current user: public

If you have questions about the server, please let us know.

Query: sp|Q9NPG2|NGB_HUMAN Neuroglobin OS=Homo sapiens GN=NGB PE=1 SV=1, from H.sapiens

Results of PSI-BLAST search in nr85s
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150
# E-value Template Links and tools%idFirst MERPEPELIRQSWRAVSRSPLEHGTVLFARLFALEPDLLPLFQYNCRQFSSPEDCLSSPEFLDHIRKVMLVIDAAVTNVEDLSSLEEYLASLGRKHRAVGVKLSSFSTVGESLLYMLEKCLGPAFTPATRAAWSQLYGAVVQAMSRGWDGELast
1 2.000e-53UniRef50_A0A2K9UYR0 Globin-like protein n=3 Tax=Actiniaria TaxID=6103 RepID=A0A2K9UYR0_EXAPA  ali  29  23LTAQQIELVRDTWKDVKQDLEGHGVTFYTRLFTEHPETQQLF--TFRDVEGIDKLKEDDRFKFQAKRVMEMVGAAVDGLDDVPSLAGVLKDLGARHVKWNVKEEHYGPVGEALVFTLQTGLTEKFTTEVKEAWLAVYGIVADNMKAGARE. 170
2 3.000e-49UniRef50_Q7WUM8 Flavohemoprotein n=33 Tax=Proteobacteria TaxID=1224 RepID=HMP_RHIME  ali  22  2LTQKTKDIVKATAPVLAQHGYAIIQHFYKRMFQAHPELKNIFNMAHQERG------------EQQQALARAVYAYAANIENPESLSAVLKDIAHKHASLGVRPEQYPIVGEHLLASIKEVLGDAATDEIISAWAQAYGNLAD-ILAGMESE 139
3 7.000e-49UniRef50_A0A2G5WM90 Flavohemoprotein n=29 Tax=Bacillales TaxID=1385 RepID=A0A2G5WM90_9BACL  ali  22  2LDQKTIDIIKSTVPVLEQHGKTITTVFYKNMFEAHPELLDIFNHANQSQG------------RQQTALANTVYAAAQHIDNLAAIIPAVVQIAHKHVSLGILPEHYPIVGEHLLGAIKEVLGDAATPEIVDAWAAAYGVIADAFI-GVEAE 139
4 1.000e-48UniRef50_A6DJX1 Flavohemoglobin n=2 Tax=Lentisphaera TaxID=256846 RepID=A6DJX1_9BACT  ali  17  3LSQETIDIVKATAPVVGENAEKITSRFYPIMFERYPMVKEFFNQSHQRDG------------LQQKALAGAVVAYALNIDNLGALGGAVEGITERHASLNVQPEHYPIVGECLLAAIAEVLGDAVTPEIANAWGEAYGFLAEILIGAEKA. 140
5 1.000e-48UniRef50_UPI000C03F59C neuroglobin-like n=1 Tax=Stylophora pistillata TaxID=50429 RepID=UPI000C03F59C  ali  28  69ISQKQISLVQETWGLVSGDLEKVGVDFYMRLFKANPDVLQLFSFRDIDKSSDDIMRADDRLKRQGLVTMQHVDLAVNSLNDLGSIVPALRDLGGRHAMYKVEEHHYVLVGSVLLDTLNNGLGDNFTVEVKEAWTGVYGIVANTMQAGARE. 218
6 2.000e-48UniRef50_A5EFK6 Putative nitric oxide dioxygenase (NOD) n=135 Tax=Bacteria TaxID=2 RepID=A5EFK6_BRASB  ali  25  1MTPSQITLVQESFAKVAPISDQAAVLFYDRLFEVAPPVRAMFP---------------EDLTEQRKKLMGTLAVVVGGLSNLDTVLPAASALAKRHVNYGAKPEHYPVVGAALLWTLEKGLGEAWTPEVAEAWTAAYGTLSGYMISEA... 133
7 2.000e-48UniRef50_W6S202 Hemoglobin-like protein n=6 Tax=Firmicutes TaxID=1239 RepID=W6S202_9CLOT  ali  20  2LDQKTIEIVKSTVPALKEHGVEITKTFYKNMFENNPEVKRLFNMDRQASG------------EQPKALAMTILAAAQNIDNLEVLLPAVKKIGERHCDVQIKEEHYPIVGANLLVAIKEVLGDAATDEVIDAWGKAYEVIAKIFIDVEKE. 139
8 3.000e-48UniRef50_A0A2A5GVQ4 Flavohemoprotein n=7 Tax=Proteobacteria TaxID=1224 RepID=A0A2A5GVQ4_9PROT  ali  20  2LSQQTIDIVKSTAPILQEHGETLTKHFYKRMFSHNPEVLPFFNPANQTEGT------------QQRALANAICAYAANIDNLEVLGSAVELIAQKHASLQIKPEHYPIVGENLLESIREVLGEAANDDIINAWGEAYGFLADILI-GRETQ 139
9 4.000e-48UniRef50_A0A1Z9E261 Hemin receptor n=1 Tax=Gammaproteobacteria bacterium TMED119 TaxID=1986671 RepID=A0A1Z9E261_9GAMM  ali  32  1MTPEQITLVQESWAKVVPIKETAAELFYGRLFAEYPEVKPYFK---------------GDMTEQGKLLMQMISTAVNGLENLDALLEPVKALGSRHKDYGVKQADYDKVGASLLWTLEQGLKEDFTEEVKAAWTETYTIVADVMIGGAE.. 134
10 4.000e-48UniRef50_A0A166P7X2 Hemin receptor n=5 Tax=Proteobacteria TaxID=1224 RepID=A0A166P7X2_9GAMM  ali  27  1MTPEQIARVQASWQQVEGIADQAAALFYQRLFTQAPELEPLFK---------------GNMEEQGKKLMSMIGVAVKGLDRLDTIVPAVQKLGERHKDYGVKPEDYDAVAQALLWTLAQGLGDAFDADTESAWTEAYTLLASTMIDAAN.. 134
11 4.000e-48UniRef50_A0A1U7TQA7 neuroglobin n=1 Tax=Tarsius syrichta TaxID=1868482 RepID=A0A1U7TQA7_TARSY  ali  85  52............................GRLFALEPDLLPLFQYNCRQFSSPEDCLSSPEFLDHIRKVMLVIDTAVTNVEDLSSLEEYLAGLGRKHRAVGVKLSSFS-VGNSELGGPRQCRGPAVSPATRAAWSPLSG............. 191
12 9.000e-48UniRef50_A0A2S5LYU6 Flavohemoprotein n=6 Tax=Proteobacteria TaxID=1224 RepID=A0A2S5LYU6_9PROT  ali  19  2LSDQTIAIVKSTAPILQEHGETLTKHFYKRMFSHNPEVAPYFNPANQAAG------------LQQKALAGAICAYAANIDNLEMLGGAVELIAQKHVSLQIKPEHYPIVGENLLASIREILGEGATDEVVNAWAEAYGFLADIMI...... 134
13 9.000e-48UniRef50_A0A163CMC1 Flavohemoprotein n=8 Tax=Betaproteobacteria TaxID=28216 RepID=A0A163CMC1_9NEIS  ali  17  2LSEQTRALVKATVPVLKEHGVTLTSHFYQRMFRHNPELKNVFNQGHQASGQ------------QQQALAGAVLGYAEHIDDPSVLAPVVMRIAHKHASLGIRAEHYPIVGGHLLASIREVLGDAASDELIAAWAEAYGQLADILI-AAEAD 139
14 1.000e-47UniRef50_Q0VR92 Oxidoreductase n=6 Tax=Bacteria TaxID=2 RepID=Q0VR92_ALCBS  ali  30  1MTPVQIALVQNSWDKVDAISDQAASLFYDRLFTNDPALKPLFK---------------GNMEEQGKKLMTMIGVAVRGLDKLDTIVPAVQKLGARHKDYGVKPADYDTVAQALLWTLGQGLGDAFDSDTEAAWVAAYTILATTMIAAAD.. 134
15 1.000e-47UniRef50_A0A0N1C593 Hemin receptor n=5 Tax=Proteobacteria TaxID=1224 RepID=A0A0N1C593_9BRAD  ali  27  1MTPDQIALVQQSFSKVAPISEQAASLFYGRLFEIAPEVKPLF--------------AKADIREQGKKLMGTLAVVVGGLTDLPSILPAASRLAKHHVGYGVTAAHYAPVGAALLWTLEQGLGDAWTPELKEAWTGAYTTLSSYMIGEA... 134
16 2.000e-47UniRef50_M5P8Y4 Flavohemoglobin Hmp n=1 Tax=Bacillus sonorensis L12 TaxID=1274524 RepID=M5P8Y4_9BACI  ali  21  2LSEKTMQIVKSTAPVLKERGTEITSCFYERMFKAHPELKNIFNMSRQQTG------------GQPKALAYTVLQAAENIDRLEALLPVVKQIGHKHKSLQVKPEHYPIVGKHLLEAIEAVLGEAATPDILQAWAEAYEEIARVFID..... 135
17 2.000e-47UniRef50_A0A1Y0YLF9 Nitric oxide dioxygenase n=22 Tax=Bacillus TaxID=55087 RepID=A0A1Y0YLF9_BACLI  ali  20  2LSEKTMQIVKSTAPVLKEKGTEITTCFYKRMFDAHPELKNIFNMSRQQTG------------GQPKALAFTVLQAAENIDRLEDLLPVVKQIGHKHKSLHVKPEHYPIVGQHLLEAIEIVLGEAATEDILQAWAEAYEEIARVFIEVYEED 144
18 2.000e-47UniRef50_A0A2W8V006 Nitric oxide dioxygenase n=1 Tax=Burkholderia multivorans TaxID=87883 RepID=A0A2W8V006_9BURK  ali  23  2LTQQTKDIVKATAPVLAQHGYDIIQCFYRRLFDAHPELKNVFNMTHKEQG------------QQQQALARAVYAYAENIEDPGSLAAVLKNIANKHASLGVRPEHYPIVGEHLLGAIKETLGDAATDEIISAWAQAYGNLAD-LLAGME.. 137
19 2.000e-47UniRef50_UPI0009957A22 NO-inducible flavohemoprotein n=1 Tax=Bacillus patagoniensis TaxID=228576 RepID=UPI0009957A22  ali  26  7LSEQQVELIKSSVPVLAEHGLTITKRFYADLFEAHPELLNLFNHANQKQD------------KQQQALANTLYAAAANIENLEELLPVVKQIAHKHRSLQVKPEHYPIVGEHLLEAIKKVLGSSATNELLDAWANAYDIIADVFISVEAE. 144
20 2.000e-47UniRef50_UPI0003F6041F NO-inducible flavohemoprotein n=1 Tax=Bacillus TaxID=55087 RepID=UPI0003F6041F  ali  20  2LSEKTMQIVKSTAPVLKEKGTEITSCFYKRMFNAHPELKNIFNMSRQQTG------------GQPKALAYTVLQAAENIDRLEALLPVVKQIGHKHKSLDVKPEHYPIVGQHLLEAIEIVLGDAATEEILQAWAEAYEEIARVFIE..... 135
21 2.000e-47UniRef50_UPI0009DEF53C hypothetical protein n=2 Tax=Kitasatospora TaxID=2063 RepID=UPI0009DEF53C  ali  33  156.......LIKSSFAVVEPHGSEVTAYFYAHLFEHNPDVRKLF---------------AEHMNDQQDRLWAAIGTLVNRLEDTDTVVNVLQGLGRRHIGYGALPEHFPAVGGSLLASLAHFAGDAWTPEIEAAWTALYGVITDVMSAAMTEE 284
22 3.000e-47UniRef50_Q5QSA9 Globin X n=11 Tax=Euteleostomi TaxID=117571 RepID=Q5QSA9_DANRE  ali  26  28LTTNHIRLIKESWRLIQEDIAKVGIIMFVRLFETHPECKDVF-FLFRDVEDLERLRTSRELRAHGLRVMSFIEKSVARLDQLERLETLALELGKSHYRYNAPPKYYGYVGAEFICAVRPILKDRWTPELEEAWKTLFQYVTSIMREGFLEE 177
23 3.000e-47UniRef50_H0TDW5 Putative nitric oxide dioxygenase (NOD) flavohemoprotein n=102 Tax=root TaxID=1 RepID=H0TDW5_9BRAD  ali  27  1MTPAQIALVQDSFAKVAPISDQAAIIFYDRLFEVAPQVRALFPD---------------DLTEQRKKLMGTLAVVVNGLTNLPSILPAASALATRHVGYGAKAEHYPVVGGALLWTLEKGLGDAWTPEVAEAWSAAYGTLSSYMIAEA... 133
24 3.000e-47UniRef50_A0A0H2LWB1 Flavohemoprotein n=21 Tax=Proteobacteria TaxID=1224 RepID=A0A0H2LWB1_VARPD  ali  20  1MTPQTIAIVKATVPALQAHGEAITSHFYRIMFETHPEVKAFFNEAHQAAGS------------QARALAGAVLAYATHIDRLDEIAGALPRIIQKHAALGVLPEHYPVVGGCLLQAIKDVLGDAATDEIIAAWGEAYQSLAALLIAAEEE. 138
25 3.000e-47UniRef50_UPI000CF3C16C NO-inducible flavohemoprotein n=1 Tax=Deinococcus sp. NW-56 TaxID=2080419 RepID=UPI000CF3C16C  ali  22  2LTPEQTAIIKATVPALEAHGETITRTFYASMFAAHPELLNIFNPANQKTG------------RQARSLAASVLAYAAHIDHPERLGGMVGRIAHKHVSLEVLPEHYPIVGEHLLGAIASVLGDAATPEILDAWAAAYGQLAKIMI...... 134
26 4.000e-47UniRef50_A0A1I1MV56 Flavohemoprotein n=1 Tax=Cupriavidus sp. OV038 TaxID=1855313 RepID=A0A1I1MV56_9BURK  ali  23  2LTQKTKDIVKATAPVLAEHGYDIIKCFYTRMFQAHPELKNIFNMAHQERGQ------------QQQALARAVYAYAENIEDPSSLMAVLTNIANKHASLGVRPEQYPIVGEHLLAAIKEVLGSAATDDIISAWAQAYGNLADVLM-GMESD 139
27 6.000e-47UniRef50_UPI0004949DD7 hemin receptor n=1 Tax=Bosea sp. 117 TaxID=1125973 RepID=UPI0004949DD7  ali  30  1MTPDQIVLLRRSIDGLRPHSEQAAALFYGRLFEMLPEVRPLF---------------TEDMVEQGRKLMRTLVAVMNGIDDMRSLRPAVERLGQRHLQYGVRQEHYEPVGVALIWALEQGLGDAFTPDTRSAWLKAYDVLTQIMLDAA... 133
28 6.000e-47UniRef50_A0A1R4KM78 Flavohemoprotein n=64 Tax=Bacteroidetes TaxID=976 RepID=A0A1R4KM78_9SPHI  ali  22  5MTTEQKQMVKATVPVLKEHGVLLTTHFYKRMFEHNPELKHVFNMGNQQNS------------KQQTALAHAVLAYAEHIEDPSVLLPVVNNIGHKHTSLDIRPEHYAIVGRHLIASIGEVLGDAATPELIDAWTTAYGQLADLM....... 136
29 6.000e-47UniRef50_A0A2N0QM05 Globin-like protein (Fragment) n=2 Tax=cellular organisms TaxID=131567 RepID=A0A2N0QM05_9GLOM  ali  18  1LSQQTIDVIKSTVPVLEQHGVTITKTFYSNMLNAHPELLNYFNRANQQKG------------RQQTALANTVLAAAKYIDNLEPIVPVVMQIAHKHRGLGILPEHYPIVGENLLRAIKEVLGDAATDEIIDAWANAYGVIAEIFISVEED. 138
30 6.000e-47UniRef50_A0A1Q9AL98 Hemin receptor n=6 Tax=Proteobacteria TaxID=1224 RepID=A0A1Q9AL98_9RHIZ  ali  31  1MTPTDIDLVQSSFAKVVPIKEAAAELFYGRLFEIAPEVKPL---------------SKGDMKEQGRKLMMTLGVVVNGLKDLPSIVPAAEALAVKHNGYGVKPEHYQVVGDALLWTLEQGLGPDFTPQTKSAWATAYGTLSGVMIAA.... 132
31 7.000e-47UniRef50_W7E6F8 Flavohemoprotein n=11 Tax=Bacteria TaxID=2 RepID=W7E6F8_9PROT  ali  17  2LTENQKSIIKATVPVLAEHGVALTSHFYERMFAQNPELKQVFNRGHQEAG------------KQQHALAGAVLAYAQNIDNPTVLQGALVHIANKHVSLGIRAEHYPIVGKHLLASIKEVLGEGATDELIDAWGKAYEQLANLLIE..... 135
32 7.000e-47UniRef50_A0A1W7AAF8 Flavohemoprotein n=37 Tax=Bacteria TaxID=2 RepID=A0A1W7AAF8_9STAP  ali  20  2LTEETKNIVKATIPVLEEHGTEITSAFYKHMFEEHPELLNVFNKTNQK------------LGRQQTALAQTVIAAAKHIDHLEAIIPNVNQIAHKHRALEIKPEHYPIVGENLIWAIQHVLGDAATPEIVDAWSKTYGVIADVFIQ-MEA. 138
33 8.000e-47UniRef50_A0A257CVZ8 Hemin receptor n=19 Tax=Bacteria TaxID=2 RepID=A0A257CVZ8_9BURK  ali  33  1MNANQIALVQSSFEDVRPIAEVAAELFYGRLFETDPMLKPMFK---------------GDMANQGRMLMSVLSAAVKGLSDLDALAPVLRNLGARHHNYGVQEEHYVTVGSTLLWTLSQGLGDKFTPEVRAAWTDAYGLIADVMQFGALE. 135
34 9.000e-47UniRef50_M7CUM7 Bifunctional nitric oxide dioxygenase/dihydropteridine reductase 2 n=2 Tax=Gammaproteobacteria TaxID=1236 RepID=M7CUM7_9ALTE  ali  19  2LSPESRSIIDATLPAVEAHANDITDVFYPLMFERYPEVKAYFNQTHQAEGT------------QRRALANAVVAYARNLDRLEALGDAVSLIVNKHVSLNIQPEHYPIVGECLLAAVKQVLGDAATEEVLAAWGEAYQQLADILISAEE.. 138
35 9.000e-47UniRef50_A0A2N1IDL0 Methyl-accepting chemotaxis protein n=5 Tax=Gammaproteobacteria TaxID=1236 RepID=A0A2N1IDL0_9GAMM  ali  27  1MTPNQISLVQTSWQKVLPIAPQAAEIFYTTLFEMDPSLKALFPN---------------DIAEQGKKLMAMLDTAVKLLDNPDKLIPAVQNLGAKHLKYGAEPEHYDTVGAALLKTLAQGLGDDFTAPTKKAWTAVYQTLASTMIAAANE. 135
