYTKD---KPITIRFIEYMPF-DGNKWQVQKLVPYRDLVRTIQTEFPDFERVTRDDPNDTSKHWHVPGHQGGFITSMTDNFCGTCNRLRVTADGNLKVCLFGNAEVSLRDAMR........... 383
361 0.000e+00UniRef50_A0A1G5S0X9 GTP 3`,8-cyclase n=94 Tax=Bacteria TaxID=2 RepID=A0A1G5S0X9_9FIRM  ali  16  1................................................MQDAYGRTIRYLRISVTDRCNLRCRYCMPPSGHESILRNEEIVEVARVAAGLGINKIRLTGGEPLVRKGIIELV---AQLAAIPGIEDLAMTTNAVLLDTMAAPLKAAGLRRINVSLDTLNPERFKEMTRGGDLSRVLKGLEEAERVGI---WPIRLNSVLIGGENDSEIRALAELT---RTKGYDVRFIELMPIGEAATWTEEHFISTD----RILEVLPELVPDIAKAHDGPARYFRLPGASGRIIQPVSCNFCADCDRIRLTADGKLKPCLHSDKEIDLLAAIRAGED....... 286
362 0.000e+00UniRef50_A0A183V249 Uncharacterized protein n=2 Tax=Chromadorea TaxID=119089 RepID=A0A183V249_TOXCA  ali  16  26.......................LEVQQLRRPVLADEFAPSAENTVEGLVDAYGRRHTYLRISVAEKCNLRCTYCMPEEGVPKLLSADEIVRIATIFAANGVTKIRLTGGEPTLRKDIVDIV---GRLSVIPGIEQVGMTTNGIALPQKLEALVDNGLKKLNISLDTLNEAKYMIMTRRNGFKKVIKSIN----LAESMFDQVKINNVIIRGINDDELIDFVALTQYRK---LDIRFIEYMPFG-GNKFEVRKMVPYREMLKVIDKSFPMIIKL-KDQPNDTSKAYSVHGFRGGFISSMSEHFCSSCNRLRVTSDGNLKVCLHGNSEVSLRDVLRAGASD...... 337
363 0.000e+00UniRef50_A0A0N5E379 Uncharacterized protein n=9 Tax=Eukaryota TaxID=2759 RepID=A0A0N5E379_TRIMR  ali  17  17....................RRILQEMPAKNRESQVARHLSAQRTSQSLRDSFGRFHNYLRISLTDRCNLRCKYCMPMNGPDQLLSQSEIFALTSLFSKLGVTKVRLTGGEPTVRTDLMDIVGSLSRIS---GLKKLGLTSNGILLRKMLPKLKERGLTHLNLSLDTLIEPKFQLITGSNGWKHVWKTIEMAERLY----PVIKINCVVIRGYNEEELCDFVELT---RNRSLDVRFIEYMPFN-GNKWEYSKMVSYLEMMQTIQRQFGDLMKLEN-NLNDTSKGYQVPGFRGGFITSMSQHFCGSCSRLRLTADGCLKVCLHGNSEVSLRDAVRSGASEEALIE. 338
364 0.000e+00UniRef50_A0A2M4A995 Putative molybdenum cofactor biosynthesis pathway protein (Fragment) n=1 Tax=Anopheles triannulatus TaxID=58253 RepID=A0A2M4A995_  ali  17  13IVGQDSSKLWGKIGPSNRRVHTAEATLLSQKTDQKNDKNHPANEVSSPLTDTFGRFHTYLRISLTERCNLRCKYCMPAEGKDQLLTSEEVIRLANLFVAEGVRKIRLTGGEPTVRKDLPEIV---SQLKAIPGLESVGITTNGLMLTRQLVGLQRAGLDALNVSLDTLKVAKYEQITRRKGWERVIAGIDLASQLGYRP----KVNCVLMKGFNDDEICDFVELTKERNV---DVRFIEYMPF-TGNRWDTDKMVSFRATLEAIRARYPAFEAL-PNGPNDTSKAYRVPGYRGGFITSMTEHFCGSCNRLRITAAGVFKV.......................... 336
365 0.000e+00UniRef50_A9BF51 GTP 3`,8-cyclase n=9 Tax=Bacteria TaxID=2 RepID=MOAA_PETMO  ali  17  1................................................MIDKYGRSIDYLRVSITDRCNLRCIYCMPPQGHSSILRYEEIIKIVEVGTELGIKKVRITGGEPLVRQGVVNLIKELRK---IPELEDITMTTNGVLLPKYAFALKRAGLSRVNISLDSLNPDTYKTITRRGEFSQAIEGIKAALEVGLN---PVKINTVVMKGINDNELENFVNLTID---KDLHVRFIEYMPMGETSLLSGNYYVSLNEFKEIIIDKMGMV--PVNIQNNGPSKDFKVPGAKGGFITAISHNFCSTCNRMRLTADGFLRPCLASDVEVNMRD.............. 280
366 0.000e+00UniRef50_I8REV2 GTP 3`,8-cyclase n=5 Tax=Sporomusaceae TaxID=1843490 RepID=I8REV2_9FIRM  ali  15  1.............................................MNGLYDSVGRRIHYLRVAVTDRCNFRCLYCMPSEGHNDILRYEEILRIITAFASLGVDKVRITGGEPLIRKG---IIGFLHKVTAIPGIKEVAVTTNGSMLEEYASLLKEAGVKRINVSLDTLDPERFKQITGHDVLYRVLAGIKKAQEIGL---TPIKLNMVVMNGINSDEIADFAKLAINN---PYQVRFIEYMPF----ALERKYLFAADKMKQQLLKAGFAKLIPEM-SNHSPAQIYRFPQAQGGFITPISQHFCSSCNRIRLTPDGNLKPCLLSNQEYSLRERLRAGISDQKLLD. 293
367 0.000e+00UniRef50_A0LJI8 GTP 3`,8-cyclase n=32 Tax=root TaxID=1 RepID=A0LJI8_SYNFM  ali  15  3..............................................SPPTDPYQRRIDYLRLSITDRCNLRCTYCMPEGGHGDILRYEEILRLARIVTAMGISKIRITGGEPLVRRDVLFLCGSIA---GIPQLRSLSITTNGVLLGRLAGGLFQAGIKRINVSLDTLKPGRFASITRQDCFEEVWKGIMAAHEAG---FAPIKLNAVVMRGVNDDEIADLARLTFE---YPFHMRFIEFMPFKEAD--YDDRFLSSEDILDRLRS-VGELVPVESTDSNGPARHYRFAGAMGGIISPISNHFCPTCNRLRVTADGRLRTCLFAREETDLKRALRLGASDEEMM.. 295
368 0.000e+00UniRef50_E3MSE5 Uncharacterized protein n=4 Tax=Caenorhabditis TaxID=6237 RepID=E3MSE5_CAERE  ali  15  46.............EKRNAVLLRMKEVGIPEDANYVVFLQIEKTNGQPPFFDMFMREHTYLRISLTEKCNFRCLYCMPAEGKDKMLTNEEVLKLVKLFASHGIDKIRLTGGEPTIRKDIVQIVEGIAS---TPGIKDVGITTNGLVLPRFLPDLKNAGLTKINISIDSLERQKFAKMTRRDGFDKVWKSI----ELARRYFPKVKLNVVVIRRQNENEIVDFVNLT---RDRNLDVRFIEFMPFG-GNEFTNDQFFGYREMLNLIVEKFRGDVIRLSDSPNDTTKAYKIEGYEGGFITSMTDHFCNTCNRLRITADGNLKVCLHGNSEVSLRDKIRGGDTDEQLSE. 373
369 0.000e+00UniRef50_A0A2T2PA60 Uncharacterized protein n=1 Tax=Corynespora cassiicola Philippines TaxID=1448308 RepID=A0A2T2PA60_CORCC  ali  15  73........................................NAKPFSEFLTDSFDRQHDYLRISITERCNLRCLYCMPEEGVPHMLTTPEIFYLSSLFVSQGVTKIRLTGGEPTVRRDIVPLMQSIGTLRPK-GLRELALTTNGISLHRKLDAMVEAGLTGVNLSLDTLDPFQFQIMTRRKGFDAVMRSIDRILEMKKGANLKLKVNCVVMRGLNERDIIPFVEM---GREKDIEVRFIEYMPFG-GNKWSQGKMISFQEMLDIIRTKYPGL-RSVPGHKNDTSKTYEVPGFVGGFITSMTNDFCGTCNRLRITSDGNLKVCLHGNDEVSLRDLLRK.......... 370
370 0.000e+00UniRef50_A0A1G6R3R4 GTP 3`,8-cyclase n=1 Tax=Halanaerobium congolense TaxID=54121 RepID=A0A1G6R3R4_9FIRM  ali  18  1.............................................MQKLIDQFGRKIDYLRISITDRCNLRCRYCMPAEGHSEILSYEEIIKIAKTAVKMGIKKIRLTGGEPLVRKNVEALIKELNKL----DLEDISMTSNAVALADKASSLKKAGLDRINISLDSLSSEKFEKITRRRALSYVLAGIEAALEADLK---PVKINMVVMKGINDNEILDFVEL---SRNKELNIRFIEYMPLGGEA--EAEKFISSKEIKKIIADKYKLLPAVTK--GSGPANYFKVEGASGGFISALSEHFCSSCNRLRLTADAKIKPCLAGNQEVKIKE.............. 280