36 1.000e-46UniRef50_W7B9N7 Flavohemoprotein n=1 Tax=Listeria grandensis FSL F6-0971 TaxID=1265819 RepID=W7B9N7_9LIST  ali  21  4ITEEQKQIVKSTAPILKEHGKEITAIFYKKMFAAHPELLNYFNMTNQEIGT------------QPLALANTVYLAAENIEQLEILLPQVKTIAHKHRSLTIKAEHYPIVGEYLLKGIAEYLGDAATPEILDAWGAAYGIIADIFIEVEQE. 141
37 1.000e-46UniRef50_R1FSQ6 Uncharacterized protein n=1 Tax=Emiliania huxleyi TaxID=2903 RepID=R1FSQ6_EMIHU  ali  34  4..PDTIPELRSSWSA------AVGVLFFKRIFEIAPGALELFS---FRDVPAPELYESAKLKSHALKVMNTVGVAVSMLDDVPALLPVLEGLGKKHVDYGVVPAHYEVVGQALLDTLALGLGDAFTPELKAAWAEIYGVVSSTMIKGAN.. 141
38 1.000e-46UniRef50_A0A0J5PJK4 Flavohemoprotein, putative n=6 Tax=Aspergillaceae TaxID=1131492 RepID=A0A0J5PJK4_ASPFM  ali  20  103LTTQQKEIVKSTIPALQEHGVTITTLFYKRLLEAHPELKNIFNTAHQATG------------EQPAALAHAVWAYASNIDQPEALSTAVSRIGHKHASLGVLPEHYPIVGQHLLVSIKDVLGPAANEQVLNAWAAAYQELADMFIN-FEDE 240
39 1.000e-46UniRef50_A0A1Z5H8E0 Nitric oxide dioxygenase n=5 Tax=Gammaproteobacteria TaxID=1236 RepID=A0A1Z5H8E0_9GAMM  ali  30  39LSSEQINLVRESWKRVLPIKEQAAELFYQRLFELDPDVKSLFK---------------GRLDFQGDKLMTTLDVVVNSLDDLHEVEGMLQAMGRRHIIYGVEAAHYETVGAALLWVLAQGLGEHFTEEVEEAWVTAYGVIATTMKEAA... 171
40 1.000e-46UniRef50_A0A2K9UYS1 Globin-like protein n=3 Tax=Hexacorallia TaxID=6102 RepID=A0A2K9UYS1_EXAPA  ali  31  29ISDSKKNIIVQTWKLVEPVKVAAGKKLFSRLFELNPSLQDTFP--AFKGKELKDVLNSRSLYLHAKRVMGAVENAVSSLNDSEAFTSYLSNLGARHIPWNMQKEHFNIVGECLLWTFQDMLGTACTTEVAEAWAELYGYIVQSMLDGMK.. 175
41 1.000e-46UniRef50_X2GRE8 Dihydropteridine reductase n=14 Tax=Bacillales TaxID=1385 RepID=X2GRE8_9BACI  ali  18  2LDQHTINVIKSTVPVLEVHGVAITKTFYHNLFKDNPSLLNIFNHTNQTKG------------RQQGALANTVYAAAQHIDNLEPIVPVVVQIAHKHVSLGVLPEHYPIVGQYLLAAIKEVLGDAATDEIIEAWGKAYGVIADIFISVEED. 139
42 1.000e-46UniRef50_Q9XDU3 Bacterial hemoglobin n=17 Tax=Firmicutes TaxID=1239 RepID=Q9XDU3_CLOPF  ali  19  2LDQKTIDIIKSTVPVLKSNGLEITKTFYKNMFEQNPEVKPLFNMNKQES------------EEQPKALAMAILAVAQNIDNLEAIKPVVNRIGVIHCNAKVQPEHYPIVGKHLLGAIKEVLGDGATEDIINAWAKTYGVIAEVFINNEKE. 139
43 1.000e-46UniRef50_UPI000DA1778E NO-inducible flavohemoprotein n=3 Tax=Salinicola TaxID=404432 RepID=UPI000DA1778E  ali  20  3.TAAQIEIVKRTIPVLRQHGETLTRHFYARLFEHAPDVRRYFNPAHQRSG------------GQQRALAGAILAYAQHIDDPAALSDAIEVIAQKHASLTIQPEHYPIVGEHLLASIREVLGDAATADVLDAWAAAYDELAGVFIE..... 135
44 1.000e-46UniRef50_Q07S70 Globin n=6 Tax=cellular organisms TaxID=131567 RepID=Q07S70_RHOP5  ali  29  1MTPDQIALVQQSFTKVAPIADVAAGLFYGKLFDIAPEVRALFK---------------GDIAEQGKKLMGTLGVVVSGLTDLDAILPAASRLARHHVSYGVKPSHYAPVGAALLWTLEKGLGDEWTPDLAEAWTAAYGTLSGYMIE..... 131
45 1.000e-46UniRef50_UPI000248E5F7 globin n=2 Tax=Aquimarina TaxID=290174 RepID=UPI000248E5F7  ali  29  1MESKTIELVQGTFKQVAPIADQAAEIFYSKLFEKDPSLKPMFK---------------GDMKQQGAKLMAMIGTAVNGLNNLEALVPAVQNLGKGHAGYGVEDKHYDTVGAALLETLDVGLGDAFTPEVKEAWTEVYTVLATTMKDAAN.. 134
46 2.000e-46UniRef50_C9SVM3 Bacterial hemoglobin n=1 Tax=Verticillium alfalfae (strain VaMs.102 / ATCC MYA-4576 / FGSC 10136) TaxID=526221 RepID=C9SVM3_VERA1  ali  19  3MTEAQTAIVKSTAPILKEHGLTITTVFYKSMLGAHPELHNVFNLSNQRSG------------AQQKSLANAVLAYATHIDELQKLGPAVERIAQKHVSLGITPDQYAIVGEHLIKAIATVLGDGLTPEVADAWVAAYGQLADIFIK..... 136
47 2.000e-46UniRef50_A0A1E5TA13 Hemin receptor n=4 Tax=Bacteria TaxID=2 RepID=A0A1E5TA13_9FLAO  ali  30  1MESKTIALVQESFEKVKPIAPAAAEIFYNKLFELDPQLKPLFPNSE------------GEMKEQRNKLMSMLGAAVAGLSNLDALIPILKNLGKRHVDYKVEAFHYVTVGEALIGALEVGLGDDFTQDVKEAWANVYGVISNVMIEGAYQD 139
48 3.000e-46UniRef50_A0A239M371 Flavohemoprotein n=25 Tax=Bacteroidetes TaxID=976 RepID=A0A239M371_9BACT  ali  23  1MTTAQKELIKATVPILREHGVALTTHFYSRMFKHNPELKNVFNMGNQGNG------------KQQLSLALAVLAYAEHIEDPSVLVSAVTKIGHKHVSLDIRPEHYAIVGQHLLASIKEVLGEGATDELIAAWAAAYQQLADLM....... 132
49 3.000e-46UniRef50_A0A2N5KSE6 Hemoglobin (Fragment) n=1 Tax=Actinobacteria bacterium TaxID=1883427 RepID=A0A2N5KSE6_9ACTN  ali  29  6.TVRQKELVQSTWKRVIPISKTAPTLFYARLFELDPQLRALFP------------AGERSMKAQHLKLMQMIHICVRGLDQLDRIVPAVQNLGRRHVGYGARNGDYDTVGVALLWTLEQGLGDAFDDEVKEAWASVYGVLAATMIGAANE. 142
50 3.000e-46UniRef50_A0A2C9D3E3 Nitric oxide dioxygenase n=4 Tax=Proteobacteria TaxID=1224 RepID=A0A2C9D3E3_9RHIZ  ali  31  1MTPEQVKLVQESFQKVAPIADAAADIFYNRLFEVAPEVRSMFP---------------ADMSDQKGKLMKTLGVAVQNLHQVQTILPVVQELGAKHVAYGVKPEHYDTVGSTLLYTLEKGLGDAWTPELKDAWTETYVTVATVMKDAAA.. 134
51 3.000e-46UniRef50_A0A1H8YFV1 Nitric oxide dioxygenase n=18 Tax=Bacteria TaxID=2 RepID=A0A1H8YFV1_9PROT  ali  29  1MTPHQIKLVQTSFAQVAPIAATAADLFYGRLFEIAPHVRAMFPD---------------DLREQKKKLMAMLGTAVAGLSHLETLVPVVQALGRRHAGYGVKAPHYASVGSALLWTLEKGLGEAFTPEVRDAWATTYIVLSTTMMNAANE. 135
52 3.000e-46UniRef50_A0A150QD55 Hemoglobin (Fragment) n=1 Tax=Sorangium cellulosum TaxID=56 RepID=A0A150QD55_SORCE  ali  32  73.SPRTIELVQSSWAKVMPISDAASALFYERLFTIDPSVRPLFKN---------------DIAEQKRKLMQMLSVAVDGLSNLPKLVPVLQSLGARHQGYMVAEHHYDLVGEALLWTLREGLGEAFTSDVEAAWKEVYGVIADVMKK..... 202
53 4.000e-46UniRef50_A0A086D0Q4 Uncharacterized protein n=5 Tax=Gammaproteobacteria TaxID=1236 RepID=A0A086D0Q4_9GAMM  ali  19  2LSPDQIATVKQTIPVLEAHGDTLTRHFYTRMFAHNPEVKPYFNPAHQREG------------AQQRALAGAILAYARHIDDTAALAPAVEVIAHKHASLTIRPEHYPIVGENLIASIQEVLGDAATPEIVDAWKAAYAQLAAVFI...... 134
54 4.000e-46UniRef50_A0A1X9YXZ9 Flavohemoprotein n=13 Tax=Bacteroidetes TaxID=976 RepID=A0A1X9YXZ9_9BACT  ali  22  1MTNEQKELIKATVPVLRKHGVALTTHFYSRMFTHNPELKNVFNMGNQGNG------------KQQLSLALAVLAYAEHIEDPSVLVSAVTKIGHKHVSLDIRPEHYAIVGKHLLASIGEVLGEGATDELIEAWAVAYQQLADLM....... 132
55 4.000e-46UniRef50_A0A239ZQU0 Putative flavohemoprotein n=1 Tax=Staphylococcus stepanovicii TaxID=643214 RepID=A0A239ZQU0_9STAP  ali  23  2LSEKTREIVKETVPVLEQYGTEITKVFYERMFEAHPELLNIFNKSNQKQG------------KQQTALAQTVLAAAKHIDHLEAIVPNVNQIAHKHRALQVKEEHYPIVGEFLLKAIKEVLGDAATDEIMNAWEEAYGEIASVFI-AMEKE 139
56 4.000e-46UniRef50_A0A1S2DE36 Nitric oxide dioxygenase n=3 Tax=Salinicola TaxID=404432 RepID=A0A1S2DE36_9GAMM  ali  21  3.TPAQIDVIKQTVPVLQQHGEALTRHFYARMFEHNPEVKRYFNPAHQRSG------------GQQRALAGAILAYAQHIEDPSALASAIEVIAQKHTSLTIQPEHYPIVGENLLASIKEVLGDAATDDILDAWAAAYGELAQVFIDREQA. 139
57 5.000e-46UniRef50_UPI000BAF0685 non-symbiotic hemoglobin 1-like n=1 Tax=Crassostrea virginica TaxID=6565 RepID=UPI000BAF0685  ali  22  38.TEDQKQLVKATWDVVREDISKVGVITFLRLFEKFPDVQDLF--VPFRGLNSEELRQNVGLREHGLRVMGTIEKCITRIDKPEKLTSMLEVLGEKHIVFDTKIEYFDLLTPQLIQAIKPAIGDQWTPEVEHAWNNFLFYITGIMKNAM... 182
58 5.000e-46UniRef50_A0A2D0NFV7 Hemin receptor n=1 Tax=Lewinella nigricans DSM 23189 = NBRC 102662 TaxID=1122177 RepID=A0A2D0NFV7_9BACT  ali  26  1MDPQTVNLVQTSFQKVIPIADLAMKIFYTKLFEIDPSLQNLFPTGE------------EQMGKQRNKLRDMLVVAVNSLSKPEVLIPALQNLGRRHVGYGVAAEHYNTVGQALIDTLAAGLGDDFTPEVKTAWGEVYGLIATTMIEAGNE. 138
59 5.000e-46UniRef50_K9WVS1 Family 3 adenylate cyclase n=2 Tax=Cylindrospermum TaxID=56106 RepID=K9WVS1_9NOST  ali  28  726..PSQVDLVQSSFAKVKPIADKAAEIFYNRLFELAPSFRPLFK---------------GDMKQQERKLMNTLALAVEGLRQPDQIIPAVQKLGRNHAGYGVKAEYYDIVGEALLWTLAQGLGEDFTTPVRKAWEEAYTFLSEIMKEAAAE. 858
60 7.000e-46UniRef50_D0MR65 Nitric oxide dioxygenase (Pi-NOD1) n=15 Tax=Peronosporaceae TaxID=4777 RepID=D0MR65_PHYIT  ali  16  22MSAKTIAILKATAPVVQEHGTEITSTMYGTMFSEFPEVQNLFNMSHHRVAGATKGGAPPGVSRQATALANAVIGFAANCDQLGNLGDAVPRMVHKHVSLDIRAKHYPIVGGCLLRAIKTVLGDAATDEIIDAWKEAYWFLADLLIQAED.. 170
61 9.000e-46UniRef50_A7RGQ4 Predicted protein n=2 Tax=Actiniaria TaxID=6103 RepID=A7RGQ4_NEMVE  ali  32  30LSTRRKKLVRESWELIEPVKITIGKRLFTRLFDVNPNMQDTFP--NFKGKELKDILNSRSLYLHAKRVMVAVENAVTVLDDAETFESYLINLGGRHLPWGVTKDHFGVVGEAFIWALQDVLGEGCTSDVAEAWIDLYGYIVQAMLEGLQQ. 177
62 1.000e-45UniRef50_A0A261QJA7 Flavohemoprotein n=9 Tax=root TaxID=1 RepID=A0A261QJA7_9BACI  ali  23  2LSEKTIEIVKATAPVLEVKGKEITTYFYKTMFADHPELLNIFNHANQEKG------------RQQTALANTVYAAAKYIDQLEVLVPAVKQIGHKHRSLAVKPEHYPIVGEYLLKAIKEVLGEAATDDIINAWAEAYGVIAKVFIDVEAE. 139
63 1.000e-45UniRef50_P39662 Flavohemoprotein n=98 Tax=cellular organisms TaxID=131567 RepID=HMP_CUPNH  ali  23  2LTQKTKDIVKATAPVLAEHGYDIIKCFYQRMFEAHPELKNVFNMAHQEQGQQQQ------------ALARAVYAYAENIEDPNSLMAVLKNIANKHASLGVKPEQYPIVGEHLLAAIKEVLGNAATDDIISAWAQAYGNLADVLM-GMESE 139
64 1.000e-45UniRef50_A0A0L1HFZ0 Flavohemoprotein n=26 Tax=leotiomyceta TaxID=716546 RepID=A0A0L1HFZ0_9PLEO  ali  20  4LTPSQVQIIKATVPVLAEHGATITTKFYHDLLEAHPQLKNVFNNTHQATG------------HQAKALAGSLYAYAANIDDLGKLSPALELICHKHASLFIRPDQHAIVGKHLLETMKTVLGDAATPEILEAWGAAYWQLANVMIGKEDQ. 141
65 1.000e-45UniRef50_A0A0R3NBJ6 Hemin receptor n=4 Tax=Bradyrhizobiaceae TaxID=41294 RepID=A0A0R3NBJ6_9BRAD  ali  33  1MSPETKELLKSTWAKVVPISDVAAGLFYERLFTLDPSLQRLFK--------------NADMKEQRRKLVQALSAVINSVDDLPSLVPTLEILGRNHIRYGVEDRHYDTVGAALLWTLEQGLKEAWTPAAKSAWVVAYSTVSGVMRDVAAA. 136
66 1.000e-45UniRef50_A0A1Z3HMF2 Bacterial hemoglobin n=7 Tax=Cyanobacteria TaxID=1117 RepID=A0A1Z3HMF2_9CYAN  ali  28  12.TALQIELLEQSFAKVKPQANEFVASFYDNLFTDYPAAKPLF--------------AHTNMAEQGQKLLMSLVFVIENLRQPGELTAALQGLGARHVKYGALPEHYPLVGNSLLKTFEQYLGADWTPDTKAAWVDAYGLITEVMLEGADYD 147
67 2.000e-45UniRef50_A0A1M7FB72 Nitric oxide dioxygenase n=4 Tax=Burkholderiales Genera incertae sedis TaxID=224471 RepID=A0A1M7FB72_9BURK  ali  31  1MTPHDIHLIRHSFNLVQPHAADTAQRFYENLFAADPGLRELFRT---------------DIRHQGERLMTMLAAAIRVLDDPFTLHAALRLLGRRHAGYGVHAEHYATVGAALIRTLREGLGDAFTPEVHDAWVAMYGIVSRTMIEAARE. 135
68 2.000e-45UniRef50_A0A1Y5ESK5 Nitric oxide dioxygenase n=2 Tax=Gammaproteobacteria TaxID=1236 RepID=A0A1Y5ESK5_9GAMM  ali  18  2LDSNTINTIKATLPAVQAHAEQITACFYPLMFEQYPEVKSFFNQTNQANGT------------QSKALANAVIAYAANIDQLGNLSEAISKIVQKHCSLGIQPEQYPIVGDCLLQAIKQVLGDAATEEVIAAWGKAYQQLADILIAAETE. 139
69 2.000e-45UniRef50_S7X5W1 Flavohemoprotein (Hemoglobin-like protein) (Flavohemoglobin) (Nitric oxide dioxygenase) n=3 Tax=Cytophagales TaxID=768507 RepID=S7X5W  ali  19  1MNNSQREIITATVPILREHGVALTTHFYKRMFSHHPDLKNIFNMGNQKTG------------KQQQALAMAVLAYAEHIANPGVLLPELHRIGHKHVSLEIRPEHYPIVGNHLIASIKEVLGEAASLEILEAWEIAYNQLADLMM...... 133
70 2.000e-45UniRef50_UPI000837A761 NO-inducible flavohemoprotein n=1 Tax=Alteromonadaceae bacterium XY-R5 TaxID=1737567 RepID=UPI000837A761  ali  18  6LDDRTRELVKATAPILLEHGETITRCFYNRMLSKHPELKRYFNQTHQQSG------------AQAKALAYSVFCYANHINELDKLGGLVEQIVTKHVSLDILPEHYPIVGENLIAAIIEVLGDAFTPELQDAWVKAYGFLADLLI-GLEEQ 143
71 3.000e-45UniRef50_S3D2U5 Globin-like protein n=1 Tax=Glarea lozoyensis (strain ATCC 20868 / MF5171) TaxID=1116229 RepID=S3D2U5_GLAL2  ali  21  4LTKSQIQTIKATVPVLAQHGETITTKFYADLLVAHPELKNVFNSTHQATG------------RQARALGASLHAYASNIDDLGRLSPALELICHKHASLYIQPESYDVVGYHLLKAMKEVLGDAATPEILDAWETAYWQLANIMMSKEKD. 141
72 4.000e-45UniRef50_A0A033V6X9 Uncharacterized protein n=22 Tax=cellular organisms TaxID=131567 RepID=A0A033V6X9_STAAU  ali  23  2LSEQTKEIVKQTVPVLEQYGNEITKVFYQRMFEAHPELLNIFNKSNQKQG------------KQQTALAQTVLAAAKHIDHLEAIVPNVNQIAHKHRALQVKEEHYPIVGEFLLKAIKEVLGDAATDDIMNAWEEAYGEIAGVFIQ..... 135
73 4.000e-45UniRef50_A0A225VFI1 Nitric oxide dioxygenase (Pi-NOD1) n=1 Tax=Phytophthora megakarya TaxID=4795 RepID=A0A225VFI1_9STRA  ali  16  21MSAKTISILKATAPVVKEHGTEITSTMYGMMFSEFPEVQNLFNMSHHRVAGATKGGAPSGVSRQATALANAVIGFAANCDQLGNLGDAVPRMVHKHVSLDIRAKHYPIVGGCLLRAIKIVLGDAATDEIIDAWKEAYWFLADLLIQAED.. 169
74 4.000e-45UniRef50_W7ATG7 Flavohemoprotein n=3 Tax=Listeria TaxID=1637 RepID=W7ATG7_9LIST  ali  24  2LDEKTREIVKSTIPFLQDKGTEITGIFYQNMFKAHPELLNIFNQNNQREGT------------QSKALANTVLAAAMNIDDLSVLKPHVIQIGYKHRALQVKPEHYPIVGHHLIEAIGIVLGDAATDEIIDAWTAAYGEIAQVFIDAEKE. 139
75 4.000e-45UniRef50_A0A094H7R8 Uncharacterized protein n=1 Tax=Pseudogymnoascus sp. VKM F-4520 (FW-2644) TaxID=1420915 RepID=A0A094H7R8_9PEZI  ali  21  276MTRQQQDIVKSTAPVLAEHGIAITTHFYKRMLEARPELKNIFNIAHQATG------------AQPAALAHAIWAYADNIDNLGALTSAVSRIGHKHASLGVTPDQYAIVGEHLLASIKEVLGDAVNEPVLDAWAAAYEQLAEIFIR..... 409
76 5.000e-45UniRef50_L0G369 Hemoglobin-like flavoprotein n=1 Tax=Echinicola vietnamensis (strain DSM 17526 / LMG 23754 / KMM 6221) TaxID=926556 RepID=L0G369_ECHV  ali  22  3.SKSTIEIVKSTAPVLKEYGEQITKVFYKKLFETHPDLRNLFNMTNQVKGT------------QPKVLANAIIQYATYIETPEVLLQAVNSIAHKHSSLSITPEMYPIVGETLLWAIKEVLGDAATPDIIGAWAEAYGELAEIFIAKED.. 138
77 5.000e-45UniRef50_A0A078M590 Flavohemoprotein n=9 Tax=Bacillaceae TaxID=186817 RepID=A0A078M590_9BACI  ali  20  2LQQQTMDIIKATAPVLEVHGVTITKTFYQNMFDNHPELLNIFNHTNQARG------------RQQTALANTVYAAAVHIENLEAILPVVVQIAHKHVSLGVLPAHYPIVGKYLLAAIKEVLGDAATPEILQAWEQAYGVIADIFIQVEED. 139
78 5.000e-45UniRef50_A0A1F7ZJE5 Flavohemoprotein n=1 Tax=Aspergillus bombycis TaxID=109264 RepID=A0A1F7ZJE5_9EURO  ali  20  262LTPQQIQIVKSTIPALEAHGVAITTLFYQRLLQQHPELKNIFNTAHQATG------------EQPAALAHSVWAYATNIEHPEALKPAISRIGHKHASLGITADQYPAVGEGLLAAIKEVLGDAVDDQVLDAWRAAYGELAGYFID..... 395
79 5.000e-45UniRef50_UPI000361A298 NO-inducible flavohemoprotein n=1 Tax=Algicola sagamiensis TaxID=163869 RepID=UPI000361A298  ali  15  2LSQQTMTIIQSTAPVLAEHGVAITDRFYHLLFSAHPALKHIFNMSNQSEGT------------QKKALAQAVYSYAQHIDRLADLLPLVERIAHKHASLGILPEHYPIVGKYLIEAIQDVLQDAFTDEIKAAWVEGYQMLADILI-AREEQ 139
80 6.000e-45UniRef50_A0A090IE55 Flavohemoprotein n=19 Tax=Proteobacteria TaxID=1224 RepID=A0A090IE55_9GAMM  ali  20  2LTQHTIDIIKATVPAVSVHANDITAHFYPLMFREYPEVKRFFNQSNQSGN------------AQPKALANALVAYAGNIENLSVLEAAVNRIINKHVSLNIQPEQYEIVGECLLKSIKAVLGDAATDEVIDAWGLAYWQLADLLIAAEEA. 139
81 6.000e-45UniRef50_A0A210PFB5 Cytoglobin-2 n=1 Tax=Mizuhopecten yessoensis TaxID=6573 RepID=A0A210PFB5_MIZYE  ali  24  54.TDRQRELVVQTWGIIQEDMTRVGVVMFMRLFETHPDVQDVF--MPFKGQSKEDLSHSSQLKAHALRVMNTVEKCLGQMNEPAKLQEMLHDLGTRHVMYSAKVDYIDLIGPQFIWAIQSSVGDQWTPEVEQAWSDLFKLISHYMKAAM... 198
82 7.000e-45UniRef50_UPI000557B650 hypothetical protein n=1 Tax=Dongia sp. URHE0060 TaxID=1380391 RepID=UPI000557B650  ali  26  1MTPRQIEIVKLSFARIMPFKDQAAELFYCRLFELDPSLRLMFR---------------SDMNEQKQKLMVAIALVVTNLDRMDNFLPAVRELGQRHKTYGVRNRQYEIVGAALIWTLEIGLGTGWNAELEEAWKNAYGCVAAAMIEGAE.. 134
83 7.000e-45UniRef50_A0A2I1C704 Flavohemo protein n=1 Tax=Aspergillus novofumigatus IBT 16806 TaxID=1392255 RepID=A0A2I1C704_9EURO  ali  20  3LTPEQVQIIKATVPVLTEHGTTITTVFYKNMLTAHPELNNVFNTAHQVSG------------HQPRALAGALFAYASNIDNLGALGPAVELICHKHASLYIKPDDYKIVGKFLLEAMGQVLGDALTPEILDAWATAYWQLADLMI-GREAQ 140
84 7.000e-45UniRef50_A0A1G7TWS7 Nitric oxide dioxygenase n=4 Tax=Flavobacteriaceae TaxID=49546 RepID=A0A1G7TWS7_9FLAO  ali  18  1MTSKQKRSIKDTIPTLKTNGIDLTKHFYKRMFFHNPELKNVFNMGNQANG------------KQQNALAGAVLAYAEHIENPGILIGTLETIGNKHVSLNITPEQYDIVGTHLLASIKEVLADKATDDIIEAWTQAYNELAAIMI...... 133
85 7.000e-45UniRef50_W7D677 Flavohemoprotein n=11 Tax=Listeriaceae TaxID=186820 RepID=W7D677_9LIST  ali  21  4ITEEQKQIVKSTAPILKEHGKEITSIFYKKMFADHPELLNYFNLTNQEIGT------------QPLALANTVYLAAENIERLEVLLPQVKTIAHKHRSLTIKAEHYPIVGEYLLKGIAEYLGDAATPEILDAWGAAYSIIANIFIEVEQE. 141
86 7.000e-45UniRef50_UPI00078047DE NO-inducible flavohemoprotein n=1 Tax=Pseudoalteromonas arabiensis TaxID=874454 RepID=UPI00078047DE  ali  19  2LSEKTIEIVKSTVPLLAEAGPQVTEYFYDRMFSYNPELKNIFNMSHQQSG------------HQQFALFNALAAYAANIDNLAVLKDALARINHKHTSYHILPEHYPIVGGHLIATLKELLPEQFTPEVEYAWREAYALLADVCI...... 134
87 7.000e-45UniRef50_Q2U124 Uncharacterized protein n=154 Tax=cellular organisms TaxID=131567 RepID=Q2U124_ASPOR  ali  21  3LSPEQIQLIKATVPVLQQHGTTITTVFYNNMLTAHPELNAVFNNANKVNG------------HQPRALAGALFAYASHIDDLGALGPAVELICNKHASLYIQPEQYQIVGKFLLEAMGEVLGDALTPEILDAWATAYWQLADLMI-GREAE 140
88 7.000e-45UniRef50_E1X5F5 Putative flavohemoprotein n=3 Tax=Halobacteriovorax marinus TaxID=97084 RepID=E1X5F5_HALMS  ali  20  17LESKTIEIIKSTAPILEEHGVLLTKHFYKKLFEKNPEVMPYFNRAHQ------------EMGTQQEALAGAICAYAKNIDNLSALSGAVSLIANKHSSLKIKPEHYPIVGVNLLESIKEVLGDGATDDIISAWKKAYFFLADILIEAEK.. 153
89 7.000e-45UniRef50_UPI00084ADFC8 uncharacterized protein LOC108680782 n=1 Tax=Hyalella azteca TaxID=294128 RepID=UPI00084ADFC8  ali  23  354LTQEQKIIIKETWAIVKQNVERVGVIMFTNLFETHPDVQEVF--LPLRGMEKNALLDNKKLRNHALRVMGFVEKAVGRLEEPAQLQALLETCGRNHCGYGAALHHIDLVGPQLLEAIKPSLEDRWSPEISTAWTLLMDNIAYAMKAAMR.. 500
90 9.000e-45UniRef50_A0A1M3FWD1 Hemoglobin n=1 Tax=Sphingobacteriales bacterium 46-32 TaxID=1895839 RepID=A0A1M3FWD1_9SPHI  ali  28  1MTQQEITIIRRTWKIFRSNPDIVGDAFYSKLFADAPAVRKMFP---------------AEMNAQYKKLVDMLSGIVANLDDISVLSGDIAAMARRHVEYGVRPGHYKVVGNALLWTLQQGLGTDWNPAVESAWRKCYQQLAEAMIAAGE.. 135
91 1.000e-44UniRef50_UPI000B8E4BF3 cytoglobin-2-like n=1 Tax=Zootermopsis nevadensis TaxID=136037 RepID=UPI000B8E4BF3  ali  24  82LTERQKELLEETWKELEGNIAKVGVITFISLFETHPDVQQVF--MPFNGIELEDLKHSKQLRAHALRVMAFVQKAVARLHEPEKLETILQELGKKHYTYGAKQKYVDLIGPQFIQAIQPSLEDRWTPELQEAWIHLFKYMAYVMKTSMGEE 230
92 1.000e-44UniRef50_A0A0Q9YP91 Flavohemoprotein n=37 Tax=root TaxID=1 RepID=A0A0Q9YP91_9COXI  ali  18  2LDEYTIRIIKSTVPILEKHAEQLTYHFYKRMFSHNPEVIPLFNSAHQSTG------------HQQKALAGAICSYAANIDNLEALGSSIELIAQKHASLQIKPKHYPIVGQNLLASIQEILGNGATDEVIQAWAQAYDFLANILI-GRETQ 139
93 2.000e-44UniRef50_A0A1I6RIH7 Flavohemoprotein n=1 Tax=Marininema halotolerans TaxID=1155944 RepID=A0A1I6RIH7_9BACL  ali  23  2LDERTIQIIKSTAPIIKEHGEEITRCFYQRLFHRHPELLNYFNQANQRQG------------RQQQALANAVWAVAENIDQLEKVLPMVEGIAHKHRALGVKAEQYPIVGENLLIAIQKVLGLSPTDEIMKAWEQAYGVIAEVFIGKEAE. 139
94 2.000e-44UniRef50_A0A090T2N7 Flavohemoprotein n=4 Tax=Gammaproteobacteria TaxID=1236 RepID=A0A090T2N7_9VIBR  ali  21  2LSNQHIEIIKSTIPLLESAGPALTQHFYQRMFAHNPELKDIFNMTHQKSG------------RQSVALFEAVAAYAKNIENLAALSAAVERIAHKHTSFHIKAEHYQIVGHHLIETLRELAPEAFTPAVEEAWTEAYLFLAQIFIDREEE. 139
95 2.000e-44UniRef50_A0A2L0EJF9 Uncharacterized protein n=1 Tax=Sorangium cellulosum TaxID=56 RepID=A0A2L0EJF9_SORCE  ali  30  74LSPRTIELVQWSWAKVMPISDAAAALFYERLFTLDPSVRPLFKN---------------DIAEQKKKLMQTLAVAVDGLNNLGKLVPVLQSLGVRHHGYMVAEHHYDVVGEALLWTLREGLGDAFSSDIETAWKEVYGVIADVMKK..... 204
96 3.000e-44UniRef50_A0A1B8C2M8 Uncharacterized protein n=1 Tax=Pseudogymnoascus sp. WSF 3629 TaxID=1622147 RepID=A0A1B8C2M8_9PEZI  ali  23  6MTPEQINIILQTVPLVQERAYDITTIFYQNMLSAHPELNSIFNTTSQRT------------EHQARALAGALCAYAANINKLDALGPMLELICHKHASLLIEPKQYSIVGKYLIEAMEQVLGEAFTPNIQAAWTTAYWQLAKIMIE..... 139
97 3.000e-44UniRef50_A6CH06 HMP (Fragment) n=1 Tax=Gimesia maris DSM 8797 TaxID=344747 RepID=A6CH06_9PLAN  ali  17  2LSAKTIQIVKEITPTVAANAETVTRVFYKRMFQENPEVQAYFNQAHQHSG------------GQQKALAGAICAYFLHIDDLAALTPAVELIAQKHCSLGIQPEHYPIVGKHLLAAIKEVMGDGATDEVLAAVGEAYQLLADVCI...... 134
98 3.000e-44UniRef50_A0A2E3CUM4 Hemin receptor n=5 Tax=Proteobacteria TaxID=1224 RepID=A0A2E3CUM4_9GAMM  ali  25  1MTPEQITKVQTTFDMVEPIADKAAELFYGRLFEIAPEVRPMFK---------------SDMSEQGAKLMRMLGIAVRGLTKLETIVPAVQNLGVKHLEYGVKEEHFQPVAEALLWTLEQGLGDAWDEEAKVAWTEAYVLLSTTMIDAM... 133
99 3.000e-44UniRef50_H2MRF9 X globin n=51 Tax=Gnathostomata TaxID=35060 RepID=H2MRF9_ORYLA  ali  22  29..EEQIQMIKDSWKVIRDDIAKVGIIMFVRLFETHPECKDVF-FLFRDVEDLERLRTNRELRAHGLRVMSFIEKSVARLDQPERLEALAVELGKSHYHYNAPPKYYNYVGAEFICAVQPILKEQWTTELEKAWQTLFQFVTALMKQGYQEE 176
100 3.000e-44UniRef50_A0A2R8AQT8 Bacterial hemoglobin n=23 Tax=Bacteria TaxID=2 RepID=A0A2R8AQT8_9RHOB  ali  29  1MDDKQITLIQESFAKVVPIKDAAAEIFYADLFETAPAVKPYF--------------ANADMKDQGSKLMATLAVVVNGLRDLDKIVPVAQQLAVKHVDYGVKAQDYDSVGASLLRTLEKGLGDDFTPEVKEAWTVAYTTLAGVMKGAA... 134
101 3.000e-44UniRef50_A0A1Y5EC26 Methyl-accepting chemotaxis protein n=17 Tax=Gammaproteobacteria TaxID=1236 RepID=A0A1Y5EC26_COLPS  ali  28  1MTPNQISLVQKSWQKVLPIAPQAAEIFYSTLFEMDPSLKALFP---------------SNIADQGKKLMAMLDTAVKLLDNPDKLIPAVQNLGAKHLKYGAEPEHYDTVGAALLKTLAQGLGQDFTAPTKKAWTVVYQTLATTMITAAND. 135
102 3.000e-44UniRef50_UPI00077B149A neuroglobin-like isoform X1 n=2 Tax=Acropora digitifera TaxID=70779 RepID=UPI00077B149A  ali  30  105.....ITRVQETWRSVKEKLEHIGLEFYLRLFTDSPELLQLFSFS-DIDLSNEAARNDKRLTRQGRVTMEHLDLAVSSLNNLGSIVPALKELGARHVMYKVEEHHYEPVGAALLKTLHNGLGERFTPEVREAWTQVYKIVADTMKAGAKE. 250
103 3.000e-44UniRef50_UPI0007EE5E86 hemin receptor n=1 Tax=Rhizobium TaxID=379 RepID=UPI0007EE5E86  ali  26  1MNPHNISLVQQSFKKLVPTADQVGLMFYGRLFETFPEVRPLF---------------AEDIGPQSKKLVQMLALVVGGLDKLDAILPAVKDLARRHKGYGVVEGHYEAVGLTLIWTLRRGLGDAFTPEVEGAWSEAFGALSGVMIAAANE. 135
104 4.000e-44UniRef50_Q7SDB4 Flavohemoglobin n=28 Tax=Sordariomycetes TaxID=147550 RepID=Q7SDB4_NEUCR  ali  21  3LTYQQSKLVRDTIPALKEHGERITSIFYKTMLTDHPELNNYFNSVNQKNG------------RQPRALTAVILGFASNINHLSELVPKFERMCNKHCSLGIQPEHYEVVGKYLIQAFGEVLGPAMTPEVQTAWTKAYWMLAKMLI-GREAQ 140
105 4.000e-44UniRef50_A0A2A5SZ43 Putative bacterial hemoglobin n=7 Tax=Bacteria TaxID=2 RepID=A0A2A5SZ43_9BACT  ali  28  3LTPHQITLISQSFYKVEPISEKITEIFYKTLFAYEPTVKSLFK---------------GDMQQQGRKLMVMLHTVVNSLNRLDNLVPVLQDLAKRHVDYGVKKTHYTPVGNALIHTLQIGLGDDFTPEVKAAWIAILDIIADTMKAEMD.. 136
106 5.000e-44UniRef50_A0A2B4SEQ9 Neuroglobin n=2 Tax=Stylophora pistillata TaxID=50429 RepID=A0A2B4SEQ9_STYPI  ali  29  34LTADTKNTLRESWKLVEPLKTEAGKLMFVRLFETHPNIQDTFPT--FKGVSLDELMNSRSLYLHAKRVMAAVDNAINALDDCEVLIESLTSLGQRHQAWSVMEDHFAVVGEALLWTLQDLLQSKCTSQVLEAWTELFKFITKTMLVG.... 178
107 5.000e-44UniRef50_A0A1F7ZZ88 Flavohemoprotein n=6 Tax=leotiomyceta TaxID=716546 RepID=A0A1F7ZZ88_9EURO  ali  21  3LSPEQIQLIKATVPVLQQHGTNITTVFYSNMLTAHPELNAVFNNANKTNG------------HQPRALAGALFAYASHIDDLGALGPAVELICNKHASLYIQPDQYQIVGKFLLEAMGQVLGDALTPEILDAWATAYWQLADLMI-GREAE 140
108 5.000e-44UniRef50_UPI0009E1D017 globin-1-like isoform X1 n=2 Tax=Orbicella faveolata TaxID=48498 RepID=UPI0009E1D017  ali  23  83LTPAQKYLVRETWETIELHKNSVGKKTFLRFFEKNPEYQKLFPE--FKDVPPEELEKTNALYGHTKRVMKAVENAVSALDDAESFSAYLDELGRRHKTRSLRPTHLEAMQDALMFTLQDLLKSSWTDETSDAWKKLFHFIIDHMIYGLQ.. 229