371 0.000e+00UniRef50_A0A1V5PLY8 GTP 3`,8-cyclase n=56 Tax=Bacteria TaxID=2 RepID=A0A1V5PLY8_9CHLR  ali  14  2...............................................PFSDSYARPIEYLRVSVTDRCNLRCRYCMPEEGHDAVLRYEEIVRIVRVAVSMG-----LAAGEPLVRRGIVDLV---AQLAAIPGLEDLSMTTNGMLLERYAGELAQAGLRRINLSLDTLRPERFHNITRLGSLEQVLRGREAALEAGLR---PVKVNTVVVRGSNDDEIVDLARLTLLPDWH---VRFIEVMPLGTGEHWSEDGVVPTTEIRARVEAGLGPLISVPNETGVGPARYYQLPGAAGGFISPVSEHFCHACNRLRLTSDGLLLPCLMSDRSIDLRTPLRTGASDSEL... 290
372 0.000e+00UniRef50_A0A0F4GGF9 Uncharacterized protein n=2 Tax=Zymoseptoria TaxID=1047167 RepID=A0A0F4GGF9_9PEZI  ali  15  67.........................................AKPFSDFLTDTYQRQHDYLRISLTERCNLRCTYCMPQEGDRDILTTPEIYYLSALFVNQGVTKIRLTGGEPTVRKDIVPLMKQIGSLRRN-GLQELALTTNGISLHRKLEDMVEAGLTGVNISLDTLDKLQFPLLTRRNGFDAVMKSINRVQEMNKGAGINLKINCVAMRGVNDDQILPFVEMT---REQDLEVRFIEYMPFG-GNKWSQKKMLPYAELVEIIRSRYPDIGRLQ-DGKSAVSKTWQVPGFKGGFITSMTNDFCGSCNRLRITSDGNLKVCLHGNTEVSLRDLLRNEHNGE..... 368
373 0.000e+00UniRef50_W7NHN0 Uncharacterized protein n=25 Tax=Eukaryota TaxID=2759 RepID=W7NHN0_GIBM7  ali  14  36.FRTIATASARPQEAPREPPSATPEIDLLQSRRRRI---RDSKPFSDFLTDTFHRQHDYLRISVSERCNLRCVYCMPEEGNRELLTTPEIVLLSSVFVSQGVTKIRLTGGEPTVRRDILPLMQQIGELRRH-GLKEICITTNGISLHRKLDSMIESGLTGVNLSLDTLDPWQFQIMTRRKGFEAVQKSIDRILELNRGAGIKLKINCVVMRGVNDREVLPFVGLTEE---KDVEVRFIEYMPF-DGNKWSKNKMFSYQEMLDLIRTKYPTLQK-VQDHKNDTSKTWHIPGFTGGFITSMTHNFCGTCNRLRITGDGNLKVCLFGDAEVSLRDILRK.......... 369
374 0.000e+00UniRef50_A0A0G4GTG7 Uncharacterized protein n=2 Tax=Chromerida TaxID=877183 RepID=A0A0G4GTG7_VITBC  ali  15  79................................................LVDRFGRSHTYLRISLTERCNLRCQYCMPADGNDSILTAHETVRFASMFAQAGVDKIRLTGGEPTVRKDFGDL---AMRLGEIPGLKTFAMTTNGVTLMRHIDTLKKARMNCINISLDTLVPAKFAFMARRNGFEKVWESINSALE---GDFCQLKINCVVMKGFNDDELCDFVRLTEE---WPVHIRFIEYMPF-TKNGWSDKRMVTKESMIKKIRKEFPSLARADDPSPNETAQLYRVAGFRGGFISSMSDMFCGSCNRIRLTADGNLKNCLFGVEEFNIRNVLRSGNSDDEVM.. 371
375 0.000e+00UniRef50_A0A162Z408 4 iron, 4 sulfur cluster binding n=1 Tax=Didymella rabiei TaxID=5454 RepID=A0A162Z408_DIDRA  ali  14  64......................PVQTPSRQSAKARIQAIENVKPFSEFLTDNFQRQHDYLRISITERCNLRCLYCMPEEGIPTMLTTPEIFYLSSLFVSQGVTKIRLTGGEPTVRRDIVPLMQQIGSLRPK-GLRELALTTNGISLHRKLDAMVEAGLTAVNLSLDTLDPFQFQIMTRRKGFDAVMKSIDRILEMNKGANVKLKVNCVVMRGLNEREILPFVDM---GREKDMEVRFIEYMPFG-GNKWSENKMIGFQEMVDMIRTKYPGLARI-PGHKNDTSKTFQVPGFVGGFITSMTNDFCSSCNRLRITSDGHLKVCLHGNDEVSLRDLLRK.......... 379
376 0.000e+00UniRef50_A0A0G2EDW0 Putative molybdenum cofactor biosynthesis protein 1 b n=1 Tax=Diplodia seriata TaxID=420778 RepID=A0A0G2EDW0_9PEZI  ali  15  78......................................IKQAKPFSEFLTDTFNRQHDYLRISITERCNLRCLYCMPEEGPDHLLTSPEIFYISSLFVSQGVNKIRLTGGEPTVRRDIVPLMRSIGSLRSK-GLRELAITTNGISLHRKLDSMVESGLTGINLSLDTLDPFQFTLMTRRKGFDAVMRSVERVLEM-KRLGAPVKINCVVMRGLNDREIVPFVEL---GREKDVEVRFIEYMPF-DGNRWNQKKMMSYQEMLDVIRAKYPGARP-VQGHKNDTSKTWEIPGFVGGFITSMTHNFCGTCNRLRITSDGNLKVCLFGNTEVSLRDIMRK.......... 377
377 0.000e+00UniRef50_A0A1V5MC57 GTP 3`,8-cyclase n=8 Tax=Bacteria TaxID=2 RepID=A0A1V5MC57_9BACT  ali  17  4...............................................PLIDSFGRLHTYLRISVTDRCNLRCRYCMPSEGREELLSFEEIERLAAIFVGMGVTKIRLTGGEPMLRRDFPDLVAKLAGLKATTGLKDLAMTTNATLLAGQASLLKEKGLSHINISLDSFKPERFEQITRLSCFDAVKAGLHEAIAAGFS---KLKLNMVVIAGFNDDEILDFAAFAREHK---INVRFIEFMPFKDND--WQIDKVVTFKEMKASLDKHFKLSPAKQEVGDVARDFDLAGGGSLSFITSMSESFCSSCNRLRLTSDGSMKSCLFYPAEINLRDAMRQNASDEEL... 300
378 0.000e+00UniRef50_F0XBX0 Molybdopterin cofactor biosynthetic protein n=3 Tax=Ascomycota TaxID=4890 RepID=F0XBX0_GROCL  ali  15  82................................KTRQAELKHARPFSDFLTDTFQRQHDYLRISLTERCNLRCLYCMPEEGVENLLTTPEVLLLADVFVGQGVKKIRLTGGEPTVRRDILPLMRQLGDLRRR-GLRELCLTTNGLALHRKLDAMVEAGLTGVNLSLDTLDPFQFRLMTRRDGLVAVRRSMDRILALNAAADVRLKINCVVMRGLNDGEMVDFVGLT---RDHDLEVRFIEYMPF-DGNRWSTGKMVSFNEMLERIRKSYPTLQRTTPDAHHDTSKTYEVPGFAGGFITSMTSNFCGGCNRLRITSDGSLKVCLFGNAEVSLRDIIR........... 391
379 0.000e+00UniRef50_UPI000952CB23 molybdenum cofactor biosynthesis protein 1 isoform X1 n=8 Tax=Bos indicus TaxID=9915 RepID=UPI000952CB23  ali  16  50........................................HAAPFSAFLTDSFGRRHSYLRISLTERCNLRCQYCMPEEGKADLLTTEEILTLARLFVKEGVDKIRLTGGEPLIRPDVVDIVALLAQLRQLEGLRTIGITTNGINLARLLPQLQKAGLSAINXSLDTLVPAKFEFIVRRKGFHKVMEGIHKAIELGYS---PVKVNCVVMRGLNEDELLDFVALTEGL---PLDVRFIEYMPF-DGNKWNFKKMVSYKEMLDTLRQQWPELEKLPEEESS-TAKAFKIPGFRGSFITSMSEHFCGTCNRLRITADGNLK........................... 344
380 0.000e+00UniRef50_A0A2P6MX67 Phospholipase D1 n=1 Tax=Planoprotostelium fungivorum TaxID=1890364 RepID=A0A2P6MX67_9MYCE  ali  15 1698.............................................DEMLIDTFSRKHNYLRISLTERCNLRCQYCMPEEGSENIMTQDEILRIATLFVESGVTKIRLTGGEPLVRKDVVDICE---RLGALPGLKHLGMTTNGLTLPRKIGDLHRVGVNLLNISLDTLKADKFTFITRRLGFERVKESIDLA--LNKYKFNPVKINCVVMKGFNDDEIWDFVEMTKE---QDMEIRFIEYMPFG-GNRWSDKKFISYQEIIDKIKRLHPEFKRIPEEEASETSKLWKVPGYKGGFITSMSQHFCSSCNRLRLTADGNLKVCLFGQEEVNLKDYMRKGATDEELRRW 1997