109 5.000e-44UniRef50_Q7UIY1 Flavohemoprotein n=14 Tax=Bacteria TaxID=2 RepID=HMP_RHOBA  ali  18  2LSEKTIRIVKEITPLVAANAETITRRFYERMFEANPEVKAFFNQAHQHSG------------GQQKALAGAICAYFTHIDNPAVLMPAVELIAQKHVSLGIKPEHYPIVGSNLLAAIGDVMGDAATPEIVEAVSEAYGFLADIFIEGYEEQ 144
110 5.000e-44UniRef50_F1A2R8 Uncharacterized protein n=6 Tax=cellular organisms TaxID=131567 RepID=F1A2R8_DICPU  ali  20  2LSPKTVQVIKSTVPVLEQYGVQITSTFYKNMFAAHPELLNIFNHSNQREG------------KQQTALANTVYAAALHIDKLPEILPAVKQIAHKHRALGIVPAQYDIVGANLLGAIKQVLGDAATDEIIGAWAEAYGVIAKVFID..... 135
111 6.000e-44UniRef50_M2THC1 Uncharacterized protein n=6 Tax=Bipolaris TaxID=33194 RepID=M2THC1_COCSN  ali  17  4LTPTQVQIIKSTVPVLAEHGTAITSRFYHDMLQAHPELKNIFNNTHQATG------------HQAQALAGSLYAYAANIDNLGKLSPAVELICHKHASLFIRADQYDIVGKHLLSTMSSVLGAAATPEILDAWGAAYWQLANIMI...... 136
112 6.000e-44UniRef50_A0A0N7LZA9 Nitric oxide dioxygenase n=142 Tax=cellular organisms TaxID=131567 RepID=A0A0N7LZA9_9RHOB  ali  28  1MHESEIQLVQASFAKVAPIADQAAGIFYDRLFEIAPHVKPYFK---------------GDMKVQGAKLMTTLGVVVKGLRDLDKIVPVAQQLAIGHVAYGVTPEDYAPVGEALIYALKTGLGDDFTPDTANAWIRAYETLSSAMIEAA... 133
113 6.000e-44UniRef50_A0A128F1V6 Flavohemoprotein n=47 Tax=root TaxID=1 RepID=A0A128F1V6_9GAMM  ali  34  3LTQQQITLIQTSFSKVEPISLKAAEIFYDTLFSYDPTLKPLFK---------------SDMKLQGRKLMAMLSAAVNGLNDLDSLVPVLHQLAERHEGYGVKKSHFTPVGNALLHTLKVGLGDEYTPEVRAAWVALLHIVADTMKSKMAA. 137
114 7.000e-44UniRef50_K9WM86 Family 3 adenylate cyclase n=4 Tax=Cyanobacteria TaxID=1117 RepID=K9WM86_9CYAN  ali  26  724LAPTQVELVQSSFEKVKPIADRTAELFYQRLFELSPSVRHLFK---------------GEMKEQERKLMHTLALAVEGLRQPENIIPAVQDLGRRHAGYGVKTEYYDILSDALLWTLAQVLGVEFTAPVRKAWEEAYTFLSEIMKEAAAE. 858
115 7.000e-44UniRef50_A0A285U7Z8 Nitric oxide dioxygenase n=1 Tax=Salinicoccus kekensis TaxID=714307 RepID=A0A285U7Z8_9STAP  ali  27  1MEPHKKEIIKATVPALEEHGTTITTVFYQNMFKKHPDLLNMFNQTNQKVGD------------QPKALAFTVLQAARHIDDLEAIVPAVIGIAHKHRALNVKPEHYPIVGENLLEGIKEVLGDAATPEIMDAWEEYYGEIAQIFID..... 134
116 8.000e-44UniRef50_I3K2H7 X globin n=36 Tax=Percomorphaceae TaxID=1489872 RepID=I3K2H7_ORENI  ali  24  31..EDQIQMIKDSWKVIRDDIAKVGIIMFVRLFETHPECKDVF-FLFRDVEDLERLRTSRELRAHGLRVMSFIEKSVARLDQLDRLEALALELGKSHYHYNAPPKYYSYVGAEFICAVQPILKERWTAELEEAWKTMFQFVTSLMNQGYQEE 178
117 8.000e-44UniRef50_A0A2N7GG17 Hemin receptor n=2 Tax=Vibrio sp. 10N.261.55.A7 TaxID=1880851 RepID=A0A2N7GG17_9VIBR  ali  30  8ITAIEKKLIQDSFSKVAPIADTAAEIFYGKLFEYDPSLKRLFK---------------SDMTSQGRKLMNTLGVAVKGLDDLESLVPVLEGIAIKHVRYGVKIDDYTPVGNALIYALKTGLGDEFDTKTRNAWVKIYSTIATVMRSAA... 140
118 8.000e-44UniRef50_A0A2G7GNZ9 Uncharacterized protein n=1 Tax=Chroococcales cyanobacterium IPPAS B-1203 TaxID=2049454 RepID=A0A2G7GNZ9_9CHRO  ali  25  4....QVEVLEQSFERVKPHANEFAASFYNNLLTDYPQLQHLF--------------AKTDMEQQHQKLIMSLILVIGNLRNPEYLKITLKNLGERHVGYGTLQQHYPMVGAALLKTFESYLGTDWTPEVKQAWADAYGVLAEMMLEGAEA. 135
119 9.000e-44UniRef50_A0A1K0FUM1 Globin H n=7 Tax=Amniota TaxID=32524 RepID=A0A1K0FUM1_MYOLU  ali  94  96......ELIRQSWQAVSRSPLEHGTVLFTRLFDLEPDLLPLFQYNCRQYSSPEDCLSSPEFLDHIRKVMLVIDAAVTNVEDLSSLEEYLAGLGRKHRAVGVKLSSFSTVGEALLYMLEKCLGPAFTPAVRAAWRQLYGAVVQAMSRGWDGE 240
120 1.000e-43UniRef50_A0A0B3BTQ4 Flavohemoprotein n=669 Tax=root TaxID=1 RepID=A0A0B3BTQ4_9PSED  ali  24  2LSQDTKDLIKATAPVLAEQGSTIIRRFYQRLFEAHPDLRNLFNMTHQQRGQ------------QQEALARAVYAYAANIEQPETLAAVLENIAHKHASLGVRPDQYPIVGEHLLGAIKDVLQEAASQDILDAWAQAYGQLAD-LLTGME.. 137
121 1.000e-43UniRef50_M7NY13 Bifunctional nitric oxide dioxygenase/dihydropteridine reductase 2 n=1 Tax=Methylophaga lonarensis MPL TaxID=1286106 RepID=M7NY13_9GA  ali  21  1MNSSQIEIIKQTVPVLQEHGETLTRRFYENMFRNNPEVKDFFNPAHQQAGT------------QQRALAGAICAYAANIDNLSALSGAVDLIAHKHVSLGIKPEHYPIVGQNLILTIQEVLGEAANEAIIEAWTVAYQELARIFV-GQEAQ 138
122 1.000e-43UniRef50_UPI000B9B7971 hypothetical protein n=1 Tax=Hydrocoleum sp. CS-953 TaxID=1671698 RepID=UPI000B9B7971  ali  23  5.....IEIIEQTFAQIKPNAEKFAASFYVNLFREYPELKPLF--------------VNTDMEKQQKKLLDALILVVENLRHGEVLKGVIEALGARHVNYGVLQQHYPAVGKALLETLKEYLQENWNSEVKAAWVSAYRGIAKLMLKGANYQ 136
123 1.000e-43UniRef50_A0A1K2FKH4 Bacterial hemoglobin n=25 Tax=Streptomycetaceae TaxID=2062 RepID=A0A1K2FKH4_9ACTN  ali  28  1MTA-DIALIRSSFAAVQPHGSQVTEYFYDHLFTHHPGVRPLF---------------AAHLDEQRDRLWAALGALVANLENTDTLMGMLQNLGRRHAGYGALAEHYPAVGASLIAALRHHAGDAWTPAVEESWTAVYGVISSTMVAAGEA. 134
124 1.000e-43UniRef50_K9Y083 Nitric oxide dioxygenase n=19 Tax=Cyanobacteria TaxID=1117 RepID=K9Y083_STAC7  ali  19  117.SQKTIDIVKSTAPVIKQHGKTITTRMYEIMFDTHPEVKSQFDMAAQANGT------------QHAKLATAVYSYATHIDDLESLKAMVDKIAHRHVATHVLPEQYPIVGECLLKAIKDVLGDAATEEVMTAWAEAYQALAGVFI...... 248
125 2.000e-43UniRef50_A0A0P1ILU2 Nitric oxide dioxygenase n=13 Tax=Bacteria TaxID=2 RepID=A0A0P1ILU2_9RHOB  ali  26  1MDENAIQLVQDSFSKVVPIKDAAAEIFYADLFETAPRVKPYF--------------VNSDMKEQGSKLMASLATVVSGLRDLDKIVPVAEQMAVRHVDYGVKPEDYDAVGASLLRTLEKGLGEEFTPSVKDAWTGAYTTLAGVMKAAA... 134
126 2.000e-43UniRef50_H1V620 Globin n=17 Tax=Sordariomycetes TaxID=147550 RepID=H1V620_COLHI  ali  22  3LTYKQSQLVKGTIPALREHGETITSIFYANMLRAHPELHDHFNKVNQANG------------RQPRALTGVILAFAANLNHISELIPKLERMCNKHCSLGIQPEHYDIVGKYLIQAFGQVLGPAMTPEIREAWTKAYWLLAKMLI-GREAQ 140
127 2.000e-43UniRef50_UPI000833C1D2 hypothetical protein n=1 Tax=Rhizobiales bacterium CCH3-A5 TaxID=1768796 RepID=UPI000833C1D2  ali  29  1MTENDIALIRETFAHLHRRKTETARIFYDRLFEIAPEVRPLFK---------------GDIKAQGAKLMETLLVAIATLNDRPGLTILLEKLGRGHRDYHVEPRHYDNVGAALIWTLQTSLGDGFTPAVERAWTSLYADIAATMIGAAKA. 135
128 2.000e-43UniRef50_A0A1H7KTF8 Hemoglobin-like flavoprotein n=6 Tax=Proteobacteria TaxID=1224 RepID=A0A1H7KTF8_9BRAD  ali  32  1MTPQDIALVRSSFAQLHRRKIETACLFYERLFTTTPGARALFKT---------------DIETQAAKLMETLMVALATLNDPGGLKVLLNRLGERHQGYGVQPEHYDAVGSALLWTLETSLGPDFTPQTRAAWTELYELMAKTMLSAA... 133
129 2.000e-43UniRef50_A0A1E3PJ88 Nitric oxide dioxygenase n=1 Tax=Nadsonia fulvescens var. elongata DSM 6958 TaxID=857566 RepID=A0A1E3PJ88_9ASCO  ali  17  3LTSTQTEIIKSSVPFLEEKGDELAKHMYDLMFEKYPEVRPLFNKVHQKNFT------------QPKILAFALLAYAKNIDNISVLGAFVNQIVSKHVGLQILPEHYPIVAECIIQAIKDLLGDAATDDLIEAWTVAYTDLAGILIGAEEAQ 141
130 2.000e-43UniRef50_A0A258BJQ5 Flavohemoprotein n=5 Tax=Proteobacteria TaxID=1224 RepID=A0A258BJQ5_9CAUL  ali  20  6LSPETIAIVKATASVLNEHGETLTRHFYQRMFRENPEVLPLFNPSNQHSG------------GQQKALAGAICAYAANIDNLEVLGGAVELIAQKHASLLIAPEHYPIVGANLLAAIREVLGEAATDAVIGAWAEAYGFLAEILM...... 138
131 3.000e-43UniRef50_G4QHE2 Methyl-accepting chemotaxis protein n=2 Tax=Glaciecola TaxID=89404 RepID=G4QHE2_GLANF  ali  27  1MTIKQSIVVQKSWQKLKPIAPQAAKIFYETLFEMDPSLKPMFK---------------GDMVEQGNKLMSMLDAAIKLLDDPDKLIPAVQKLGERHVSYGVKPEHYSTVGAALLKTVETGLGDEYTTTVKRAWTAVYKTLADTMI...... 130
132 3.000e-43UniRef50_UPI000C6D695A neuroglobin-like n=1 Tax=Centruroides sculpturatus TaxID=218467 RepID=UPI000C6D695A  ali  26  46LTPQQIQLVRSTWSIVSQDMVGVGTIVFQRFLTRHPELCKMFRKFMTLKDDGTYDWDLEELQRHALLVMQALEAAIDNLDDSRVLAGILYDLGRRHARYNVQEQMFDKLWEALRYGLEKSLQNRMTREVNQAWFAVFKYISWQVIKGMRD. 195
133 3.000e-43UniRef50_A0A2W4SAM4 Hemin receptor n=2 Tax=Rhizobiales TaxID=356 RepID=A0A2W4SAM4_9RHIZ  ali  31  29MTDEDITLVRESFAQLHRRRNETSELFYARLFEIAPDVRPLFK---------------ADLAAQRVNLMEFLAVAMATLRDPKGLTVLLKKLGRNHRGYGVQERHYDQVGAALIWTLRTSLGAGFTPELERAWTSLYGEMANTMIAA.... 160
134 3.000e-43UniRef50_UPI000BBD572A neuroglobin-like n=5 Tax=Euteleostomi TaxID=117571 RepID=UPI000BBD572A  ali  22  24LSKEQKELIKDSWSKIQQDVTKAGIIMFVRLFENHPECKDAF--FSFRNVEDPRVQASRELRAHGLRVMSFLEKSMARIDKPERLEKLVLELGRKHYHYHSNPKYYMYLGLEFINVIKPILKDSWTSELEEAWKTLFLYLTQMMRLGYKEE 172
135 3.000e-43UniRef50_F3MBR1 Flavohemoprotein (Fragment) n=3 Tax=Bacillales TaxID=1385 RepID=F3MBR1_9BACL  ali  22  2LSQRTIEVVKSTVPVLETHGTAITSAFYQKLFHHHPELLNIFNHANQREGKQPFALANAV------------YAAAAHIDRLEAIVPVVKQIGHKHRALNILPEHYPIVGETLLGAMKDVLGDAATPEIIEAWAEAYGVIADVFI-GIEAD 139
136 3.000e-43UniRef50_UPI0004B49BE6 hemin receptor n=1 Tax=Solimonas soli TaxID=413479 RepID=UPI0004B49BE6  ali  32  1MNPSQIAMVQASWQQVLPMRRQAAALFYGRLFSLHPHLRALF---------------HSPIAEQGEKLINMIDAAIGNLDRLDQLMPVIHALGARHQGYGVQPDHYVAVGGALLWTLEQGLGAAFTAELCEAWTEVYSALAAAMLDGA... 133
137 3.000e-43UniRef50_UPI0006B0D012 globin C, coelomic-like n=2 Tax=Limulus polyphemus TaxID=6850 RepID=UPI0006B0D012  ali  27  25LTPREKQNIRKTWAIVQKNVKENGVELFIRFFDAHPDYIKLFK--PLANIPRDQLRSSKRLEAHALSVMYAITSLVDSLDDVECLKELLLKTAHNHAHRGVQGEQFDHLTIIILKFLRDGLGSSFTPPVGEAWEKAFNVMNEIIKQGLKE. 172
138 3.000e-43UniRef50_A0A2U3DXL3 Uncharacterized protein n=2 Tax=Purpureocillium lilacinum TaxID=33203 RepID=A0A2U3DXL3_9HYPO  ali  20  857LTAEQIAIVKSTAPVVKQHGRTITTTFYASMLGAHPELLNIFSVRNQHTG------------AQQAALADAVFAYAAHIDDLAALRGAVERIAHKHASLFVKPEQYAIVGEHLVGAFATVLGDALTDDVKDAWIAAYGQLADVFIQ..... 990
139 3.000e-43UniRef50_B3DUZ7 Hemoglobin-like flavoprotein n=3 Tax=Methylacidiphilum infernorum (isolate V4) TaxID=481448 RepID=B3DUZ7_METI4  ali  35  2IDQKEKELIKESWKRIEPNKNEIGLLFYANLFKEEPTVSVLFQNP---------------ISSQSRKLMQVLGILVQGIDNLEGLIPTLQDLGRRHKQYGVVDSHYPLVGDCLLKSIQEYLGQGFTEEAKAAWTKVYGIAAQVMTA..... 132
140 3.000e-43UniRef50_B0CEY8 Globin domain protein n=9 Tax=Cyanobacteria TaxID=1117 RepID=B0CEY8_ACAM1  ali  28  154....QVELLETSFAQVKPVANEFADRFYENLFTDYPAAQPLF--------------ANTDIKQQSKKLLQSLVLVVENLRKPDALGDALTGLGARHVKYGALPEHYPLVGNTLLKTFEEFLGTAWTDDVKQAWVDAYGAISTIMLDGAD.. 284
141 4.000e-43UniRef50_A0A1V3A045 Nitric oxide dioxygenase n=4 Tax=Ectothiorhodospiraceae TaxID=72276 RepID=A0A1V3A045_9GAMM  ali  20  6....TREIVKSTVPVLAEHGETITRRFYARMFEAHPELRNVFNQAHQAAG------------EQPHALARAVMAWAEHIDEPQVLEDTVRRIAHKHVSLRVTADQYAIVGEHLLGAMGEVLGEAATPEIVGAWEQAYWELARILIDAEQ.. 138
142 4.000e-43UniRef50_UPI000933B364 flavohemoprotein n=2 Tax=Cyanobacteria TaxID=1117 RepID=UPI000933B364  ali  26  4....QVECLEQSFEKVKPNADAFVTSFYDNLTTMYPEAAPLFS--------------STDMAAQKKKLLASLVLVVENLRNPDALTDALHGLGARHVKYGALPEHYPLVGNALLKTFEDYLQDDWTAEVKQAWVDAYGAIAELMLAGAD.. 134
143 4.000e-43UniRef50_A0A2H1YC60 Flavohemoprotein n=12 Tax=Bacteroidetes TaxID=976 RepID=A0A2H1YC60_9FLAO  ali  18  3.SKKTIEIVKSTVPVLEVHGEAITKVFYRLLFENHPELKDIFNMTNQKKGN------------QQIALASAVFKYAQHIDKLEMLGGMVNTIAQKHVSLSIPKEAYPIVGENLLAAIKEVLGDAATPEIIDAWAEAYGDLAAIFVGKEEA. 139
144 4.000e-43UniRef50_A0A2W2KUB6 Uncharacterized protein n=1 Tax=Streptomyces sp. NTH33 TaxID=1735453 RepID=A0A2W2KUB6_9ACTN  ali  28  38MTA-DLSLIRSSFAAVQPHGSQVTAYFYDHLFAHHPGVRPLF---------------ATHLDEQRDRLWAALGALVVNLENTDTLTGMLQNLGRRHAGYGALAEHYPAVGASLIATLRHYAGDAWTPAAEESWAAVYDVISSTMIEAGKA. 171
145 4.000e-43UniRef50_F8I6Y7 Nitric oxide dioxygenase n=1 Tax=Sulfobacillus acidophilus (strain TPY) TaxID=1051632 RepID=F8I6Y7_SULAT  ali  24  26.DQNTIDKVKATVPLLKGRAEELGTRFYRHLFAEYPELQNVFNHAHQATL------------KQPRALAESVLGAAENLDNATYLRDAIQTIAHKHRSLEVKPDHYPIVGRVLLQTLAESLGPAATPDTITAWATAYEFIADVFIQAESA. 162
146 4.000e-43UniRef50_A9GV91 Probable bacterial hemoglobin n=2 Tax=Sorangium cellulosum TaxID=56 RepID=A9GV91_SORC5  ali  30  72LSQRTIELVQWSWAKVMPISDAAAALFYERLFTLEPSVRPLFKN---------------DIAEQKKKLMQTLSVAVDGLNNLPKLVPVLQALGVRHQGYMVVDRHYDVVGEALLWTLREGLGDSFSADVESAWKEVYGVVSDVMKK..... 202
147 5.000e-43UniRef50_A0A177W3W1 Flavohemoprotein n=4 Tax=Piscirickettsiaceae TaxID=135616 RepID=A0A177W3W1_9GAMM  ali  16  2LSEHTKTIVKATAPVMKEHGLTITLRMYDIMFARYPKTKTLFNQTHQEN------------KQQPRALANSIYAYAANIDNLDALGDAVELIAHKHASLNILPEHYDIVAECLIQAVKDILKEAATTEIITAWTEAYTFLANVFINREEE. 139
148 5.000e-43UniRef50_A0A2P8VSJ7 Globin n=1 Tax=filamentous cyanobacterium CCP5 TaxID=2107701 RepID=A0A2P8VSJ7_9CYAN  ali  29  167.....IALLEQSFEKVKPQANEFVGSFYENLFTDYPAAKPLFTHTN--------------MKEQGNKLLMSLVFVIDNLRKPGELTNALKGLGARHVKYGALPDHYPLVGNSLLKTFEQYLGSDWTPETKAAWVDAYGLITEVMLDGAD.. 296
149 7.000e-43UniRef50_K1R7G1 Neuroglobin-1 n=8 Tax=Mollusca TaxID=6447 RepID=K1R7G1_CRAGI  ali  23  53LTERQKELIMQSWQKIQEDMSKVGVVMFMRLFETHPDVQDVF--MPFKGLSQDDLRHSSQLREHALRVMGTVEKCLARINEPKKMEEMLHDLGTRHVMYSAKVDYVDLIGPQFIWAMQPALEDQWNTELEEAWSDLFKMMTHVMKNAMQ.. 199
150 7.000e-43UniRef50_A0A0L0N5X4 Flavohemoprotein n=1 Tax=Tolypocladium ophioglossoides CBS 100239 TaxID=1163406 RepID=A0A0L0N5X4_9HYPO  ali  20  3LTAKQIAIVKSTAPVVKEHGQTITRLFYKDMLAAHPELKNYFSLRNQQIG------------AQQAALADAVFAYATHIDDLPRLGAAVERIAQKHASLFIKPEQYPIVGKFLIGAFAKVLGGALTPEIKDAWVAAYGQLADVFIQ..... 136
151 7.000e-43UniRef50_UPI00040E3AFA NO-inducible flavohemoprotein n=1 Tax=Bacillus aurantiacus TaxID=254410 RepID=UPI00040E3AFA  ali  20  6LSTQSKEIVKASAPILQEHGEKVTQTFYHNLFQAHPELLNIFNETHQKKG------------KQPMALANTLYAAAVNIERLEELLPAVKQIAHKHRSLNVLPEHYPIVGKYLLEAMREVLGE--SPEVIQAWAEAYGIIADIFINVEKE. 144
152 7.000e-43UniRef50_A0A2G7DQ60 Hemoglobin-like flavoprotein n=9 Tax=Streptomycetaceae TaxID=2062 RepID=A0A2G7DQ60_9ACTN  ali  32  28.......LIKTSFAVVEPHGSEVTAYFYTHLFEHNPDVRKLF---------------AEHMNEQQDRLWAAIGTLVNKLEDTDTVVNVLQGLGRRHAGYGALPEHFPAVGASLLASLAHFAGDAWTPEIEAAWTALYGVVTDVMSAALTE. 155
153 8.000e-43UniRef50_A0A128FGE6 Flavohemoprotein n=25 Tax=Bacteria TaxID=2 RepID=A0A128FGE6_9GAMM  ali  33  3LKQQQITLIQTSFNKVEPISVKAAEIFYDTLFSYDPTLKSLFK---------------GDMKQQGRKLMAMLSAAVKGLNDLESLFPVLHELAQRHEGYGVKKSHFTPVGNALLHTLKVGLGDDFTPEVRAAWVTLLHIVADTMKSKMAA. 137
154 8.000e-43UniRef50_M7XWG2 Uncharacterized protein n=6 Tax=Methylobacterium TaxID=407 RepID=M7XWG2_9RHIZ  ali  30  704ISATQVERVQASFAKVRPIADTAADLFYERLFAIAPQVRPLFP---------------ADMTVQKRKLMAMLALAVANLDKPEALVSAVTDLGLRHRGYGTHEAHYEAVGAALLWTLEQGLGADFTPEIREAWAETYGVVAGLMRSAATAE 839
155 8.000e-43UniRef50_UPI000852A369 hypothetical protein n=2 Tax=Thermogemmatispora TaxID=768669 RepID=UPI000852A369  ali  28  5.......LLKESFGLIAPQKEAFARQFYERLFATYPQTRPLF--------------ANTDMRRQESALMATLAAVVAGVERGENLVPVLHKLGERHYRYGVQPEHYPLVGQALIATFVDFLGPRFTPAMQDAWVQAFEVISSQMIAAGE.. 132
156 9.000e-43UniRef50_A0A1W1HMZ7 Globin-coupled methyl-accepting chemotaxis protein (Modular protein) n=2 Tax=Nitrospira sp. ND1 TaxID=1658518 RepID=A0A1W1HMZ7_9B  ali  30  5.....VELLESSFKLVAPKGDALVTRFYERLFKKYPSVKPLFKKT--------------SIKEQKKKLLASLVLVIQNLRRPDKLTSVLQDMGARHVGYGVKPAHYDAVGENLLAVLGEVAGPAWTPQVKQAWTEAYGAIKTIMLAGAE.. 134
157 9.000e-43UniRef50_A0A2C5XD19 Uncharacterized protein n=4 Tax=Hypocreales TaxID=5125 RepID=A0A2C5XD19_9HYPO  ali  20  3LTAHQVALVKSTAPVIKEHGKTITSYFYKTLLAEHPELKNMFSLRHQQVG------------AQQQALADAVFGYAAYIDDLDKLSAAVERIAHKHASLYVRPEHYPIVGEYLVRAFEQVLGAALTPEIKEAWVAAYGQLADVFI-GREKQ 140
158 1.000e-42UniRef50_A0A139X0Z2 Globin domain protein n=1 Tax=Scytonema hofmannii PCC 7110 TaxID=128403 RepID=A0A139X0Z2_9CYAN  ali  30  683MSMSKVDLVQSTFAKVQPIADTVAELFYQRLFELSPSLRPLFK---------------GSMEDQQRKLMSTLAIAVEGLRQPQAIIKAVQQLGKRHADYGVMAQYYDVVGEALLWTLEQGLGEAFTPQVRRAWEEAYKFLSEIMKDAAAQ. 817
159 1.000e-42UniRef50_UPI000DABA6F9 NO-inducible flavohemoprotein n=1 Tax=Thermosporothrix hazakensis TaxID=644383 RepID=UPI000DABA6F9  ali  20  6...EEIQLVASLVPVLKAHGSEITTRFYNMMFTAHPELLNIFNHSNQRDG------------LQQQALASSVYAAAAHIDNLDAIEPVVQHIAHKHCSLNVQPEHYPIVGKYLTLALKDVLGNAVTPEVERVWLKAYDVIADYFIR-MEQD 140
160 1.000e-42UniRef50_D4XB67 Flavohemoprotein n=45 Tax=cellular organisms TaxID=131567 RepID=D4XB67_9BURK  ali  19  2LSPEVRALVKATAPVLKTHGVALTRHFYARMFEHNPELKHVFNQGHQGGGQQQH------------ALAGAVTAYAEHIDDPSVLAPVVTRIVHKHVSLGIRAEHYAIVGKHLLASIREVLGEAATDELVDAWAAAYGQLADLLIA..... 135
161 1.000e-42UniRef50_A0A1A8T8H1 Flavohemoprotein n=16 Tax=Bacteria TaxID=2 RepID=A0A1A8T8H1_9GAMM  ali  19  2LSQTHIDTVKATIPVLASAGTAITEHFYNRMFTHNPELKDVFNMSHQATG------------RQPAALFNAIAAYATHIDNLEVLTGAVMRIAHKHTSFNIQADQYAIVGHHLIETLRELLGEAFTPAIEEAWGAAYQQLADIFIK..... 135
162 1.000e-42UniRef50_A0A2G3JEF9 Hemin receptor n=1 Tax=Iodobacter sp. BJB302 TaxID=1506510 RepID=A0A2G3JEF9_9NEIS  ali  25  3LSDKDISLVKETLALVLPIADTAAEMFYQHLFEIAPEVKPLFK---------------GDIKKQGAMLMTSIKLAVDNINKPEILLPAIQKLGERHAHYHVQEEHYTTVGQALLWTLEQGLADAFTSDVKSAWAATYTTLACEMIKA.... 134
163 1.000e-42UniRef50_UPI0008326626 hemin receptor n=1 Tax=Pseudoruegeria sabulilitoris TaxID=1510458 RepID=UPI0008326626  ali  28  1MNQSQITLIQQSYAKLVPSKQQAGEIFYAKLFEIAPEVRPLFK---------------ENVTEQAGKLMTMLGTVVNGLRDLHKVTPIARKMAVEHVGYGVKPAHYEPVGAALIATLEAGLGEDFTLETREAWVEAYSILSTAMIDAAKAQ 136
164 1.000e-42UniRef50_A0A2N6NCZ4 Flavohemoprotein n=11 Tax=Sordariomycetes TaxID=147550 RepID=A0A2N6NCZ4_BEABA  ali  16  42.TQSQIDIVKSTAAILKDQGDRITRIFYVNMLTAHPELKNYFSLRNQATG------------AQQAALGASVLAYASYIDDLPRLTSAVERIAHKHASLFVRPEQYAIVGEHLVGAFAEVLGDALTPEVADAWKAAYAQLADVFI...... 173
165 1.000e-42UniRef50_A0A1E3H4Z3 Bacterial hemoglobin n=1 Tax=Methylobrevis pamukkalensis TaxID=1439726 RepID=A0A1E3H4Z3_9RHIZ  ali  30  1MTPEEIRLVQDSFREIQPSVGVVANVFYAHLFSMTPALRPLFPH---------------DMSGQKIKLMKMIEAAVDNLHHFDLMRPTIRSLGARHVGYGVRDEHYDLVGAALLHTVAAALGDGWTTDIEDAWLEVYGRVAGEMKDAAAA. 135
166 1.000e-42UniRef50_A0A1C3SHN7 Flavohemoprotein n=35 Tax=Bacilli TaxID=91061 RepID=A0A1C3SHN7_9BACI  ali  25  2LDKETIQIVKSTAPILKEHSQEIGKRFYELLFSKVPELHNMFNQTNQKRGI------------QQEALAYAVYAAGENIDHLEALEPVIKRITEKHRAIGVKPEQYPIVGETLLAAVKDVLGDAATEEVLEAWKKAYGEIAKAFI...... 134
167 1.000e-42UniRef50_A0A0H4KKN4 Flavohemoprotein n=21 Tax=Bacteria TaxID=2 RepID=A0A0H4KKN4_9BACI  ali  26  2LDPKTIEIVQSTVPVLKEHSKEIGKRFYELLFAKEPDLYNMFNQTNQKRGI------------QQEALGYAVYAAGEHITNLEAIKPVIERISQKHRAIGVKAEQYPVVGETLLQAVKDVLGDAATDEIIEAWGKAYGYIADAFI...... 134
168 1.000e-42UniRef50_A5DQY8 Uncharacterized protein n=2 Tax=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324  ali  20  14LSPEQVNIVKASVPILKASGQELTKNFYQKMLSSYPEVKPFFNESDQKSL------------RQPKILAFALLKYAENIENLEPLTGFVQQIVTKHVGLQVKPEHYPIVGTCLLNTMENMLGELATPEFLQAWATAYGNLARLLINAED.. 150
169 1.000e-42UniRef50_A0A1S2VJ89 Hemoglobin n=4 Tax=Bacteria TaxID=2 RepID=A0A1S2VJ89_9BACT  ali  32  1MTGEQIQLVKTTWRLLREDPVLLGDVFYGRLFIDNPALQSLFKSP---------------MDEQYKKLIDTISVVVARLENLPELIPDIQALAQRHVQYGVKPEQYDLVGAALLWTLEKGLGRDWTPAAAEAWSRCYHTLAQTMI...... 131
170 1.000e-42UniRef50_B4WU25 Globin domain protein n=1 Tax=Synechococcus sp. (strain ATCC 29403 / PCC 7335) TaxID=91464 RepID=B4WU25_SYNS7  ali  27  716...RQVELVQRSFAKVEPISEQVGKLFYEHLFETRPDFKPLFS--------------STDMETQQRKLMMTLATAVEGLRHPEEIISKVQALGRSHQGYGVKAEDYEAIGATLLWTLKEKLGDDFTPEVKRAWEVAFQFLSKIMINAAAQ. 848
171 1.000e-42UniRef50_A0A1X6PD63 Uncharacterized protein n=1 Tax=Porphyra umbilicalis TaxID=2786 RepID=A0A1X6PD63_PORUM  ali  19  4LSDDTVRIVKSTAPVLKVHGGAIVDGFYALLFEQHPAAAAYFNVVPTXXXXXXXXXXXXXSKAQIQRLSMAVLLYAESIDQLDTLGPVLERISAKHASRGIPAEFYPAVGACLLQSIGRVLGDAATPEIVGAWGEAYGFLADALMA..... 149
172 1.000e-42UniRef50_D3SCW1 Flavohemoprotein n=28 Tax=Proteobacteria TaxID=1224 RepID=D3SCW1_THISK  ali  16  2LSDDHKAIIQKTVPILESGGEDLTRHFYSIMFRDYPEVRPLFNQAHQASGQ------------QARALANAVLQYARHIDEMEALGPLVGQIVNKHVSLQVQPEHYPIVGECLLRAMRELLGEEATDAVLEAWGAAYQQLADILIAAEED. 140
173 1.000e-42UniRef50_A0A2D1U1Z3 NO-inducible flavohemoprotein n=1 Tax=Pedobacter ginsengisoli TaxID=363852 RepID=A0A2D1U1Z3_9SPHI  ali  20  1MNIKQEQLISATVPVLRENGVLLTTHFYNRMFTHNPELKNMFNMGNQESG------------KQQTALAMAVLAYAENIANPGVLMPVVDRIGHKHVSLDIRPEHYQIVGRHLIASIQEVLGAAATPDILEAWTVAYQQLATLM....... 132
174 1.000e-42UniRef50_A0A0U3MPE4 Hemin receptor n=3 Tax=Pannonibacter TaxID=227873 RepID=A0A0U3MPE4_9RHOB  ali  27  1MTPEQIQLVQASFDRLRPQGTAVISGFYGRLFELSPSLRPLFRTS---------------LPAQEQRLLEALSAVVSMLSNLQMLLPELEALAKRHVTYGVSAAHYQAAGDALLWTLESHLGEAFTPEVRSAWMAAYATLSDIMIASAE.. 134
175 1.000e-42UniRef50_A0A1V5NS93 Flavohemoprotein n=1 Tax=Bacteroidetes bacterium ADurb.Bin397 TaxID=1852812 RepID=A0A1V5NS93_9BACT  ali  27  2LTAKQIELVQNTWSTITPVSQQMGESFYSRLFQNHPELKPMFKSDP---------------KDQAMKLMFMISYLVHRLGSFDDLKDEIIKLASRHTGYGTKKEHYGAVGDALLATLKESLGKSWTPETEAAWTDTYMLIAGLMQQA.... 133
176 2.000e-42UniRef50_UPI0006B09B77 neuroglobin-like n=2 Tax=Chelicerata TaxID=6843 RepID=UPI0006B09B77  ali  21  39LTSNQIALLTNTWKLLVENISRVGVIAFMNLFETHPDVQEVF--LPFKGLSQNELRYNKELRAHALRVMGFVQKVMARLNEEEKMDQLLADLGRKHIYYGAKPEYIDWIGPQFVNAIRPSLEAHWTAEIEEAWCQLFRYVAWVMKTAMMEQ 187
177 2.000e-42UniRef50_UPI0009DE34DE hypothetical protein n=1 Tax=Thermogemmatispora carboxidivorans TaxID=1382306 RepID=UPI0009DE34DE  ali  28  44.......LLKESFGLIAPQKEAFARQFYERLFATYPQTRPLF--------------ANTDMRRQEGALMATLAAVVAGVERGENLGPVLHKLGERHYRYGVQPEHYPLVGQALIATFVDFLGPRFTPAMQDAWVQAFEVISSQMIAAGE.. 171
178 2.000e-42UniRef50_A0A2A5HE23 Flavohemoprotein n=1 Tax=Alteromonadaceae bacterium TaxID=1916082 RepID=A0A2A5HE23_9ALTE  ali  23  10........IKASVPVLREHGLTITTLFYKNMFAAHPELKHLFSRSSQAGG------------AQQQALAGAVYAYADNIEKPEFLSSVLNRIAHKHASLGIKPAQYTIVGKYLLGAIAQTLGDGATPELLDAWDEAYWLLAGELI-AMEA. 138
179 2.000e-42UniRef50_A0A1H0PYW0 NAD(P)H-flavin reductase n=6 Tax=Pseudonocardiaceae TaxID=2070 RepID=A0A1H0PYW0_9PSEU  ali  25  27.....VRLVRESFAVVEPHAEEVAQFFYGMLFTIEPSAREMFP---------------ANMQVQRSRLLRALVHVVQMVDRPDDLVPFLQQLGRDHRKFGVVSTHYEAVGMALISSVKKFAGPAWTDEVERAWAEAYTIMARSMLDAAAAD 157
180 2.000e-42UniRef50_A0A250IQZ8 Nitric oxide dioxygenase n=2 Tax=Melittangium TaxID=44 RepID=A0A250IQZ8_9DELT  ali  21  6LAPRTIEIIQSTVPVLKVHGEAITTRFYQRLFESHPELRDVFNQARQREGKQQAALANAVYAA------------AQNIERLEAILPAVRNIAHKHRALGVVPEHYPIVGQHLLAAIKEVLGDAATGEILGAWAEAYQEIASVFISVERE. 143
181 2.000e-42UniRef50_A0A1I3T1A6 Hemoglobin-like flavoprotein n=3 Tax=Rhizobiales TaxID=356 RepID=A0A1I3T1A6_9BRAD  ali  33  4..DDDVQRIRESFAHLHRRKAETGEIFYNRLFEIAPEVRPLFK---------------GDMKAQSVKLMEMLTVAIATLNDREGLAILLRKLGREHKGYGVKDSHYDRVGEALIWTLRTSLGDAFTPRLEQAWTQLYTDIADVMIAA.... 133