381 0.000e+00UniRef50_A0A271J4H1 GTP 3`,8-cyclase n=6 Tax=cellular organisms TaxID=131567 RepID=A0A271J4H1_9BACT  ali  17  1.............................................MSPLTDSFGRRHTTLRLGLTERCNLRCVYCMPAEGVPQMLSTDEIERLARVLAEVGVDKIRLTGGEPLVRKDAVEVAERLGRL----GLRSLALTTNGLLLEDRLPDLRAAGLTDLTLSLDTLRADRFEAVTRRPGLDRVLSALDAALRLGYRIDGPLKVNVVALRGVNEDEAVDFADWAARE---PIEVRFIEVMPF-DGNGWDRSELVPYAETRARIEDVHGPLDAL-DDGPHSTARTFSRPGWRGGFVASMTVPFCAGCNRLRVTADGALKVCLFGAREVSLRDAMRGGATDADLLE. 300
382 0.000e+00UniRef50_Q20624 Molybdenum cofactor biosynthesis protein 1 n=11 Tax=Caenorhabditis TaxID=6237 RepID=MOCS1_CAEEL  ali  17  17......SSTEEIVKQLTVPLREHAEPILTLTPEQKKIQEIEHTKGQPPFFDMFMREHTYLRISLTEKCNFRCLYCMPAEGKDKMLSNSEVLRLVKLFAAHGVDKVRLTGGEPTIRKDIVHIVEGISS---TPGIKEVGITTNGLVLQRFLPQLRDAGLTKINISIDSLDREKFAKMTRRDGFDKVW----KAIELARGYYPKVKLNVVVLKHQNENEVVDFVNLTKDRN---LDVRFIEFMPFG-GNEFKNDNFIGYREMLNLIVDKYGDGVIRLSDSPNDTTKAYKIDGFQGGFITSMSDHFCNTCNRLRITADGNLKVCLHGNSEVSLRDRIR-CGDSDEQLS. 356
383 0.000e+00UniRef50_A0A2A2K3Q1 Uncharacterized protein n=2 Tax=Diploscapter pachys TaxID=2018661 RepID=A0A2A2K3Q1_9BILA  ali  17  79.........................LITSARRNESLDEVKKRLLPENAFRDTFGRVHTYLRISLTERCNLRCLYCMPEEGKGNLLTTEEVIRLTRLFASHGVNKVRLTGGEPTLRKDLVDIV---HQISNIDGIEDIGLTTNGLMLSKHVMALREAGLTKVNVSLDTLRQDRYIEMCRRNGLGKVLESIKATESLY----PYVKINVVVMRGKNDDEIMDFVRMTQARR---IDVRFIEFMPFG-GNHFNQGHFVSYGEVMQRIKDEFGENVCKLTELPNDTAKSYKIRGFTGGFISSMSDHFCFTCNRLRITADGNLKVCLHGNAEVNLRDLMRLDESDEKLSE. 395
384 0.000e+00UniRef50_A0A292YTY0 GTP 3`,8-cyclase n=2 Tax=Effusibacillus lacus TaxID=1348429 RepID=A0A292YTY0_9BACL  ali  14  5................................................LTDKFGRVHDYLRISLTDRCNLRCVYCMPEEGNDKHLTFDEIEAVVRMAAKLGVRRLRLTGGEPLVRPNVEKLV---SRLSAIPGIEDIALTTNGIFLAQKAEKLRKAGVTRVNISLDSMKQERFAKITRGGDVSKVLAGLEASFRVGFN---PIKLNVVLMNRFNDDEVDDFLRMTLEREVH---VRFIEYMPIGHDDNGWRDLYLPLEYVKERCEAMGMTPEPTQSVFGNGPAEYFRLPGAKGSFIHPVSDHFCESCNRLRLTADGNIKPCLFWQDEFNVRKYIGDEQALEDL... 297
385 0.000e+00UniRef50_A0A1E4RUJ1 Molybdenum cofactor biosynthesis prote n=1 Tax=Cyberlindnera jadinii NRRL Y-1542 TaxID=983966 RepID=A0A1E4RUJ1_CYBJA  ali  16  20....................................SAIHNALPLSHFLTDNYGRKHNYLRISITERCNLRCLYCMPEEGDSHILSRDEIKQLASIFVSQGVDKIRLTGGEPTVRRDIVEIVQDLKSL----GVKELGITSNGIALHRKLPLLVESGITALNLSLDTLQDGKFMTITRRNGLNQVLKSLERALEL----GIKVKLNCVVIRGVNEDEILAFVKLAQ---WWPIEVRFIEYMPF-DGNKWELNKVISYKEMKELILQKHP-LMVHRDHKSGETAKVFKSPDWVGGFITSMTDDFCSDCNRLRLTSDGNLKVCLFGNEEVSLRDMIRSNVPKDEILE. 322
386 0.000e+00UniRef50_A0A1L7NVA6 MOCS1AB n=6 Tax=Obtectomera TaxID=104431 RepID=A0A1L7NVA6_BOMMO  ali  17  6...NNFSSLYRIFECDLRTIKSCFRAITVPDRLYSDDSRVEAA---ASLSDLHGRRHNYLRISLTERCNLRCKYCMPAEGVPLSSRSEELRVIVGALAAAGVDKLRLTGGEPTLRSDLADIIQ---SLKAIDGIRSVSMTTNGLVLARRLASLQRAGLDAVNVSLDTLRPDRYEDMARRRGLARVLAGLDLALQLGYS---PVKINTVLMRGFNDDEIGDFIEMT---RERDLEVRFIEFMPF-AGNEWKSGRLVPHREVLRAARAAHPG-LRPLPPRPNDTATLWKVGGYAGGFISSMTQHFCATCNRLRLTADGNLKVCLFGAAEVSLRDAVR........... 330
387 0.000e+00UniRef50_A0A1V8U8X6 Uncharacterized protein n=3 Tax=Rachicladosporium TaxID=470018 RepID=A0A1V8U8X6_9PEZI  ali  15  261...............................RSSRAAAIREAKPFSDFLTDTHARQHDYLRISLTERCNLRCLYCMPEEGNRDLLTTAEIVYLSALFVNQGVTKIRLTGGEPTVRKDIVPLMHQIGALR-KDGLKELALTTNGISLHRKLDEMLKAGLTGVNISLDTLDPFQFQLLTRRQGFAAVMKSIDRVKEMNKGAGIKLKINCVVMRGLTDHQILPFVEMTENEEV---EVRFIEYMPFG-GNKWSQNKMVSYADMLDVIRAKYPEFGRL-KDRKSDTSKTWQVPGFVGGFITSMTQDFCGSCNRLRITSDGNLKVCLHGEAEVSLRDVLRN.......... 567
388 0.000e+00UniRef50_Q20624-2 Isoform mocs1a of Molybdenum cofactor biosynthesis protein 1 n=6 Tax=Rhabditida TaxID=6236 RepID=Q20624-2  ali  17  17......SSTEEIVKQLTVPLREHAEPILTLTPEQKKIQEIEHTKGQPPFFDMFMREHTYLRISLTEKCNFRCLYCMPAEGKDKMLSNSEVLRLVKLFAAHGVDKVRLTGGEPTIRKDIVHIVEGISS---TPGIKEVGITTNGLVLQRFLPQLRDAGLTKINISIDSLDREKFAKMTRRDGFDKVW----KAIELARGYYPKVKLNVVVLKHQNENEVVDFVNLTKDRN---LDVRFIEFMPFG-GNEFKNDNFIGYREMLNLIVDKYGDGVIRLSDSPNDTTKAYKIDGFQGGFITSMSDHFCNTCNRLRITADGNLKVCLHGNSEVSLRDRIR-CGDSDEQLS. 356
389 0.000e+00UniRef50_A0A0U1M3D2 Molybdenum cofactor biosynthesis protein 1 n=1 Tax=Talaromyces islandicus TaxID=28573 RepID=A0A0U1M3D2_TALIS  ali  14  871.......................................KSAKPFSEFLTDTFARQHDYLRISITEKCNLRCLYCMPEEGIPHMLTTPEIVYLASLFVSQGVTKIRLTGGEPTIRKDIIPMMQAIGNTR-RDGLRELCLTTNGISLHRKLDAMAEAGLTGVNLSLDTLDPFQFQIMTRRKGFDAVMKSIARIEEMNKHAGIKLKINCVVMRGLNDREIIPFVEM---GRDKAIEVRFIEYMPF-DGNKWSEGKMVPYQEMLATIREKYPALEKVM-DHKNDTSKTYRVPGFEGGFITSMTHNFCGTCNRLRITSDGNLKVCLHGNAEVSLRDLIRKENN....... 1172