182 2.000e-42UniRef50_Q6WZ20 Neuroglobin n=9 Tax=Cercopithecinae TaxID=9528 RepID=NGB_MACMU  ali  99  7......ELIRQSWRAVSRSPLEHGTVLFARLFALEPDLLPLFQYNCRQFSSPEDCLSSPEFLDHIRKVMLVIDAAVTNVEDLSSLEEYLASLGRKHRAVGVKLSSFSTVGESLLYMLEKCLGPAFTPATRAAWSQLYGAVVQAMSRGWDSE 151
183 2.000e-42UniRef50_A0A0F7D450 Flavohemoprotein n=24 Tax=Staphylococcaceae TaxID=90964 RepID=A0A0F7D450_9STAP  ali  25  7.....KQIIKETVPVLEEHGTEITTVFYKRMFEAHPELLDIFNKTNQKVGD------------QPKALAMTVLAAARHIEDIETIVPAVMGIAHKHRALDVKPEHYPIVGKYLLEGIREVLGEAATPEIIDAWGEYYGKIADVFI...... 134
184 2.000e-42UniRef50_A0A2A4VZ60 Methyl-accepting chemotaxis protein n=23 Tax=Gammaproteobacteria TaxID=1236 RepID=A0A2A4VZ60_9GAMM  ali  30  1MTPKQITLVQESWQKVLPIAPQAAENFYNTLFELDPSLKPLFK---------------SNIVDQGNKLMTMLDTAVKLLNSPDKLIPAVQKLGARHLDYGVKTQHYDTVGKALLNTLETGLGDEFTTPVKRAWTAIYKVLSKTMIDAANA. 135
185 2.000e-42UniRef50_A0A0S7DZ55 Flavohemoprotein n=17 Tax=Aspergillus TaxID=5052 RepID=A0A0S7DZ55_9EURO  ali  20  166...DTIQIIKATVPVLTEHGTTITTVFYKNMLTAHPELNNVFNTAHQVSG------------HQARALAGALFAYASNIDNLGALGPAVELICHKHASLYIKPDDYKIVGKFLLEAMGQVLGDALTPEILDAWATAYWQLADLMI-GREAQ 300
186 2.000e-42UniRef50_I3KRJ1 Uncharacterized protein n=11 Tax=Percomorphaceae TaxID=1489872 RepID=I3KRJ1_ORENI  ali  22  27LSAESREAIRSSWKEIQEDISRVGVIMFVRLFETHPECKDAF-FAFRDLNDVNALRASKELKAHGLRIMYIIEKTVARIDQDDRLDQLILDLGRKHYQYKALPKYYDLMGEEFIQAIHPVLQERWTSDLEEAWKTLFLYITRTMKKGYQQ. 175
187 2.000e-42UniRef50_F8ELZ1 Globin n=3 Tax=Runella TaxID=105 RepID=F8ELZ1_RUNSL  ali  27  1MDDQQKKLVQTSFARVVPKAEYAAQLFYKRFFELAPEVESLFN---------------SELKTQGIKLFQVISFTVCSLDNMDELLPLLQDLGRQHVKYGAEEHHYGYVGEALLWTLEKVLKEDFTPEIQQAWTDVFRVMSDTMIEAAHQQ 136
188 3.000e-42UniRef50_A0A0C1N7H3 Flavohemoprotein n=27 Tax=Cyanobacteria TaxID=1117 RepID=A0A0C1N7H3_9CYAN  ali  26  5.....VELLEQSFAQIKPRAEDFVASFYENLFASHPEAKPLF--------------ANTNMVEQRQHLLAALVLVVQNLRKPEVLEEALKKLGAKHISYGTAPEHYPLVGQALLTTFEQYLQQDWTSEVEQAWTDAFGAITALMLKGAEE. 135
189 3.000e-42UniRef50_UPI0003776242 hypothetical protein n=1 Tax=Methyloferula stellata TaxID=876270 RepID=UPI0003776242  ali  25  1MTPAEVDMVKTTFVQILPQADEFGPKFYERLFSLDPTLKEMFK---------------EDMAVQSKKLVRMLATLVAGLQSLETVVPTLEALAIRHVGYGVRDEHYNVIGQSLIWTLEQQLGEAFTPEVRNAWIATYVLIAETMKAAARD. 135
190 3.000e-42UniRef50_Q9NPG2 Neuroglobin n=125 Tax=Amniota TaxID=32524 RepID=NGB_HUMAN  ali  100  7......ELIRQSWRAVSRSPLEHGTVLFARLFALEPDLLPLFQYNCRQFSSPEDCLSSPEFLDHIRKVMLVIDAAVTNVEDLSSLEEYLASLGRKHRAVGVKLSSFSTVGESLLYMLEKCLGPAFTPATRAAWSQLYGAVVQAMSRGWDGE 151
191 3.000e-42UniRef50_A0A1J5KJN2 Uncharacterized protein n=1 Tax=Bacteriovorax sp. MedPE-SWde TaxID=1860085 RepID=A0A1J5KJN2_9PROT  ali  23  4....DIKIIRDSFAQAKPIADQVADKFYEFLFADYPAAQPLF--------------ENVNMAKQKKQLMGGLSHIVDSLDKPEELTKYLKSSGQRHVKYGTKEEHYPLVGNTLIKTFAHFFGDAWTPELQQQWLWAYEFIANTMIEGAKE. 135
192 3.000e-42UniRef50_A0A177QZV1 Hemin receptor n=1 Tax=Betaproteobacteria bacterium SCGC AG-212-J23 TaxID=1799662 RepID=A0A177QZV1_9PROT  ali  32  1MTPEQIDLVQRTWRAVLPVGDTAAELFYGKLFSLDPEVRRLFKN---------------DMVDQGRNLTAMISVAVGALAKPERIRLAVRQLGERHAAYGVERRHFELVGVALIWTLEKCLGEAFTPDVKDAWRATYVFLTEAMLIGA... 133
193 3.000e-42UniRef50_A0A2N3UWU4 NAD(P)H-flavin reductase n=4 Tax=Actinobacteria TaxID=201174 RepID=A0A2N3UWU4_9ACTN  ali  28  1MTEDQLTLIRSSFALLRDHGDKLAAHFYATLFLHNPQLRELFP---------------AAMDVQRDRLFQALAGAVRMLDRPAELTVFLQQLGRDHRKYGVRSEHYAAVGQALLATLARFAGPQWTPAHERAWTIAYHQIAATMSGAAETE 137
194 3.000e-42UniRef50_A0A1Y2RB33 Hemoglobin n=1 Tax=Chitinophagaceae bacterium IBVUCB2 TaxID=1985174 RepID=A0A1Y2RB33_9BACT  ali  26  2MTTEQTILVKTSWRMIRDDPAIVGDTFYSKLFCDTPALRKMFPKN---------------MDEQYRKLMDMLSTVAARLDNLNDLTEDILSMAQRHVQYGVRPAHYKLVGKALLWTLQQGLGKDWTEEVKVAWTTCYSTLADTMIAA.... 134
195 3.000e-42UniRef50_U7Q638 Uncharacterized protein n=4 Tax=Sporothrix TaxID=29907 RepID=U7Q638_SPOS1  ali  17  31.TPEQISIVKATAPVLKEHGVTITTVFYENMLKENPELKNVFSLTSQATG------------AQPRALAAAVLGYAMFIDDLPRLHHAVERIAHKHASLQIQPDQYDIVGKYLIQAIGQVLGDAATPSIVDAWTAAYGVLADVFI...... 162
196 3.000e-42UniRef50_A5EIC9 Putative globin-like protein n=6 Tax=Bradyrhizobiaceae TaxID=41294 RepID=A5EIC9_BRASB  ali  27  2LTAEEIACVRSSFDMVFANATDMTTTFYQRLFELAPECRSMFPDNMDVLKRD---------------FIATLAVLVGSLDRMTGLLSSTDILGRNHARYGVRPEHYPLVGEALLWSLAKGLGPQWTAEVEQAWRKVYEIISQRMIA..... 132
197 3.000e-42UniRef50_UPI000BA7EB78 cytoglobin-2-like n=1 Tax=Limulus polyphemus TaxID=6850 RepID=UPI000BA7EB78  ali  22  41LTRNQRAILTNTSKLLVENISRVGVITFMNLFETHPDVQEVF--MPFKGLSGNDLRYSRELRAHAFRVMGVVQKVITRLNEEEKLDQLLTDLGKKHARYGAKPQYIDLIGPQFVHAIKPSLEDHWTTEMEEAWCQLFRYIAWVMKAAM... 186
198 4.000e-42UniRef50_I8IYL2 Bifunctional nitric oxide dioxygenase/dihydropteridine reductase 2 n=2 Tax=Fictibacillus TaxID=1329200 RepID=I8IYL2_9BACI  ali  20  2LTQETMKVIKATAPVLQEHGVAITTVFYEELFREHPELRNVFNQSNQAQG------------RQQVALAQILYQAALHIEQLETLLPAVRQVGEKHRSLGVVPEHYPIVGKHLLLAMKAVLKEAATDEILEAWETAYEVIASLFIE..... 135
199 4.000e-42UniRef50_K9SG59 Globin n=2 Tax=Cyanobacteria TaxID=1117 RepID=K9SG59_9CYAN  ali  26  5.....VKLLEDSFDRIKPKARAFSASFYHNLFEMYPVAKPLF--------------ANTDMIAQREKLIKSLVLVTSNLRSPDVLTETLAGLGSRHVEYGALPEHYPLVGNALLATFEEYLGTAWTEEVKQAWVEAYAAITELMLEGAD.. 134
200 4.000e-42UniRef50_A0A285EXK6 Ferredoxin-NADP reductase n=4 Tax=Micromonosporaceae TaxID=28056 RepID=A0A285EXK6_9ACTN  ali  24  1.......MLKESWSLIEEHQEKVAGYFYARMFLSHPELRDLFPV---------------HMDMQRSRLLGAIVTAVQTLEDPEKFDSYLRGLGRDHRKFHVEPEHYEVVGGALIEAMRQYAGESWSVEYDQAWADAYAVIASKMLSGAEAD 129
201 4.000e-42UniRef50_A0A1V9ZMC5 Nitric oxide dioxygenase (Pi-NOD1) n=5 Tax=Saprolegniaceae TaxID=4764 RepID=A0A1V9ZMC5_9STRA  ali  17  26LSAKTIDIIKATSPVVAEHGYAITTTMYGTMLTSDASVRALFNPSHQKVLPGENQ------ARQPSALAHAVSAYAANIDNLGVLTAAVERIAQKHVSLYILPEHYDIVGSHLLRAIKTVLGDAATPEIVQAWAEAYGFLAEILIERERE. 169
202 4.000e-42UniRef50_A0A0X8GKV9 Uncharacterized protein n=1 Tax=Janthinobacterium sp. B9-8 TaxID=1236179 RepID=A0A0X8GKV9_9BURK  ali  25  3LTDKDIALVRETLALVLPIADAAAEMFYQHLFEIAPEVRPLFK---------------GDIKKQGAMLMSSIKLAVDNINKPEVLLPTIQKLGERHAKYAVQEEHYTTVGHALLWTLEQGLADAFTDDVKKAWAATYTTLACEMIKAQRA. 137
203 4.000e-42UniRef50_Q6CB74 YALI0C21362p n=2 Tax=Yarrowia lipolytica TaxID=4952 RepID=Q6CB74_YARLI  ali  16  2LTDAQIKIIKDSAPFLAENGTDFAAKMYKYMFATYPEVIRFFNQSDQKNL------------AQPKILAHALVAYASNIDNLGVLSDFVEQIVVKHVGLQIQPEQYPIVAASIIHTLKEMLGEAATPEFIEAWTVAYTQLANILIDAEK.. 138
204 4.000e-42UniRef50_D8PFN9 Globin-coupled methyl-accepting chemotaxis protein (Modular protein) n=4 Tax=Nitrospira TaxID=203693 RepID=D8PFN9_9BACT  ali  27  4....HIELLESSFKLVAPQGDALVTRFYERLFEKYPAVKPLFK--------------NASISEQKKKLLASLVLVIQNLRHPEKLTPVLQDMGARHVGYGAKPAYYDAVGENLLAVLGEFAGEAWTPEVKQAWTDAYAAIKTIMLEGAK.. 134
205 4.000e-42UniRef50_A0A2G1WCW5 Flavohemoprotein n=1 Tax=Rhodopirellula bahusiensis TaxID=2014065 RepID=A0A2G1WCW5_9PLAN  ali  18  2LSENTIRVVKEITPVVAANAETITRRFYERMFEVNPEVKVFFNQSHQHTG------------GQQKALAGAICAYFTHIDNPAVLLPAVELIAQKHCSLGIKAEHYPIVGANLLAAIQDVMGDAATDEIMDAVEEAYGFLADIFI-GRENE 139
206 5.000e-42UniRef50_B3RYV6 Uncharacterized protein n=1 Tax=Trichoplax adhaerens TaxID=10228 RepID=B3RYV6_TRIAD  ali  29  17LTEEQKAIIRENWQDVEENMSEVGLYLFSKLFTIAPEYREVFPF--------ETTTDNVRLRVHATGVMKTVGKAVQNLDQFSELQSALSTLGQFHHRKAIKFENFQAVGQALIQTLSDKLQENFTPEVHEAWSKTFDMITAAMKSGMN.. 157
207 5.000e-42UniRef50_N6V4P8 Flavohemoprotein n=256 Tax=Bacteria TaxID=2 RepID=N6V4P8_9RHIZ  ali  19  5LSAATKAIVRATVPALAAHGTEITAAMYLLLFKDE-EVRNLFNQSHQGEGG-----------GQAKALAQAILAYAQNIDNLAVLGPAVERIAQKHVGLQIQEHHYPHVANALLAAIKQVLGDAATDEVLAAWGEAYWFLADILI-GREKQ 142
208 5.000e-42UniRef50_A0A1A9NPZ4 Hemin receptor n=3 Tax=Methylophilaceae TaxID=32011 RepID=A0A1A9NPZ4_9PROT  ali  25  1MTPQQISVVKKTWALAEPLGDTVTVLFYGRLFELDPSLRSLFRK---------------DMQEQGRSLRTMIGMVVGGLDDPDKLAGALAASGRRHVTYRVENRHYDTVREALLWTLNQALREIYTAEVRDAWIATYNMMADTMKAAAAE. 135
209 5.000e-42UniRef50_A0A076P2E8 Flavohemoprotein n=66 Tax=Bacteroidetes TaxID=976 RepID=A0A076P2E8_FLAPS  ali  20  10MTSTQKDLIKATIPILKSNGEDLVKYFYNRMFIHNPELKNLFNMGNQSSG------------KQQSALTGAVLAYAENIDNPTVLINTLKLIGNKHVSLQVTAKQYDIVGNHLIASIKEVLGAEATEELLHAWTIAYTQLAQIMID..... 144
210 5.000e-42UniRef50_A0A2K9UYP1 Globin-like protein n=3 Tax=Actiniaria TaxID=6103 RepID=A0A2K9UYP1_ACTTE  ali  33  49LDPASIKLIRESWSEVEKDLQETGLVVFRRLFEIAPYLRDLFPFGYNPDG--------KDLKAHALGVMSTVGVAVRGLDDLESLKPKLVELGALHKGFEITDKEFKHVGEAIIWTLDKGLGDQFTPEVKAAWVEAYGLITTTMKEGLK.. 190
211 5.000e-42UniRef50_R7QRC5 Uncharacterized protein n=2 Tax=Rhodymeniophycidae TaxID=2045261 RepID=R7QRC5_CHOCR  ali  17  7.TPETIAIVKSTVPILRENLTEVITRFYENLFSTYPELKKQFNMDRHRGGTVKEENGIPK---QVAALGGAVISYAKNIDRVEALLPVVERISHKHVSRGVSAAQYDKIGECLLRAMKDILEEAITEDIHNAWAEAYGFLASVFI...... 147
212 5.000e-42UniRef50_F2Q9W9 Globin n=3 Tax=Branchiostoma TaxID=7737 RepID=F2Q9W9_BRAFL  ali  31  29LTQEQVHGIKETWAILAQDPVERGVGLFMKIFEEDPDLKKLF---YFADDGRELSRDDQRVRSHGERVMEAVGGAVDSQGDLTAVVPVLTELGALHHKYGVQPSYFDTVGAALIYILETNLGDKLTPSIRQGWVLVYGIVGATMKKGMQQ. 175
213 6.000e-42UniRef50_H8Z1I5 Hemoglobin-like flavoprotein n=2 Tax=Chromatiaceae TaxID=1046 RepID=H8Z1I5_9GAMM  ali  29  1MTSDDIALVRTSWAQLQPQAEQVGAALYQRMFNDHPELRRLFK---------------GEMDEQAHKLMRMVNRTVDTLDDLTSLNRVIIMMGARHSGYGVEDEDYPKMRNALVATLDTHLGSEFTPETRSAWISVYGELAELMMEGAA.. 134
214 6.000e-42UniRef50_C7PYV8 Oxidoreductase FAD/NAD(P)-binding domain protein n=3 Tax=Catenulisporales TaxID=414714 RepID=C7PYV8_CATAD  ali  32  5.......LLRTSWAKVAQYGEQVPLFFYGHLFLSHPEVRAMFP---------------PSMAAQRDRLVAALGAVVANVDNLDSAVPFLQGLGRDHRKFAVEPGHYPAVGASLLATLEQFLGPDWTPAVAESWTEAYGIVAKVMTDAAAA. 132
215 6.000e-42UniRef50_UPI00024838DF globin domain-containing protein n=1 Tax=Acaryochloris sp. CCMEE 5410 TaxID=310037 RepID=UPI00024838DF  ali  28  154....QVELLETSFAQVKPVANEFADRFYENLFTDYPAAQPLF--------------ANTDIKQQSKKLLQSLVLVVENLRKPDALGDALTGLGARHVQYGALPEHYPLVGNTLLKTFGQFLGPAWTDEVQQAWVDAYGAISTIMLDGAD.. 284
216 7.000e-42UniRef50_G2XJ88 Hemoglobin n=2 Tax=Verticillium dahliae TaxID=27337 RepID=G2XJ88_VERDV  ali  18  3ITEAQTAIVKSTAPILKEHSLTITTVFYKSMLGAHPELHNIFNISNQRSG------------AQQKSLANALLAYATHIDELQKLGPAVERIAQKHVSLGITPDQYAIVGEHLIKAIATVLGDGLTPEVADAWVAAYGQLADIFVK..... 136
217 7.000e-42UniRef50_A0A0B4EVF2 Flavohemoglobin (Fragment) n=24 Tax=Hypocreales TaxID=5125 RepID=A0A0B4EVF2_METAN  ali  16  6.TAEQIAIVKSTAPIIKQHGRAITDAFYTNLLSVHPELKNYFSLRNQQTG------------AQQLALANAVFAYAAYIDDLAKLSEAVERIAQKHASLFIQPEHYPIVGKFLVEAFVQILGSAVTEEIKDAWIAAYQQLADIFIQ..... 138