390 0.000e+00UniRef50_A0A024TII9 Molybdenum cofactor biosynthesis protein A n=7 Tax=Eukaryota TaxID=2759 RepID=A0A024TII9_9STRA  ali  16  70...........................................EREDHLVDTYGRVHNYLRISLTERCNLRCQYCMPEDGTSDLLSTPEILHLTNLFAQSGVSKLRLTGGEPLVRPD---IVSLATSLHAIPGIESLGITTNGLSLSKHLAAL-CAVPARLNISLDTLNEAKFAKITRRKGFQRVW---AAIEAAVAASPVQVKLNCVVMRDFNLDEIVDFVRLTTTLNV---DVRFIEWMPF-DQNRWNDQTFVPFAEMLSQLHAEFPVIEPLEN-HLNDTSKSFRLPDSPGSFITSMSEHFCGGCNRLRITADGNLKVCLFGNAEVSLRDAMRHGYSDDDLL.. 365
391 0.000e+00UniRef50_UPI000D781026 molybdenum cofactor biosynthesis prote n=1 Tax=Jaminaea rosea TaxID=1569628 RepID=UPI000D781026  ali  16  78...............................................SLVDSHSRHHSYLRISLTERCSFRCTYCMPAEGDDRLLSTEEVKRIARVFVQMGVKKIRLTGGEPTLRKDLVDIVRYLDSLR-GEGLESIGITTNGLVLARSLPELVAAGLTHVNISIDSLLPDRFASISRQKTLARVLATIDDSLRYA--PQLKVKLNVVVIKGMNDDEVASFVEMT---RHRNLDVRFIEYMPFN-SNAWSTQALIPAAELLQRVQAAHPPGVQRHVDEANDTTRHYAIRGYKGGFISSMTDHFCSTCNRVRVLADGNLKVCLFGNKEVSLRDAMRSDQVDDEGL.. 377
392 0.000e+00UniRef50_A0A2H3IZG2 Elongator protein 3/MiaB/NifB n=3 Tax=leotiomyceta TaxID=716546 RepID=A0A2H3IZG2_9EURO  ali  17  7.........................VESPVNSQNVSALRLPKKPISENLVDGFRRQHDYLRISVTERCNLRCMYCMPEEGPSHLLTTAEIVYLSSLFVSEGVTKIRLTGGEPTVRKDIVPLVQAIGKLRQN-GLRELCLTTNGISLLRKLDPMVEAGLTGINLSLDTLDPFQFQIMTRKQGLEAVRKSIDRILEMNRGAGVKLKINCVVMRGLNEREILPFVEM---GRENPIEVRFIEYMPF-DGNKWRQNRMVSYQEMLTMIRTKYPEISKTTGLK-NDTSKNYQIPGFAGGFITSMTHNFCGSCNRLRITADGNLKVCLFGSAEVSLRDLLR........... 320
393 0.000e+00UniRef50_I1RRZ6 Uncharacterized protein n=10 Tax=Hypocreales TaxID=5125 RepID=I1RRZ6_GIBZE  ali  13  66......................................IKDPKPFSDFLTDNFNRQHDYLRISVAERCNLRCVYCMPEEGVPELLTTPEIVLLSSVFVSQGVSKIRLTGGEPTVRRDILPLMRQIGELRQH-GLKELCITTNGISLHRKLGSMVESGLTGVNLSLDTLDPWQFQIMTRRKGYDAVQKSIDRILEMNRGAGIKLKINCVVMRGVNDREVLPFVDMTQE---KDIEVRFIEYMPF-DGNKWSKNKMFSYQEMLDLIRTKYPTLQK-VQDHKNDTSKTWHVPGFAGGFITSMTHNFCGSCNRLRITGDGNLKVCLFGNAEVSLRDILRK.......... 365
394 0.000e+00UniRef50_A0A0D2AEF7 Molybdenum cofactor biosynthesis protein A n=1 Tax=Verruconis gallopava TaxID=253628 RepID=A0A0D2AEF7_9PEZI  ali  14  78........................................NAKPFSDFLTDNFNRQHDYLRISITERCNLRCLYCMPEEGPEHLLTTPEIFYLSSLFVSQGVTKIRLTGGEPTVRPDVVQLMQQIGSLRSK-GLKELALTTNGISLHRKLDAMVEAGLTGINLSLDTLDPFQFQIMTRRKGFEAVMRSIDRVLEMKKGANLKLKVNCVVMRGMNDREIVPFVEL---GREKDIEVRFIEYMPFG-GNKWSKGKMLSYQEMLDIIRTKHPGIHRVQGHR-NDTSKTYQIPGFVGGFITSMTDDFCGTCNRLRVTSDGNLKVCLHGNTEVSLRDILREGN........ 377
395 0.000e+00UniRef50_A0A2C5XGD8 Molybdenum cofactor biosynthesis protein 1 n=2 Tax=Hypocreomycetidae TaxID=222543 RepID=A0A2C5XGD8_9PEZI  ali  14  109......................................IKEAKPFSDFLTDTFNRQHDYLRISVTERCNLRCLYCMPEAGVPNILTTPEIVLLSSLFVSQGVTKIRLTGGEPTVRSDIVPLMQQIGALRSR-GLRELCITTNGISLHRKLDAMVDAGLTGINLSLDTLDPLQFQIMTRRKGFEAVQRSIDRVLAINHAPKLKLKINCVVIRGVNDREILPFVELT---RSHNLEVRFIEYMPF-DGNRWNKAKMLSYADMLDIIRRVHPDVH-AVRGHANDTSKTWQVPGHVGGFITSMTHNFCGSCNRLRITSDGNLKVCLFGNAEVSLRDVLR........... 413
396 0.000e+00UniRef50_A0A2U3EJ76 Molybdenum cofactor biosynthesis protein 1 B n=1 Tax=Purpureocillium lilacinum TaxID=33203 RepID=A0A2U3EJ76_9HYPO  ali  13  46.....................SEVATPTAPTASSRRERIRSAKPFSEFLTDTFHRQHDYLRISVTERCNLRCVYCMPEEGNRELLTTPEIVMLSSLFVGQGVSKIRLTGGEPTVRRDILPLMHQIGALRP-QGLRELCITTNGISLHRKLDSMVEAGLTGVNLSLDTLDPWQFQIMTRRKGFDAVQKSIERILELNKHAGIKLKINCVVMRGVNDREVIPFVEMT---REKDIEIRFIEYMPF-DGNKWSQGKMFSYTEMLDLIRAEYPGLEK-VQDHKNDTSKTWHIPGFTGGFITSMTHNFCGTCNRLRITGDGNLKVCLFGNAEVSLRDLLRK.......... 362
397 0.000e+00UniRef50_F8A8W9 GTP 3`,8-cyclase n=3 Tax=root TaxID=1 RepID=F8A8W9_THEID  ali  16  1...............................................MLIDSYGRKITYLRVSVTDRCNLRCFYCFAKLPPEKILSYEELYQIIKVAVSLGVKRVRLTGGEPLVRKDLVSFVAALAQ---IPGLEDLALTTNGILFASMALDLKKAGLKRVNISLDAITPQKYKEICGIDALNQVLAGIEKALEVGFS---PVKINMVVMRGLNDDEAIEMARLTLKE---PLEVRFIEFMPIGSGAPWEEDLFMPVSEIEKRLKEVFGELHPASKI-GAGPAKVFTLPGAKGGFISAISNHFCHKCNRLRLTPEGRLRLCLFSDEEIDLR............... 281
398 0.000e+00UniRef50_A0A1Y2LXC1 Uncharacterized protein n=1 Tax=Epicoccum nigrum TaxID=105696 RepID=A0A1Y2LXC1_EPING  ali  13  60......................PVQTPSRQAARERIQAIEKAKPFSEFLTDKFQRQHDYLRISITERCNLRCLYCMPEEGIPTMLTTPEIFYLSSLFVSQGVTKIRLTGGEPTVRRDIIPLMQQIGSLRPK-GLRELALTTNGISLHRKLDAMVEAGLTGVNLSLDTLDPFQFQIMTRRKGFDAVMKSIDRVLEMNKGANIKLKVNCVVMRGLNEREIIPFVEM---GREKDIEVRFIEYMPFG-GNKWSENKMISFQEMVDTIRTKYPGLERI-PGHKNDTSKTFQVPGFVGGFITSMTNDFCSTCNRLRITSDGNLKVCLHGNDEVSLRDLLR........... 374
399 0.000e+00UniRef50_A0A2S7R008 Molybdenum cofactor biosynthesis 1 B protein n=2 Tax=Rutstroemia TaxID=38452 RepID=A0A2S7R008_9HELO  ali  15  73.......................................KKAKPFSSFLTDTFQRQHDYLRISITEKCNLRCLYCMPEEGVPNLLTTPEIVLLSSIFVSQGVSKIRLTGGEPTVRRDILPLMQQIGALRSD-GLRELCLTTNGLNLARKLDGMVAAGLTGVNLSLDTLDPWQFQIMTRRKGFEAVMKSIERILELNRGANIKLKINCVVMRGINEQEIVPFVEL---GREKDIEVRFIEYMPF-DGNKWSKGKMLGYQEMLGIIRQKYPTLRK-VADHKNDTSKTYEIPGFVGGFITSMTHNFCGTCNRLRITSDGNLKVCLFGNAEVSLRDILRK-SNDNQPID. 379
400 0.000e+00UniRef50_A0A0F8B348 Cyclic pyranopterin monophosphate synthase accessory protein n=40 Tax=saccharomyceta TaxID=716545 RepID=A0A0F8B348_CERFI  ali  14  109......................................IKEAKPFSDFLTDTFNRQHDYLRISVTERCNLRCLYCMPEAGVPNILTTPEIVLLSSLFVSQGVTKIRLTGGEPTVRSDIVPLMQQIGALRSR-GLRELCITTNGISLHRKLDAMVDAGLTGINLSLDTLDPLQFQIMTRRKGFDAVQRSIDRVLAINHAPKLKLKINCVVIRGVNDREILPFVELT---RSHNLEVRFIEYMPF-DGNRWNKAKMLSYADMLDIIRRVHPDVH-AVRGHANDTSKTWQVPGHVGGFITSMTHNFCGSCNRLRITSDGNLKVCLFGNAEVSLRDVLR........... 413
401 0.000e+00UniRef50_A0A1J9RRJ6 Molybdopterin cofactor biosynthetic protein n=1 Tax=Diplodia corticola TaxID=236234 RepID=A0A1J9RRJ6_9PEZI  ali  14  63.....................QVEFPPPQPSQQARRDAIKQAKPFSEFLTDTFNRQHDYLRISVTERCNLRCLYCMPEEGPDHLLTSPEIFYISSLFVSQGVNKIRLTGGEPTVRRDIVPLMRSIGSLRAK-GLRELCITTNGISLHRKLDSMVESGLTGINLSLDTLDPFQFQLMTRRKGFDAVMKSVDRVLEMKRAAPVKLKINCVVMRGLNDREIVPFVEL---GREKDVEVRFIEYMPF-DGNRWNQKKMMSYQEMLDVIRAEYPGLRPVQGHR-NDTSKTWEIPGFVGGFITSMTHNFCGTCNRLRITSDGNLKVCLFGNTEVSLRDIMRK.......... 379
402 0.000e+00UniRef50_A0A1F2WJE0 GTP 3`,8-cyclase n=4 Tax=Bacteria TaxID=2 RepID=A0A1F2WJE0_9ACTN  ali  20  1................................................MIDPYSRTIDYLRLAVTDRCNLRCLYCMPEEGHEDILSYEEILRLLKICIQAGISKVRLTGGEPLVRKDLDYLISQISKLQPSL---DISLTTNGLLLSKQAESLAAAGLKRVNISIDSLDPDTYRRITRTGNLSQVLSGLEAAIAAGLE---PVKINVVVLKHVN-EELEAFVELA---RRLPVHVRFIEYMPCG----IFDESFYVSAEEIKQGLAEFGRLEVAEPPLGAGPARYFKLAGAKGGFISPISSHFCPNCNRLRLTADGKMKTCLFSPDEDDIREILRSGSEDGYVLE. 291
403 0.000e+00UniRef50_A0A1Z5T6R2 Uncharacterized protein n=1 Tax=Hortaea werneckii EXF-2000 TaxID=1157616 RepID=A0A1Z5T6R2_HORWE  ali  16  64.........................................AKPFSDFLTDSFSRQHDYLRISVTERCNLRCLYCMPEAGPKTQLTSPEIFYLSQLFVNQGVNKIRLTGGEPTVRKDIVPLMQQIGSLRSN-GLRELALTTNGISLHRKLDAMVEAGLTGVNISLDTLDPFQFQLLTRRQGFDAVMKSISRVQDMNRGAGVKLKVNCVVMRGLNDHQIMPFVDMT---RDQDLEVRFIEYMPFG-GNKWEEQKMMPYAEMLDVIREKYPTLTRMQ-DAKNDTSKSWHIPGFAGGFITSMTHNFCGTCNRLRITSDGNLKVCLHGETEVSLRDLLRTERNGE..... 365
404 0.000e+00UniRef50_E4ZRZ1 Uncharacterized protein n=1 Tax=Leptosphaeria maculans (strain JN3 / isolate v23.1.3 / race Av1-4-5-6-7-8) TaxID=985895 RepID=E4ZRZ1_  ali  14  134.............HESRPTTDSPQEILPPTKPVDRKQAIQNAKPFSDFLTDTFNRQHDYLRISVTERCNLRCLYCMPEEGVPNMLTTPEIFYLSSLFVSQGVTKIRLTGGEPTVRRDIVPLMHQIGSLRSK-GLRELALTTNGISLHRKLDAMVEAGLTGINLSLDTLDPFQFQIMTRRKGLDAVMKSIDRILEMNKGAGVKLKVNCVVMRGLNEREIIPFVEL---GREKDIEVRFIEYMPFG-GNKWSEGKMISFQEMLDIIRVKYPGLA-AVPGHKNDTSKTFQIPGFVGGFITSMTNDFCSSCNRLRITSDGNLKVCLHGMAEVSLRDLLRQGNN....... 461
405 0.000e+00UniRef50_A0A2S7QHW0 Molybdenum cofactor biosynthesis 1 B protein n=1 Tax=Rutstroemia sp. NJR-2017a BBW TaxID=2070414 RepID=A0A2S7QHW0_9HELO  ali  15  50.......................................KKAKPFSSFLTDTFQRQHDYLRISITEKCNLRCLYCMPEEGVPNLLTTPEIVLLSSVFVSQGVSKIRLTGGEPTVRRDILPLMQQIGALRSD-GLRELCLTTNGLNLTRKLDGMVAAGLTGVNLSLDTLDPWQFQIMTRRKGFEAVMKSIERILELNRGANIKLKINCVVMRGINEREIVPFVEL---GREKDIEVRFIEYMPF-DGNKWSKGKMLGYQEMLGIIRQKYPTLRK-VADHKNDTSKTYEIPGFVGGFITSMTHNFCGTCNRLRITSDGNLKVCLFGNAEVSLRDILRK-SNDNQPID. 356
406 0.000e+00UniRef50_A0A225B8R4 Uncharacterized protein n=1 Tax=Talaromyces atroroseus TaxID=1441469 RepID=A0A225B8R4_9EURO  ali  14  803.................................RRAAAIRSAKPFSDFLTDTFHRQHDYLRISVTEKCNLRCLYCMPEEGVPHLLTTPEIVYLSSLFVSQGVTKIRLTGGEPTVRKDIVPLMQAIGDLRLD-GLRELCLTTNGISLHRKLDAMAEAGLTGVNLSLDTLDPFQYQIMTRRKGFDAVMKSINRIQEMNDKAGIKLKINCVVMRGLNEREIVPFVEL---GRDKAIEVRFIEYMPF-DGNKWSEQKMVPYQEMLATIRTKYPNLEK-VADHKNDTSKTYRVPGFAGGFITSMTHNFCNTCNRLRITSDGNLKVCLHGNAEVSLRDLIREENN....... 1111
407 0.000e+00UniRef50_A0A177TMM2 Uncharacterized protein n=1 Tax=Tilletia indica TaxID=43049 RepID=A0A177TMM2_9BASI  ali  16  136................................................LRDTHGRQHSYLRISLTERCNLRCLYCMPEEGSDKLLSQAEIARLAGLFVREGVSKVRLTGGEPTLRSDLGEIVESLNELRP-LGLRQIGMTSNGISLHRKLPSLVSSGLTHLNLSLDTLDPFKFEFMTRRRGFEAVIRSLDKALELGMES---VKLNVVVLKGVNDQDVLDFVQFT---RDKPVTVRFIEYMPF-DGNKWQMGKLVSYRDLLDRIQHKFGPLERLRDDD-NDTSKGWRVPGFAGGFITSMTEHFCGTCNRLRITADGNLKVCLFGNAEISLRDAMR........... 421
408 0.000e+00UniRef50_W9CNK6 Molybdenum cofactor biosynthesis protein 1 B n=1 Tax=Sclerotinia borealis F-4128 TaxID=1432307 RepID=W9CNK6_9HELO  ali  14  45..................PLAEDAESPTSGRALNRRAELKDSKPFSSFLTDNFQRQHDYLRISITEKCNLRCVYCMPEEGVPDLLTTPEIVLLSSLFVSQGVSKIRLTGGEPTVRRDILPLMQQIGALRSR-GLRELCLTTNGLNLSRKLDGMVEAGLTGVNLSLDTLDPWQFQIMTRRKGFEAVMRSMDRILHMNLGAGIKLKINCVVMRGVNEREIIPFVEL---GRDKNVEVRFIEYMPF-DGNKWSQGKMLSYKEMLDIIRQKYPTVQK-VTDHKNDTSKTYEIPGFVGGFITSMTHNFCGTCNRLRITSDGNLKVCLFGNAEVSLRDILRK.......... 364
409 0.000e+00UniRef50_A0A151I1C7 Molybdenum cofactor biosynthesis protein 1 n=1 Tax=Atta colombica TaxID=520822 RepID=A0A151I1C7_9HYME  ali  17  29...............................SRLQQLRAKLREDEHEILTDTFGRKHTYLRISLTERCNLRCTYCMPAEGKEGILKTDEIIQIADLFVKEGVRKIRLTGGEPTIRKDIIDIIGQLKQLR---DLDQVAITTNGLTLTRQLPALQKAGLDALNISLDTLKEERFELFTRRRGWAKVMASIDLAVQLGYK---PVKINCVMMRGRNDDEIIDFIDFT---RDRPVDVRFIEYMPF-QGNQWKENKMISFNEMKAIIREKYSDFQALPNQPNN-TSKAYHVPGFIGGFITSMSQHFCDSCNRIRITADGNLKVCLFGKGEVSLRDALRSGISEN..... 335