218 7.000e-42UniRef50_I2GB73 Hemoglobin n=9 Tax=Cytophagaceae TaxID=89373 RepID=I2GB73_9BACT  ali  26  1MTIQEINIVKRTWKLLRDDPQLLGDVFYRRLFLTYPSVRPMFR---------------EPMTTQYHKFVDMLSLIVSRIDRPEEVMSEIAQLAQRHERYGVKPEHYPVVGETLLWTLEQGLGNQWNNDVKQAWEACYQTLVQAMLEKA... 134
219 8.000e-42UniRef50_A0A0G4MVX5 Uncharacterized protein n=4 Tax=Verticillium longisporum TaxID=100787 RepID=A0A0G4MVX5_9PEZI  ali  18 1184ITEAQTAIVKSTAPILKEHSLTITTVFYKSMLGAHPELHNIFNISNQRSG------------AQQKSLANALLAYATHIDELQKLGPAVERIAQKHVSLGITPDQYAIVGEHLIKAIATVLGDGLTPEVADAWVAAYGQLADIFVK..... 1317
220 8.000e-42UniRef50_A0A1Z4RR64 Putative globin-like protein n=1 Tax=Chondrocystis sp. NIES-4102 TaxID=2005460 RepID=A0A1Z4RR64_9CHRO  ali  18  116ISHQSVEIVKSTAPVLKQHGKTITTRMYEIMFNQYPEVKTQFDQSAQANGS------------QPAKLANAVYSYATHIDDLEALKAMVDKIAHRHVDSHVLPQQYPIVGECLLQAIKDVLQDAATPEVMQAWTEAYQLLAEVFI...... 248
221 9.000e-42UniRef50_A0A0B6ANF3 Flavohemoprotein n=38 Tax=Bacillales TaxID=1385 RepID=A0A0B6ANF3_BACMB  ali  21  2LDSKTIEIVQSTVPVLKEHSKQIGKRFYELLFEKAPDLYNMFNQTNQKRGI------------QQEALGYAVYAAGEHITNLEAIKPVIERISQKHRAIGVKAEQYPVVGETLLQAVKDVLGDTASDEIIEAWGKAYGYIANAFIELEEA. 139
222 9.000e-42UniRef50_P04252 Bacterial hemoglobin n=146 Tax=Bacteria TaxID=2 RepID=BAHG_VITST  ali  22  2LDQQTINIIKATVPVLKEHGVTITTTFYKNLFAKHPEVRPLFDMGRQESL------------EQPKALAMTVLAAAQNIENLPAILPAVKKIAVKHCQAGVAAAHYPIVGQELLGAIKEVLGDAATDDILDAWGKAYGVIADVFIQ..... 135
223 1.000e-41UniRef50_A0A1C3EJG9 Flavohemoprotein n=3 Tax=Planctopirus TaxID=1649480 RepID=A0A1C3EJG9_9PLAN  ali  20  2LSSATLSVVRATAPALAEHAQSITKRFYQLMLSEHPELWAYFNPAHQQSG------------RQSMALANAIVAYATHIENLGVLLPAVELIAQKHCSLGVQPEHYPIVGKYLLRAIRDVLGEAATDDVLTAWGEAYQLLADLLIE..... 135
224 1.000e-41UniRef50_A0A254TKT7 Sugar (And other) transporter family protein n=1 Tax=Aspergillus niger TaxID=5061 RepID=A0A254TKT7_ASPNG  ali  18  46LTPEQIKIIKATVPVLQEYGTKITTAFYKNMLTAHPELNAVFNTANQVNG------------HQARALAGALFAYASHIDDLGALGPAVELICNKHASLYIQADEYKIVGKYLLEAMKEVLGDACTDDILDAWGAAYWALADIMI...... 178
225 1.000e-41UniRef50_A0A1P8FQ56 Uncharacterized protein n=1 Tax=Betaproteobacteria bacterium GR16-43 TaxID=1904640 RepID=A0A1P8FQ56_9PROT  ali  27  1MTPEQIALVQNSWKKIVPFKDMAAVLFYGRLFELNPSLKPLF---------------GKPMDLQGRKLMAMIGTAVGCLGRMHELSPGMDGIGQRHAVYCLKDEHYETVAQAFLWTLEQTLDTDFTLEVREAWTVAYTTLANVMKDA.... 132
226 1.000e-41UniRef50_A0A1M5K8Q5 Hemoglobin-like flavoprotein n=3 Tax=Proteobacteria TaxID=1224 RepID=A0A1M5K8Q5_9GAMM  ali  31  1MNEQLIQDVQGSWVAVEGIAPQAAALFYRNLFEADPALQALFK---------------GDMVAQGARLMQMIGVAVSKLRDIDALVPVLQALGRRHVTYGVQDAHYAVVGAALLKTLGQGLGPAFTPQVQASWTAVYGAISDVMIEAA... 133
227 1.000e-41UniRef50_UPI000DAC7A24 hemin receptor n=1 Tax=Rhodobacteraceae bacterium DSL-40 TaxID=2219044 RepID=UPI000DAC7A24  ali  27  1MTPDQIGLVKQSYYLIAPVSHQAAGLFYGRLFSVAPEVRPLFDRAN--------------MFTQADKLWATLGKIVDVLDRPEALEPAAAKLAVSHLHYGVMPEHYAPVGDALVWALEQGLGESFNPEVRDAWTAAYDHISQAMISA.... 133
228 1.000e-41UniRef50_A7SFV0 Predicted protein n=1 Tax=Nematostella vectensis TaxID=45351 RepID=A7SFV0_NEMVE  ali  26  18LSEAQKYLVRETWETIEPQKQTVGKKAFLRFFDMNPDYQNLFPE--FKSLSYEELQKANALHGHAKRVMKAVENAVMSIDDVMSFSAYLEELGRRHKTRALKPSYLEAMHGALMDTLRNLLQSQWTEETAEAWNKLFSFISTTMVRGLQ.. 164
229 1.000e-41UniRef50_A0A1W1UB38 Nitric oxide dioxygenase n=4 Tax=Deinococcus TaxID=1298 RepID=A0A1W1UB38_9DEIO  ali  30  8LTPQQMALVQGSLARALPEASEVAGLFYDRLFALDPSLRALF---------------LGDMAAQGRKLVDTLDVFAGDLTRLPALRPAMRRLGQRHADYGVRPEHYATVSEALLWALEQALGEGFTPEVRGAWEAAYAVIAREMLSG.... 139
230 1.000e-41UniRef50_UPI000DD441CC hemin receptor n=1 Tax=Piscinibacter caeni TaxID=1861917 RepID=UPI000DD441CC  ali  33  1MTPQQTQLIRASHARLAPHADRAGQLFYRKLFALAPDLQPLF---------------IGDIRQQATRLMQMIGAAVGLLDRPAQLVPVLQHLGARHAGYGVQARDYHAVGLALLETLAEQLGAEFDADTRAAWSAMYALVSATMIAAARAE 136
231 1.000e-41UniRef50_A0A1U7IDG3 Bacitracin resistance protein BacA n=8 Tax=root TaxID=1 RepID=A0A1U7IDG3_9NOSO  ali  16  2ISQQTIDIVKSTAPVLKKNGQQITSRMYEIMFQNHPEIREQFNMSDQADGS------------QPARLATAVYSYANQIDNLAALKSMVEKIAHRHVQTHVTPEQYPIVGESLLQAMKDVLQEAATDEVMAAWTEAYQALSEVFI...... 134
232 2.000e-41UniRef50_A0A0Q0CYB3 Flavohemoprotein n=7 Tax=Gammaproteobacteria TaxID=1236 RepID=A0A0Q0CYB3_PSESS  ali  17  2LSTAHRDIIKATVPILETGGEALTTHFYRIMLDEYPQVRPLFNQANQASG------------AQPRALANAVLMYARNIDRLENLGPLAAQIVNKHVALQILPEHYPVVGACLLRAIREVLGAEATDAVIDAWAAAYQQLADMLINAERD. 140
233 2.000e-41UniRef50_A0A1A9HJM4 Dihydropteridine reductase n=2 Tax=Mitsuaria TaxID=65047 RepID=A0A1A9HJM4_9BURK  ali  19  4..PQTIALIQATVPLLKSRGEDITRHFYRAMLTGHPELKAFFNEAHQAEGT------------QARALAGAVLAYASHIDRIHEIAPALPRIIQKHVALGVQPEHYPIVGACLLAAIREVLGDVATDEIIAAWAEAYGALAQLLIDAEEQ. 140
234 2.000e-41UniRef50_UPI000C80DFBC hypothetical protein n=1 Tax=Defluviimonas sp. MS2-2 TaxID=2056283 RepID=UPI000C80DFBC  ali  30  55LSAREVQVIRDNFRAVQDRIVPASLEFYEALFRRRPDLRPMFR---------------EDLTGQGMKFMSTLEAVVDSLESPEAIADRMEELGHSHAALGVKAEHFVPMGEALIETLRKYVGEGWTAEADAAWRKAYDEVAGRMLAG.... 186
235 2.000e-41UniRef50_A0A1Z4SE05 Putative globin-like protein n=3 Tax=Cyanobacteria TaxID=1117 RepID=A0A1Z4SE05_9NOSO  ali  19  2ISQQTIDIVKSTAPVLKKNGQQITTRMYEIMFQNHPEVKEQFDMSAQANGS------------QPAKLASAVYSYATQIDNLPALKSMVEKIAHRHVDTHVLPEQYPIVGESLLQAIKDVLGEAATEEVMAAWTEAYQALSEVFI...... 134
236 2.000e-41UniRef50_R7TFF7 Uncharacterized protein n=1 Tax=Capitella teleta TaxID=283909 RepID=R7TFF7_CAPTE  ali  23  21.TDRQKAIITKTWRHMGNDLTGRGSKVFLKIFNLHPEVKQLFPSL--KNDNEDQLLKNPCFRGHASRFMQSVGAVVENLDTPGDLSPLLIDLGRKHVLFGFTPEYFAAFTEGMMCIWSEELGKGFTDEVSVAWKTVFDFIMSQLQDGYA.. 167
237 2.000e-41UniRef50_UPI000DBEB0C6 NO-inducible flavohemoprotein n=1 Tax=Echinicola strongylocentroti TaxID=1795355 RepID=UPI000DBEB0C6  ali  17  1MTQKTIDIVKSTAPVLKSHGEQITRVFYEELFKHHPELKNMFNMTHQATGN------------QPKVLAMTIIKYAEHIDQLDMLTDTVNVIVQKHSSLDVRPEMYPIVGKYLLEAIKTVLGDMATAEILGAWEEAYQLLAQLFIGKEE.. 138
238 2.000e-41UniRef50_A0A1H5ZWH9 Nitric oxide dioxygenase n=6 Tax=Bosea TaxID=169215 RepID=A0A1H5ZWH9_9BRAD  ali  31  1MTPHQTQLIRESFAHLHRRQAESAELFYGRLFEIAPETRALFKT---------------DIRSQGVKLMESLTVAIASLNDRPGLTAFLKKLGRNHRNYGVEAKHYASVGEALIWTLQTSMGKEFTDETRLAWEILYGDISGVMIKAQEA. 135
239 2.000e-41UniRef50_UPI00042825D3 hemin receptor n=2 Tax=Bacteria TaxID=2 RepID=UPI00042825D3  ali  36  1MTPEQIDAVQASFRQVAAVREDAAAQFYDRLFTLDPGLRPLFK---------------GDMAEQQRKLMATLGLAVGSLKAPEALAGPLRELGARHRDYGVQDEHYATVAEALLWTLERNLGPAFTDDVRGAWVALYGMVAEGMRR..... 131
240 2.000e-41UniRef50_UPI0008247F59 NO-inducible flavohemoprotein n=2 Tax=Bacillaceae TaxID=186817 RepID=UPI0008247F59  ali  24  18LDPEKLEIVKATLPVVLEHGEAITTRFYERLFENHPELKNVFNLTHQKTGHQPKALANAVYAA------------AANIEDMSAIMPALERIGQKHRSLQIKPEQYPIVGENLLGAIKEILGEAATPEIIDAWADAYTIIADVFIK..... 151
241 3.000e-41UniRef50_D2AQM5 2-polyprenylphenol hydroxylase and related flavodoxin oxidoreductase-like protein n=4 Tax=Streptosporangium TaxID=2000 RepID=D2AQM5_S  ali  28  4....DIGLIRRSWSLVEPVADQVTQHFYGRLFANYPHIREMFP---------------PAMDLQRDRLLHALTQVVLNLEDGAGLNDYLGQLARDHRKYGVQPEHYPAVGSCLVAAMRFNAGGAWLPAYDEAWMTAYNYIAEVMIQAAEQD 135
242 3.000e-41UniRef50_UPI00037A7EB7 flavohemoprotein n=2 Tax=Thiotrichales TaxID=72273 RepID=UPI00037A7EB7  ali  22  2ITAESLAIVQATVGVVREYGADITRKFYSTLFAAHPELTNLFNMSNQASG------------EQQQALASAVYAYAANIQNPTALEPILSRIAHKHASLGIKPAQYTLVGKHLLAAIKSVLGEAATPEILAAWDEAYWLLACELVA..... 135
243 3.000e-41UniRef50_K9T9X7 Hemoglobin-like flavoprotein n=2 Tax=Pleurocapsales TaxID=52604 RepID=K9T9X7_9CYAN  ali  27  6......DVLEKSFNLVEPRANEFAASFYETLFTDSPEAKPLF--------------ANTDMEKQQQKLIMSLVYVVTNLRYPEELTKVLREMGEKHATYGAKAEHYPIVGAALLKTLEAYLGADWTPEVKQAWTDAYEEISYLMLEGAK.. 134
244 3.000e-41UniRef50_A0A1H0HXP3 Nitric oxide dioxygenase n=2 Tax=Bacillus TaxID=55087 RepID=A0A1H0HXP3_9BACI  ali  19  2LTQDQISTIKATIPVLEEHGVTVTTHFYKTLFEDYPQLLNLFNHVNQDTG------------AQPKALAYSLYQAAVHIDRLEAILPVVHQIAHKHRSIGVKEEHYPIVGEYLLKAMQEKLDLSADDPIIEAWGATYEIVADVFIQVEKE. 139
245 3.000e-41UniRef50_A0A210Q3Q0 Neuroglobin n=2 Tax=Mizuhopecten yessoensis TaxID=6573 RepID=A0A210Q3Q0_MIZYE  ali  26  22LTPRQIHLVQDTWDIIKDDLSKLGVIVFLRLFETEPDLKHLFPKIVQMNEQLEWDIDRDMLTKHAVSVMEGLGAAVESLDESEFLNSVLISIGQTHVKRHVKPQMLKRLWPSLNYGLKQVLQSKYNKEVNEAWKKVYFYIVAHMKRGME.. 172
246 4.000e-41UniRef50_I1RB58 Uncharacterized protein n=34 Tax=Sordariomycetes TaxID=147550 RepID=I1RB58_GIBZE  ali  20  3LSYQQTKLIRGTIPALTDHGERITTIFYRNMLRDHPELNDYFNTVNQANG------------RQPRALTAVILSYANNINHITELIPKMERMCHKHCSLGIKPEHYAIVEKYLIAAFAEVLGPTMTTQIREAWTKAYWMLAKMLI-GREAQ 140
247 4.000e-41UniRef50_Q7NSD8 Flavohemoprotein n=59 Tax=Bacteria TaxID=2 RepID=HMP_CHRVO  ali  18  2LSEQTRSLVKATVPVLQQHGVALTSHFYRRMFEHNPELKNVFNQGHQHSGQQQQ------------ALAMAVLAYARHIDDPSPLLPVLTRVAHKHVSLGIRAEHYPIVGKHLLASIRELLGEAAGDDLIQAWAEAYGLLADTLI...... 134
248 4.000e-41UniRef50_A0A061H6I6 Uncharacterized protein n=1 Tax=Anthracocystis flocculosa PF-1 TaxID=1277687 RepID=A0A061H6I6_9BASI  ali  19  3LTSQQVAIIQATVPVLKQHGEHITTTFYRHLLEENPALKNVFGMTNMLTG------------RQPKALAHGLLAYASHITEPAVLADFVEKVSHKHASLGVEPAQYAVVGKYLLAAMAEVLGDAFTPDVHDAWAAAYWILANIMIE..... 137
249 4.000e-41UniRef50_UPI0003F0C79F globin-1-like n=1 Tax=Saccoglossus kowalevskii TaxID=10224 RepID=UPI0003F0C79F  ali  24  22LDDRQKRIVRKTWRPLANDMTENGQKIFINIFESHPEIKYMFPT--RDIEGRDNLSANPHFRMHSSRFMQSVGAAIDNLNDLDALRPLLVKLAKTHVRFGFKPDYFDAFEEAMLSVWQEELGQRFTTEVEESWKLLFFYIKDCLKEGYD.. 170
250 4.000e-41UniRef50_A0A0Q1CSX6 Uncharacterized protein n=17 Tax=Burkholderiales TaxID=80840 RepID=A0A0Q1CSX6_9BURK  ali  35  1MSPEQIHLVRQSFAQVAPVAAKAGALFYAKLFARDPAISGLF--------------ASSDMNEQARKLLDMIGSAVRMLGQPEQLDAALRALGKRHAGYGVEAAHYDTVGAALLDTLAEALGGAFNPATREAWGALYAHVGTTMRAGAA.. 135
251 4.000e-41UniRef50_A0A2A3I599 Hemoglobin-like flavoprotein n=1 Tax=Streptomyces sp. TLI_235 TaxID=1938860 RepID=A0A2A3I599_9ACTN  ali  31  7.......LVKSSFAAVEPHGTEVTAWFYRHLFEHHPAVRPLF---------------AEHLDEQQDRLFAALGALVANLEDTDTLVGVLTGLGRRHAGYGALPEHFPAVGVSLIATLRHFAGDAWSPQAEAAWAAVYGVVADTMGRAL... 132
252 4.000e-41UniRef50_A0A210QE49 Neuroglobin n=2 Tax=Mizuhopecten yessoensis TaxID=6573 RepID=A0A210QE49_MIZYE  ali  34  8LSSGDKILIKQSWSQFTSTGADVGVPMFAKLFADYPDVKTLFSFMREGGGSLE----SEAVRNHAEGVMGVVGTAVESIDNLEGLVPTVRSLGAKHYTYGAQTAHLGPVGECLLYAMEKKLKEKFTNETKLAWLKLYDVISVAFQDGLEEE 156
253 5.000e-41UniRef50_I0IMI4 Putative flavohemoprotein n=31 Tax=root TaxID=1 RepID=I0IMI4_LEPFC  ali  22  6......DLIKASAQLIAPLGSKVTEYFYNTMFTDHPEVRKMFP---------------AEMGVQAQRLFDSIVYITSNIDKPDALVPYLQRLGSGHIKFDTRPEHYPIVGNSLMKTLAHFAGPAWTKEMAEAWSEAYNLAASVMIEAA... 132