410 0.000e+00UniRef50_A0A093UUT1 Molybdenum cofactor biosynthesis protein 1 (Fragment) n=3 Tax=Talaromyces marneffei PM1 TaxID=1077442 RepID=A0A093UUT1_TALMA  ali  13  829...........................SIPKASRRFEAIKSAKPFSDFLTDTFHRQHDYLRISITEKCNLRCLYCMPEEGVPHLLTTPEIVYLSSLFVSQGVTKIRLTGGEPTVRKDLVPMMQAIGDLR-KDGLKELCLTTNGISLHRKLDAMAEAGLTGVNLSLDTLDPFKYTIMTRRNGFEAVMKSINRIEEMNHKAGIKLKINCVVMRGLNEHEIVPFVEM---GREKDIEVRFIEYMPF-DGNKWSEQKMVPYQEMLDIIRKSYPELEKA-ADHKNDTSKTYRVPGFQGGFITSMTHNFCGTCNRLRITSDGNLKVCLHGNAEVSLRDLIREENN....... 1143
411 0.000e+00UniRef50_T2M4C2 Molybdenum cofactor biosynthesis protein 1 (Fragment) n=1 Tax=Hydra vulgaris TaxID=6087 RepID=T2M4C2_HYDVU  ali  17  85...................................SKVPHDKKTFSSFLTDSFGRKHNYLRISLTERCNLRCGYCMPEEGKDDLLTNEEMIRLARLFVFEGVNKIRLTGGEPLVRKDIVQICDQLSSLK---GLKTLAITTNGLVAEQKLLYLKQAGLTNVNISLDTMIEKKFEFISRRKGLTKVFNAIEKAIELKFNS---VKINCVVMKGLNDDELIEFVNFTQN---KPVDVRFIEYMPF-DGNKWAPVKFVPYGEMLKLIFQKFPDIVK-VEDDPNDTAKTYKVPDFKGGFITSMSEHFCGTCNRLRLTADGNLKVCLFGPNEVSLRDLIRSGASDTDLLN. 390
412 0.000e+00UniRef50_A0A2H3ILQ3 Elongator protein 3/MiaB/NifB n=1 Tax=Penicillium occitanis TaxID=290292 RepID=A0A2H3ILQ3_9EURO  ali  13  768...............IEENTSVPPSYTPTPSRRFEAI--KSAKLFSDFLTDTFHRQHDYLRISITEKCNLRCLYCMPEEGVPHLLTTPEIVYLSSLFVSQGVTKIRLTGGEPTVRKDLVPMMQAIGDLR-KDGLKELCLTTNGISLHRKLDAMAEAGLTGVNLSLDTLDPFKYTIMTRRNGFEAVMKSINRIEEMNRNAGIKLKINCVVMRGLNEHEIVPFVEMGKE---KDIEVRFIEYMPF-DGNKWSEQKMVPYQEMLDIIRKTYPQLEK-VADHKNDTSKTYRVPGFQGGFITSMTHNFCGTCNRLRITSDGNLKVCLHGNAEVSLRDLIREENN....... 1092
413 0.000e+00UniRef50_A0A2T3AMU4 Uncharacterized protein n=2 Tax=leotiomyceta TaxID=716546 RepID=A0A2T3AMU4_9PEZI  ali  15  131..........................................KPFSDFLTDSFHRQHSYLRISLTEKCNLRCVYCMPEEGVPSLLTTPEILLLASTFVSQGVSKIRLTGGEPTVRPDILPLMQQLGDLRPH-GLRELCITTNGIALHRKLEKMVEAGLTGVNLSLDTLDPWQFQIMTRRRGFEAVQKSIARIHELNRAAGIKFKINCVVMRHVNDRELLDFVDMT---RDKDVEVRFIEYMPF-DGNKWSKGKMYSYTEMLDTIRARYPSVAK-VQDHQNDTSKTWHIPGFAGGFVTSMTHNFCGSCNRLRITSDGSLKVCLFGDAEVSLRDILRE.......... 426
414 0.000e+00UniRef50_Q721B9 GTP 3`,8-cyclase n=257 Tax=Firmicutes TaxID=1239 RepID=MOAA_LISMF  ali  17  1.............................................MQLLKDKFGRVHDYIRISVTDRCNLRCVYCMPEEGHEKVLSKDEIVSFMELMVKFGIKKVRITGGEPLLRTDIVEIV---RGLGAIPEIEDISITTNAMYLAKKAEALKDAGLTRVNISLDSLHEDRFKAITRGGRLQKVLDGIQKAEEVGL---FPIKLNVVLIKGQNDDEITDFLRFTKD---KDINIRFIEYMPIGHAGTSWKEKYLPLDTIFEACNEAGYEYEPVDSIRGNGPSENFRIKGAKGGVIHPVSAHFCDSCNRLRLTADGYIKACLYWDEEMNIR............... 284
415 0.000e+00UniRef50_UPI000CF7E458 molybdenum cofactor biosynthesis protein 1 isoform X2 n=1 Tax=Oryzias melastigma TaxID=30732 RepID=UPI000CF7E458  ali  17  82..................................DSLRNEDIQPFSTVLTDSFGRHHNYLRISLTEKCNLRCQYCMPEKGRSQLLSTSEVLTIARLFVQEGVDKIRLTGGEPLIRPDLLDIIIELRKLN---GLKTIAVTTNGIHLAKPLSRLKEAGLDLINISLDSLVPAKFEFIVRRRGFHKVMEGIDKAIELG---FTPVKINCVVMRGLNEDELLDFVRLTEK---KPLEVRFIEYMPF-DGNKWNFKKMM------------------------------FKVPGFEGGFITSMSEHFCGSCNRLRITADGNLKVCLFGNSEFSLRDALRSGASDEELL.. 358
416 0.000e+00UniRef50_A4J6S5 GTP 3`,8-cyclase n=59 Tax=root TaxID=1 RepID=MOAA_DESRM  ali  16  1................................................MIDNYNRNINYLRISVTDRCNLRCVYCMPPEGHSEILSLEEFARVVDAASDIGIRKIRITGGEPLVRKNIVNLFE---KISTNSAIDDISLTTNGVLFAEMASDLKKAGLNRVNFSLDSLNPDTFRDITRMGKFNDVWRSIQKALELELH---PVKLNVVAVRGINDHEFADFARLTKEI---PIHVRFIELMPIGECNPWAVGNFIAAEEILHGLQQKFGLLDTQVKVTGSGPAKYYCLPNSKGGFITAISEHFCAGCNRLRLTANGQLRPCLYGKQEFDLKTPLREGAS....... 289
417 0.000e+00UniRef50_B0TI16 GTP 3`,8-cyclase n=31 Tax=root TaxID=1 RepID=MOAA_HELMI  ali  15  1................................................MIDAFARDIHYLRVSVTDRCNLRCIYCMPEAGHREVLRFEEFERLIAIAASQGIRRVRITGGEPLVRKGIVPFVARV---KTMTGIEDVALTTNGLLLPRFASELKAAGLDRVNISLDTLRPERFRAVTRVGRIDDVWTGIEAALAADLH---PVKLNVVVMGGVNDDEVADFARLTLQ---WPIHVRFIELMPIGEGDSRFRGQYVTIEQMKAKMAEQGLRLGDHPGIRGGGPARYHTLAGALGGFISAISKHFCGTCNRLRLTAEGKLRPCLHSRQEIDLRTPLRRGASDNLL... 293
418 0.000e+00UniRef50_A0A2I0RZY9 Molybdenum cofactor biosynthesis protein 1 n=2 Tax=Cercospora TaxID=29002 RepID=A0A2I0RZY9_9PEZI  ali  14  38...........SVEPRLPPLAPALPSRPERREKLRD-----AKPFSDFLTDTFDRQHDYLRISLTERCNLRCTYCMPAEGDREILTTPEIYYLSALFVNQGVNKIRLTGGEPTVRKDIVPLMQQIGSLRRN-GLKELALTTNGISLHRKLDDMVEAGLTGVNISLDTLDPLQFPLLTRRNGFNAVMKSIDRVQEMNRGAGIKLKVNCVAMRGVNDDQIPKFVEMT---REQDLEVRFIEYMPFG-GNRWAQKKMLPYAEMVDLIKMQYPTLARLQ-DAKNDTSKTWQVPGFRGGFITSMTHNFCGTCNRLRITSDGNLKVCLHGNAEVSLRDLLR........... 358
419 0.000e+00UniRef50_A0A139IRP7 Uncharacterized protein n=1 Tax=Pseudocercospora musae TaxID=113226 RepID=A0A139IRP7_9PEZI  ali  14  72........................................NAKPFSDFLTDTYDRQHEYLRISLTERCNLRCTYCMPEEGNREILTTPEIYYLSALFVNQGVNKIRLTGGEPTVRKDIVPLMQKIGSLRRN-GLKELALTTNGISLHRKLDAMIEAGLTGVNISLDTLDPLQFPILTRRQGFSAVMKSINRVQEMNKGAGIKLKINCVAMRGVNDDQIIPFVEMT---RDEDIEVRFIEYMPFG-GNKWSQRKMLPYAELVELISTRYPTLGRL-KDATNDTSKTWQVPGFKGGFITSMTHNFCGTCNRLRITSDGNLKVCLHGNTEVNLRDVIR........... 368
420 0.000e+00UniRef50_A0A2G5I4M6 Molybdenum cofactor biosynthesis protein 1 n=1 Tax=Cercospora beticola TaxID=122368 RepID=A0A2G5I4M6_CERBT  ali  14  32.....VSRELPTVDQRIPPLAPSLPSQPARKEKLRD-----AKPFSEFLTDNFDRQHDYLRISLTERCNLRCTYCMPSEGDREILTTPEIYYLSALFVNQGVNKIRLTGGEPTVRKDIVPLMQQIGSLRRN-GLKELALTTNGISLHRKLDDMVEAGLTGVNISLDTLDPLQFPLLTRRNGFNAVMKSIDRVQEMNKGAGIKLKINCVAMRGINDDQILKFVEMT---REQDLEVRFIEYMPFG-GNRWAQKKMLPYAEMVDLIKVQYPTLSRLQ-DAKNDTSKTWQVPGFKGGFITSMTHNFCGTCNRLRITSDGNLKVCLHGNAEVSLRDLLR........... 358
421 0.000e+00UniRef50_A0A0L1HDP8 Molybdenum cofactor biosynthesis protein n=1 Tax=Stemphylium lycopersici TaxID=183478 RepID=A0A0L1HDP8_9PLEO  ali  13  51......................PVSIPQRSSAEERRAAIKKAKPFSDFLTDTFNRQHDYLRISITERCNLRCLYCMPEEGVPNMLTTPEIFYLSSLFVSQGVTKIRLTGGEPTVRRDIVPLMQQIGSLRPK-GLRELALTTNGISLHRKLDAMVEAGLTGVNLSLDTLDPFQFQIMTRRKGFDAVMKSIDRILEINKGANVKLKVNCVVMRGLNEREILPFVEM---GREKDIEVRFIEYMPFG-GNKWSENKMISFQEMLDNIKTKYPGLRP-VAGHKNDTSKTYEVPGFVGGFITSMTNDFCGSCNRLRITSDGNLKVCLHGNAEVSLRDVLRQGNNGE..... 371
422 0.000e+00UniRef50_A0A2A9NVD2 Uncharacterized protein n=1 Tax=Amanita thiersii Skay4041 TaxID=703135 RepID=A0A2A9NVD2_9AGAR  ali  18  21.............................................SPMLVDTFQRKHNYLRISLTERCNLRCFYCMPSEGVEKLLTNEEVLRLATLFVKSGVTKIRLTGGEPTVRKGLDDIISALNALRP-LGLQAIAMTSNGLALYRRLPELVEKGLSHLNLSLDTLDPYRFEIMTRRRGHDAVLRTLDLALSLPLKS---VKLNVVVIRGLNEDEILDFVEMTKDN---PISIRFIEFMPF-TGNKWEKQRMVPSSQLIQQISERHPSLSRGSAEL-NETAQTWKIPGYQGGFISSMSDLFCSTCNRLRLTADGQIKVCLFDPKEVSLRDELRRNATDEELLS. 318
423 0.000e+00UniRef50_A0A226ES70 Molybdenum cofactor biosynthesis protein 1 n=3 Tax=Folsomia candida TaxID=158441 RepID=A0A226ES70_FOLCA  ali  15  39...............................KTRPTREKEEFLPFSAFLTDKHGRQHNYLRISVTERCNLRCTYCMPEEGVPKLLSAAEIVRVAKTFVQQGVDKIRFTGGEPLLRKDLPSILGQISELN----LKSIGITTNGILLARLMPELKSSGVTSINVSLDTLIPKKFEKISRRPAWFKVWKGIEMAELMGYH---PLKINCVVQGGVNDDEICDFVELTKD---RHLDVRFIEYMPF-TGNKWDLSRMVAYKDMVEMIQSRYPNFSKLE-DPVTHTSKAYKIPGHVGGFITSMSEHFCGGCNRLRITADGNLKVCLFGNAEISIRDALRSGISEEDLLN. 349
424 0.000e+00UniRef50_A0A0L0NLF4 Molybdenum cofactor biosynthesis protein 1 n=1 Tax=Tolypocladium ophioglossoides CBS 100239 TaxID=1163406 RepID=A0A0L0NLF4_9HYPO  ali  14  66........................................DARPFSEFLTDTFHRQHDYLRISVTERCNLRCMYCMPEEGNRELLTTPEMVLLSSLFVSQGVTKIRLTGGEPTVRRDILSLMQQIGALRPR-GLKELCLTTNGISLHRKLDSMVEAGLTGVNLSLDTLDPWQFQIMTRRKGFDAVLKSVDRILELNLGAGIKLKINCVVMRGINDREVVPFVEMT---REKDMEVRFIEYMPF-EGNKWSQGKMFSYSEMLDLIREKYPDLQK-VQDHKNDTSKTWHVPGFVGGFITSMTHNFCGTCNRLRITSDGNLKVCLFGNAEVSLRDILRK.......... 363
425 0.000e+00UniRef50_R7Z7P6 Uncharacterized protein n=1 Tax=Coniosporium apollinis (strain CBS 100218) TaxID=1168221 RepID=R7Z7P6_CONA1  ali  15  50.............EPVVDFPSQSIELPPQQPERNRKDDLKHAKPFSDFLTDTFNRQHDYLRISITERCNLRCLYCMPEEGPSHLLTTPEITYLSALFVSQGVTKIRLTGGEPTVRSDILPLMRSIGALRSR-GLKELALTTNGISLHRKLDAMVEAGLTGVNLSLDTLDPFQFQIMTRRRGFEAVMKSVERILEMNKGAGVKLKINCVVMRGLNEREILPFVEMT---RDKDIEVRFIEYMPF-DGNRWSQGKMLPYREMLEIIRGKYPEV-RRVQGHKNDTSKTFGIPGFVGGFITSMTHNFCGSCNRLRITSDGNLKVCLFGNAEVSLRDLLRK.......... 374
426 0.000e+00UniRef50_F8PFY6 Uncharacterized protein n=13 Tax=Agaricomycotina TaxID=5302 RepID=F8PFY6_SERL3  ali  16  27....................SEQTVLDTTARAQLKISQIDSRTPISPSLIDSFHRRHDYLRISLTERCNLRCFYCMPNEGPQHLLTDSEVIRLATLFVKGGVTKIRLTGGEPTIRKGIIEIIGRLDELRVH-GLKSIGMTTNGLILHRRLPEFVANGLTHINLSLDTMDPFKFEIMTRRRGHEAVLRSLEAA--LLSPDLVSVKLNVVVMKGLNDHEVVDFVEMTKG---HNLSVRFIEFMPF-TGNKWDKAKMVPSSELLANIANRYPDIARA-PGKINDTARSWKIPGYRGGFISSMSDHFCASCNRLRLTADGQIKVCLFDAKEISLRDEMRGGASDTELL.. 349
427 0.000e+00UniRef50_C7N1E2 GTP 3`,8-cyclase n=22 Tax=Actinobacteria TaxID=201174 RepID=C7N1E2_SLAHD  ali  17  1................................................MKDSHGRVIDYLRISLTDRCNLRCRYCMPEEGHEDILSLEEIERIIRVAAGMGISRLRLTGGEPLVRKGIAGLIKEAMR---TPGIESVALTTNGILLPKMAAELKEAGLSRVNISLDTLDEEQFHYITRRGHVADVMAGIDAALEAGFN---PVKINAVVVRSLNQD----LYEFARMSVDRPLHMRFIEYMPVGDGTGWGPQDVVSCDEVMETINARIPELKPASKHTGWGPARYYEFEGAKGGFISPLSRHFCSECNRLRMTADGKIRPCLFSDEELDVRAAVREGTDEDIR... 304
428 0.000e+00UniRef50_M4C332 Uncharacterized protein n=1 Tax=Hyaloperonospora arabidopsidis (strain Emoy2) TaxID=559515 RepID=M4C332_HYAAE  ali  20  741LVPEPASSPNESLHQIRQILAEIRQLPQKATARRQ-------------LVDQFGRTHTYLRISLTERCNLRCRYCMPKDGNEDLLTPLEIIQLAKLFASSGVTKIRLTGGEPLLRQDLIELV---TQLKAIPGIESVGITTNGIVLRKKLLALQQAGVDGLNISLDTLKPVKFAHITRRQGFTRVMNSIVEAQELGIR---PLKINCVVQRHFNLDELVDFVAFTEK---HAVDIRFIEWMPF-DSNRWNDETFVAYDEMMEMIETAFPTVEKLQ-DRANDTSKAYHVPGFRGGFITSMSEHFCGSCNRLRLTADGNLKVCLFGSAEISLR............... 1054
429 0.000e+00UniRef50_A0A0D2F4X6 Molybdenum cofactor biosynthesis protein A n=12 Tax=Herpotrichiellaceae TaxID=43219 RepID=A0A0D2F4X6_9EURO  ali  15  62.......................LQSRPERRRLDKLREEHEPRPFSSFLTDNYSREHNYLRISVTERCNLRCLYCMPEEGSAQLLTTPEIVYLAELFVNQGVDKIRLTGGEPTVRKDIVGLMQQIGNLRRN-GLKELCITTNGISLHRKLDSMVESGLTGVNLSLDTLDPYQFTIMTRRNGHDAVMKSINRILEMNKGAKIKLKINCVVMRGLNESEILPFVEL---GREQDIEVRFIEYMPF-DGNKWSEKKMISFDEMLALIRQKYPDVQKVEG-HKNDTSKTYKVPGFAGGFITSMTHNFCGTCNRLRITGDGNLKVCLFGNAEVSLRDILRE.......... 376
430 0.000e+00UniRef50_A0A1P8B110 Cofactor of nitrate reductase and xanthine dehydrogenase 2 n=15 Tax=Eukaryota TaxID=2759 RepID=A0A1P8B110_ARATH  ali  17  41.......................SERLFSSSYAAHQVDQIKDNPVSDMLIDKFGRLHTYLRISLTERCNLRCQYCMPSEGKPQLLSQSEIVRLAGLFVSAGVNKIRLTGGEPTVRKDIEEICLQLSSLK---GLKNLAITTNGITLAKKLPRLKECGLDSLNISLDTLVPAKFEFLTRRKGHDRVMKSIDTAIELGYN---PVKVNCVIMRGLNDDEICDFVELT---RDKPINVRFIEFMPF-DGNVWNVKKLVPYAEVMDKVVKRFPSI-KRMQDHPTETAKNFTIDGHCGSFITSMTEHFCAGCNRLRLLADGNFKVCLFGPSEV.................. 341
431 0.000e+00UniRef50_A0A2A3ERQ9 Molybdenum cofactor biosynthesis protein n=8 Tax=Apis TaxID=7459 RepID=A0A2A3ERQ9_APICC  ali  15  6.......NITKSFFGVVYSSTESFVTPYVSRRIQQFRDQLNNTHNNDILTDSFGRRHTYLRISITERCNLRCLYCMPAEGNDGILRTDEIIKIADLFVNEGINKIRLTGGEPTVRKDIVDIIAGLKQLS---NLKQVAITTNGLTLTRQLPFLQKAGLDAINISLDTLQENRFEQFTRRKGWSRVMAAIDLAIQLGYN---PVKVNCVIMKGFNDDEIIDFVNLTKN---RPIDIRFIEYMPF-QGNEWNQNKMVSFETMKKFIRDIYPNLQRLPNKY-NDTSKAYHVPGFTGGFITSMTNHFCNSCNRLRITADGNLKVCLFGKGEISLRDALRSGVSNDILKE. 340
432 0.000e+00UniRef50_U1GGH6 Uncharacterized protein n=1 Tax=Endocarpon pusillum (strain Z07020 / HMAS-L-300199) TaxID=1263415 RepID=U1GGH6_ENDPU  ali  14  48..........RRHQADIQWIRHDQPTTGLPQQPLRLREETNPRPLSSYLTDDFSRAHNYLRISVTERCNLRCVYCMPENGVPHLLTTPEIVYLSQLFVSQGVDKIRLTGGEPTVRKDIIDLMTQIGRLR-RSGLKELCLTTNGLTLHRKLDAMVEAGLTGVNLSLDTLDPYQFTIMTRRNGHEAVTRSIERILEMNRGAGIKLKINCVVMRGINEREIIPFVELGKN---KDIEVRFIEYMPF-DGNKWSQGKMLSFKEMLATIREKYPDLQKIQ-DHKNDTSKTYQVPGFLGGFITSMTHNFCGTCNRLRITSDGNLKVCLFGNSEVSLRDILRE.......... 378
433 0.000e+00UniRef50_A0A074Y898 Uncharacterized protein n=1 Tax=Aureobasidium subglaciale EXF-2481 TaxID=1043005 RepID=A0A074Y898_9PEZI  ali  14  19.LQTERRSIATATATAQSSLDRDGSILSPQDDRRQAIKQ--AKPFSDFLTDKFKRQHDYLRISVTERCNLRCLYCMPEEGVPHLLTTPEIVYLSELFVSQGVTKIRLTGGEPTVRPDILPLMQQIGSLKTK-GLRELALTTNAISLHRKLDKMVEAGLTGVNISLDTLDPFQFQILTRRKGHSAVMKSIDRVLEMNKGAGIKLKVNCVVMRGINERELVPFVEMGKE---KDIEVRFIEYMPFG-GNKWSERKMLTYQEMLDIIREKYPTL-RSVKGHLNDTSKTYEIPGFVGGFITSMTENFCGTCNRLRITGDGNLKVCLHGNTEVSLRDLLRK.......... 353
434 0.000e+00UniRef50_U9UMQ3 Uncharacterized protein n=7 Tax=Rhizophagus irregularis TaxID=588596 RepID=U9UMQ3_RHIID  ali  18  22IIRGISSTSNSKQVQAIDTI--DIRHDLKHRVKEKISTIDKERPFSNFLTDRFDRQHTYLRISITERCNLRCTYCMPAEGIDKLLSTEEIIRIAQLFVSQGVNKIRLTGGEPTIRKDIVELIGELSKLKP-QGLQTIAMTSNGIALKRKLPKLVENGLNLLNISLDTLNPYKFELISRRKGLEKVLETIEQGIALGLR---PLKINCVVMRGVNDQEVPDFIELT---RNKPIEVRFIEYMPF-DGNKWNKNKLVSYRELLNDIRTRYNDVRKLSDDLHN-TSKTYYIPGFTGGFITSMSDHFCGTCNRLRITADGNLKVCLFGNAEVNLRDLLRENVPDHQLLD. 371
435 0.000e+00UniRef50_A0A0G4LU40 Uncharacterized protein n=1 Tax=Verticillium longisporum TaxID=100787 RepID=A0A0G4LU40_9PEZI  ali  14  381..........................LPANSTSNRRDALRDAKPFSDFLTDNFSRQHDYLRISVTERCNLRCVYCMPEEGVPDILTTPEIVMLSSVFVNQGVTKIRLTGGEPTVRRDIVPLMRQLGALRPH-GLQELCLTTNGLSLHRKLDAMVEAGLTGINLSLDTLDPWQFQIMTRRNGFSAVRKTIDRVFELNRAAGLKFKINCVVMRGRNDAEIVPFVDMT---RDRDVEVRFIEYMPF-DGNRWNEGKMLGYAEMLDVIRAAHPTVEK-VRDHRNDTAKTWRVPGFAGGFITSMTHNFCGSCNRLRVTSDGNLKVCLFGNAEVSLRDILRK.......... 692
436 0.000e+00UniRef50_Q0CMC0 Molybdenum cofactor biosynthesis protein 1 B n=1 Tax=Aspergillus terreus (strain NIH 2624 / FGSC A1156) TaxID=341663 RepID=Q0CMC0_ASP  ali  15  84........................................SAKPFSEFLTDTFNRQHDYLRISVTERCNLRCVYCMPEEGVERLLTSPEIVYLSSLFVSQGVTKIRLTGGEPTVRKDIVPLMQSIGELRRH-GLRELCLTTNGISLHRKLEPMVEAGLTGINLSLDTLDPFQFQIMTRRKGLDAVMKSIDKVLELNKGAGIKLKINCVVMRGVNDREILPFVEM---GRDSPIEVRFIEYMPF-DGNKWNQGKMVSYQEMLAIIREKYPSLEK-VTDHKNDTSKTYRVPGFKGGFITSMTHNFCGTCNRLRITSDGNLKVC......................... 366
437 0.000e+00UniRef50_A0A1R3KJF4 Chloroplast envelope membrane protein, CemA n=1 Tax=Corchorus olitorius TaxID=93759 RepID=A0A1R3KJF4_9ROSI  ali  15  331..................................EDLVKDKANPVSDMLVDRFGRMHTYLRISLTERCNLRCHYCMPEEGTPQLLSHQEIFRLANLFVTSGVNKIRLTGGEPTLRKDIQDICFNLSSLK---GLKALAFTTNGITLAKKLPMLKQCGVTSLNISLDTLVPAKFEFMTRRKGHHKVIESINAAIDLGYN---PVKVNCVVMRGFNDDEMCDFVNLT---RDKPINVRFIEFMPF-DGNVWNVKKLVPYSEMLDTVSKQFPGLKRL-NDPLTETAKNFKIDGHTGTFITSMTEHFCAGCNRLRLLADGNLKVCLFGPSEVSLRDPLRSGAGDEEL... 635
438 0.000e+00UniRef50_A0A135LK05 Cation transporter n=1 Tax=Penicillium patulum TaxID=5078 RepID=A0A135LK05_PENPA  ali  14  751.............................PTEPSRLSTLKSAKPFSDFLTDTFNRQHDYLRISV<