254 5.000e-41UniRef50_H3KC31 Nitric oxide dioxygenase n=8 Tax=Proteobacteria TaxID=1224 RepID=H3KC31_9BURK  ali  20  2LTPNQISLVKATIPVLREHGVALTAHFYARMLKGNPELRQVFNQGHQRAGRQQEALAAAV------------LAYAEHIENPAALLPAVEHIAGKHVSVGIRAEHYPIVGRHLLASIQEVLGDAATPELIEAWGAAYGQLAGILIE..... 135
255 5.000e-41UniRef50_UPI000CF1EB88 hypothetical protein n=3 Tax=Streptomycetaceae TaxID=2062 RepID=UPI000CF1EB88  ali  30  72.......LIKSSYGVVEPHGTEVTAWFYRHLFEHNPGVRSLF---------------AAHLDEQQDRLWAAIGALVTHLEDPDALLPLLRGLGERHAAYGALPAHLPAVGASLLATLAHFAGPAWTPETERAWTAVYGVAAETIGAAM... 197
256 5.000e-41UniRef50_A0A2E7E671 Uncharacterized protein n=1 Tax=Oceanospirillaceae bacterium TaxID=1899355 RepID=A0A2E7E671_9GAMM  ali  20  16LSPATLEIVAATVEVVRANGTAITDVFYRNMLSAYPELQRLFNMPNQASG------------GQKQALASAVYAYAANQNNPEALEPVLNRIAHKHASLGITPAQYTIVGKYLLGAVADVLGDAITPEVAAAWDEVYWQLACDLIA..... 149
257 5.000e-41UniRef50_A0A287B6B7 Neuroglobin n=1 Tax=Sus scrofa TaxID=9823 RepID=A0A287B6B7_PIG  ali  92  1MERPEHELIRQSWRAVSRSPLEHGTVLFARLFDLEPDLLPLFQYNCRQFSSPEDCLSSPEFLDHIRKVMLVIDAAVTNVEDLSSLEEYLAGLGRKHRAVGVKLSSFSVGKGAL...................................... 113
258 6.000e-41UniRef50_A0A2B4SPY0 Cytoglobin-2 n=3 Tax=Stylophora pistillata TaxID=50429 RepID=A0A2B4SPY0_STYPI  ali  24  21LTTAQKYLVRETWETIEIHKNSVGKKTFIKFFEKNPEYQRLFPE--FKDVPPSELEKTNALYGHAKRVMKAVENAVSALDDSESFSAYLEELGRRHKTRALKPMYLDSMQEALMFVLQDLLESSWTEETADAWNKLFRFVTEHMTYGLQ.. 167
259 6.000e-41UniRef50_A0A060T0W4 ARAD1C11660p n=1 Tax=Blastobotrys adeninivorans TaxID=409370 RepID=A0A060T0W4_BLAAD  ali  18  3LTKDQVDIIKATVPVLETRGEEITKYFYSKMLSENPDVSNFFNKTHQASF------------AQPRALAHSLLAYAHNIDNLDALSGLVERVAQKHCSLMVQPEHYPIVGKYLLIALSDVLGDVATEAVLEAWGAAYQALANILIEAEA.. 140
260 6.000e-41UniRef50_A0A2K9UYR2 Globin-like protein n=5 Tax=Actiniaria TaxID=6103 RepID=A0A2K9UYR2_ACTTE  ali  25  23LSKAQKYLVRETWETVELYKNNVGKQTFLRFFENNPEFQKLFPE--FKELKYEELQKANALHGHAKRVMKAVENAVSAMDDAVSFSAYLEELGRRHVARSLKPSYLDAMQAALMDSLRQTLQSEWTDETAIAWNKLFRFIADTMITGLQ.. 169
261 6.000e-41UniRef50_A0A2T7NZ43 Uncharacterized protein n=2 Tax=Pomacea canaliculata TaxID=400727 RepID=A0A2T7NZ43_POMCA  ali  21  67LTEEEKRILTESWEIIVHDVEKIGVVTFFGLFETHPDVQDIF--IPFKGKKLEDLWTSTDLKSHVLRVMGTVEKCLARIHEPAKMESILHELGVKHLLLNIRVEYLDLIGPQFIKAVRPAMGDLWTPEVESAWANLFRLITHIMKEAM... 212
262 7.000e-41UniRef50_UPI0009E48129 neuroglobin-like n=1 Tax=Orbicella faveolata TaxID=48498 RepID=UPI0009E48129  ali  29  10LTDLQIEMIRSSWEKVTPNKKHHGQLLFHKLFEIAPEMTDLFPFGDDFTKPQ--------FTTHALNIMNALDHAIQNLDNPDVLIPKLRELGQMHAGFELTIKEFQHVGEALIWVLATGLGDDFTPQLRTAWGDVYAIITDVMLGAIKD. 151
263 8.000e-41UniRef50_A0A2W2E3R7 Globin n=2 Tax=Micromonosporaceae TaxID=28056 RepID=A0A2W2E3R7_9ACTN  ali  25  2....DVSRLKQSWSLVAAHGDQVPLYFYSTLFLAYPETRQMFPTN---------------MAGQRDRLVTALGHIVSQVDQLDHLVGYLQDLGADHRKFAVRAEHYPAVGEALLATLRHFLGDQWTDELAQDWTAAYGLVSKVMTEAAQA. 132
264 9.000e-41UniRef50_A0A1N6R640 Nitric oxide dioxygenase n=1 Tax=Chryseobacterium sp. RU37D TaxID=1907397 RepID=A0A1N6R640_9FLAO  ali  21  1MNTNQKNLIKATIPFLKTNGTDLTKHFYATMLSENPELNNLFNISNQASG------------RQQNVLANTVLAYAENIEKPTVLINILKGIGNKHVSLNIHPEQYKIVGHYLISSIKAILGDAATAEIIEAWTEAYNELAQIMI...... 133
265 9.000e-41UniRef50_UPI000719D0AA neuroglobin-like n=3 Tax=Priapulus caudatus TaxID=37621 RepID=UPI000719D0AA  ali  30  19LTEREKALIRRSWKLLCEDSMTIGGEIFLKIFELNNEVKALFP---FRDVTGEALKHDPDFKGHASRFMQALGAAVDNLDNLHSLEPLLSALGKTHTRYGFTPAFFDEFTASILHVWRERLGRKFTPEVRAAWLAMVSFIATAMKDGYR.. 169
266 1.000e-40UniRef50_A0A2H5B1V1 Uncharacterized protein n=2 Tax=Streptomycetaceae TaxID=2062 RepID=A0A2H5B1V1_9ACTN  ali  30  7.......LIKSSYGVVEPHGTEVTAWFYRHLFEHNPGVRSLF---------------AAHLDEQQDRLWAAIGALVTHLEDPDALLPLLRGLGERHAAYGALPAHLPAVGASLLATLAHFAGPAWTPETERAWTAVYGVAAETIGAAM... 132
267 1.000e-40UniRef50_A0A2C9JQU3 Uncharacterized protein n=3 Tax=Euthyneura TaxID=216307 RepID=A0A2C9JQU3_BIOGL  ali  21  52LTAETREIILASWEIIKKDIERVGVVMFMGLLE-DPDVKGTF--MDFRDKTAEELRASTALRSHVLRVMGAVEKVVARMDSEDKVVTLLHDLGQRHVVYNARPEFLDLVGPQFNTAIQPALGDRWTPEVEQAWADLFRYITHLMKETM... 196
268 1.000e-40UniRef50_UPI000568E4F5 hypothetical protein n=1 Tax=Sporocytophaga myxococcoides TaxID=153721 RepID=UPI000568E4F5  ali  24  2INDTQISLVKKSWESAYKIQDVAGPLFYNRLFEIAPEVRYMFAQTN--------------LQEQSKKLFQMLNYIIQRLHNLDDIIDEVASLAGRHVKYGVKERHYQIVGEALLWTLEKGLGELWNSETKESWVKTYTILSSAMIGA.... 134
269 1.000e-40UniRef50_I1XFU2 Flavohemoprotein (Nitric oxide dioxygenase) n=1 Tax=Methylophaga nitratireducenticrescens TaxID=754476 RepID=I1XFU2_METNJ  ali  18  1MKPETFDIIRQTVPVLEQHGELLADCFYKNMFHNNPEVKAFFNPAHQHSG------------AQQRALAATICAYARHIENFDQLQQLIGLISQKHVSFGIKPEHYPIVENHFLLALREVMGESATEEVIEAWTEAYGVLAGIFIDKEDD. 138
270 1.000e-40UniRef50_A0A2G3K510 Hemin receptor n=1 Tax=Chitinimonas sp. BJB300 TaxID=1559339 RepID=A0A2G3K510_9BURK  ali  33  1MNAETIKLTQESWKKVAAIAPQAAALFYENLFTADASLKPMFK---------------GNMEEQGQKLMQMIGAAVSKLNNQETLIPILQALAKRHAGYGVKPSHYQTVGAALIQTLEQGLGNDFTPAVKAAWVEVYGAMVGVMVSA.... 132
271 1.000e-40UniRef50_UPI00076FDDE3 hemoglobin-2 n=1 Tax=Neodiprion lecontei TaxID=441921 RepID=UPI00076FDDE3  ali  23  23LTGKQKRLVTETWGIMRQDPMKLGIAVMMRLFTKHPEYRSQFH--AFKDTPHEDLPKNKRFQAHASAIANALSTIIDSLKDPGLLEAILISLGEKHHKRGQTVEQFNNLKLVLLVVFKEFLGSRWTPEVNNAWSKALDFVYSIIFKVYA.. 169
272 1.000e-40UniRef50_A0A1K2FMD5 Flavohemoprotein n=84 Tax=Actinobacteria TaxID=201174 RepID=A0A1K2FMD5_9ACTN  ali  26  1MSDSQ--ALRDSFALVGKSGDEVPRYFYSYLFLIAPEVRPMFPVA---------------MGAQRDRLVAALGRIVAEADDPDRLIPFLQQLGRDHRRFQVVAQHYEAVGQALLATLAYFLGDAWTPELQRGWTEAYSLVARTMIQAAEAD 134
273 1.000e-40UniRef50_Q90YJ2 Neuroglobin n=149 Tax=Euteleostomi TaxID=117571 RepID=NGB_DANRE  ali  54  4LSEKDKGLIRDSWESLGKNKVPHGIVLFTRLFELDPALLTLFSYS-TNCGDAPECLSSPEFLEHVTKVMLVIDAAVSHLDDLHTLEDFLLNLGRKHQAVGVNTQSFALVGESLLYMLQSSLGPAYTTSLRQAWLTMYSIVVSAMTRGWA.. 151
274 1.000e-40UniRef50_A0A1H3U9P0 Nitric oxide dioxygenase n=2 Tax=Jannaschia faecimaris TaxID=1244108 RepID=A0A1H3U9P0_9RHOB  ali  25  14LTPRQIFLIRDSFSSVAPMRKTAATLFHAHLFEMAPSVRPLFSR---------------DVSDQGDMLMAALARIVRALDRMEDVAPDLEALARRHPGYGAREEHYPAVGEALIWALEQALAERFTDEVRKAWVDAYAEISHIMIAATRA. 148
275 1.000e-40UniRef50_A0A1D2MAA6 Cytoglobin-2 n=3 Tax=Entomobryomorpha TaxID=730330 RepID=A0A1D2MAA6_ORCCI  ali  25  2LTPEEEKSIKDTWAFVSPDLKGNGIKFFIHFFTGYPEYQKLFRG--FADVPLDKLSENKRLQAHAFTVLNAINGLVDNLDDPDVLTELLLKTGRNHARRKLTRGDFENLKTSLLEFLGKALKSHWTPEAETSWTKLLSVMVGKISEGLE.. 148
276 1.000e-40UniRef50_A9AW41 Globin n=1 Tax=Herpetosiphon aurantiacus (strain ATCC 23779 / DSM 785) TaxID=316274 RepID=A9AW41_HERA2  ali  27  2.........QQTFAEVGRNPQQLVEAFYGQLFMLAPDFRPLFP---------------EDMSEQKKKLLQSLVLVVNNLKKPEAVLPAVQELGRRHVDYGVKPEHYQTVGAALIWALSQQLGEQWNDEVQAAWVAAYTLVANVMVEASQA. 127
277 1.000e-40UniRef50_A0A2C6Y0J1 NO-inducible flavohemoprotein (Fragment) n=1 Tax=Roseomonas rhizosphaerae TaxID=1335062 RepID=A0A2C6Y0J1_9PROT  ali  19  5LSEQTIAVVKATVPALEVHGLALTRRMYERLFQNA-SIRDLFNQSH-----------HGETGSQPKALAGAVLAYAQNIDNLGVLAGAVERIAQKHVGLNILPEHYPHVADALLGAIRDTLGEAATPEILAAWGEAYWFLADLLI...... 137
278 2.000e-40UniRef50_A0A2J0YT24 Nitric oxide dioxygenase (Fragment) n=1 Tax=Rhizobium meliloti TaxID=382 RepID=A0A2J0YT24_RHIML  ali  27  1.........................HFYKRMFQAHPELKNIFNMAHQERG------------EQQQALARAVYAYAANIENPESLSAVLKDIAHKHASLGVRPEQYPIVGEHLLASIKEVLGDAATDEIISAWAQAYGNLAD-ILAGMESE 113
279 2.000e-40UniRef50_E0VN13 Globin D, coelomic, putative n=6 Tax=Hexapoda TaxID=6960 RepID=E0VN13_PEDHC  ali  24  40LTTREKELLIETWKELEENIAKVGVITFVSLFETHPDVQESF--MSFSGVDIEDLKHSKQLRAHALRVMAFVQKAVARLHEPEKLETLLKELGRKHVGYGAKQKYVELVGPQFILAIKPSLEKQWDEELDDAWTHLFKIIEFVMVSSMDDD 188
280 2.000e-40UniRef50_A0A235HP54 Globin n=2 Tax=Cyanobacteria TaxID=1117 RepID=A0A235HP54_9NOSO  ali  28  5.....VELLEQSFEKVKPRADEFAASFYNNLFQAHPEMKPLF--------------AKTDMKNQEKKLLSSLVLVVENLRNPEALEPVLKALGARHVGYGAIPKYYGLVVEALLVTLEQYLQQYWTPEVKKAWLDAFRAITGLMLKGAGEE 136
281 2.000e-40UniRef50_UPI0007322D17 hypothetical protein n=1 Tax=Thiohalocapsa sp. ML1 TaxID=1431688 RepID=UPI0007322D17  ali  25  1MTPEHIAAVKASWEQLRPISEQTAFLFYTRLFEQHPDLHGMFRT---------------DSREQGHKLLAMLDTAVASLADLDALEPDIRELGGRHVGYGVMDGHYPLFEDAMHWALSQGLGDGWTADVEAAWRALFGRLSRTMRAGA... 133
282 2.000e-40UniRef50_UPI0009E63069 neuroglobin-like n=1 Tax=Orbicella faveolata TaxID=48498 RepID=UPI0009E63069  ali  29  30LSEETKNVLRESWKLVEPLKTVAGKKMFERMFGSHPEVIYLFPI--FKGLTLREILCSRALHLHVKKVMSALENAVLSLNDAEKLTHYLINLGERHRPWSVRMEHFDLLKESLLWTLQDMLQSKCTPGVSRAWSEMIDLVAEAMMQGLK.. 176
283 2.000e-40UniRef50_A0A0D6MNJ7 Oxidoreductase FAD-binding domain-containing protein n=1 Tax=Tanticharoenia sakaeratensis NBRC 103193 TaxID=1231623 RepID=A0A0D6M  ali  21  5LDENTRSIIKACIPALEVHGLAITTEMYRRLL-IDPDIRSYFNLSHQADGS------------QARALAGAVLAYARHIDDPGVLGAAIERIAEKHVGLTVQPGHYPLVGTAFLGAIGEVLGDAATPEILEAWGHAYWFLADILI-AREAE 141
284 2.000e-40UniRef50_A0A2A4N209 Nitric oxide dioxygenase (Fragment) n=1 Tax=Gammaproteobacteria bacterium TaxID=1913989 RepID=A0A2A4N209_9GAMM  ali  18  2LSQQTIETVQSTIPLLAEHGQTITQNFYEKLFVAHPELKNVFNLNNQQDGN------------QARALADAVFAYANNLTNLEALIPAVQRIANKHVSLGIKPEQYPIVGQYLLAAIQDVLSLPDDHPALTAWAEAYAVLADVFINTEE.. 138
285 2.000e-40UniRef50_UPI00068661E2 hypothetical protein n=2 Tax=Planktothrix TaxID=54304 RepID=UPI00068661E2  ali  22  180.TTAQIELVETSFEKIKPRAVEFVSSFYQNLFETYPETQRLFGKT--------------DMDKQGKKLLNSLILLVEGLRTPEALIPVLKDLGARHKGYGTITEYYPLVGEILLKTFADYLQEDWTPDVAQAWLEIYTNTSNLMLEGA... 312
286 3.000e-40UniRef50_Q5DVM4 Putative haemoglobin n=2 Tax=Opisthokonta TaxID=33154 RepID=Q5DVM4_ASPNG  ali  18  3LTPEQIKIIKATVPVLQEYGTKITTAXYMNMSTVHPELNAVFNTANQVKG------------HQARALAGALFAYASHIDDLGALGPAVELICNKHASLYIQADEYKIVGKYLLEAMKEVLGDACTDDILDAWGAAYWALADIMI...... 135
287 3.000e-40UniRef50_UPI00034B7A69 hypothetical protein n=1 Tax=Prochlorothrix hollandica TaxID=1223 RepID=UPI00034B7A69  ali  25  4....QVELLEQSFEKVKPQATEFVDRFYENLFADYPAAKPLFEHTN--------------MAKQKTMLLNSLVLVVDNLRSPDVLSDALKGMGARHVNYGALPAHYPLVGNSLIKTFSQFLGDGWTSDYEAAWAGAYDVITDLMLQGAD.. 134
288 3.000e-40UniRef50_A0A0A1Z321 Flavohemoprotein n=8 Tax=Proteobacteria TaxID=1224 RepID=A0A0A1Z321_PSEFL  ali  16  2ITSQQRALVKATVPLLETGGEALTRHFYAMMLSEYPEVRPLFNQAHQASGD------------QQRALANGILMYAKHLDHLEALGPLAGKIVNKHVSLQILPEHYPIVGTCLLRAIREVLGADATDEVLEAWGVAYGILADLLINAEE.. 139
289 3.000e-40UniRef50_A1ZE02 Flavohemoprotein n=1 Tax=Microscilla marina ATCC 23134 TaxID=313606 RepID=A1ZE02_9BACT  ali  21  2ISKENIAIVKSTVPVLETQIHTITQAFYKRLFKNHPQLKEVFNMTHQAKGS------------QPKALATAIFQYARYIEQPEVLKAAIAMIAEKHVSLSVTPTQYEVVGENLLAAIKEVLGDAATPEVLGAWAEAYGQLAQLLI-GEEE. 138
290 3.000e-40UniRef50_A0A1Y5HRR3 Hemin receptor n=1 Tax=Oleispira antarctica TaxID=188908 RepID=A0A1Y5HRR3_OLEAN  ali  25  1MNPTTIHNVQSTFDLIAPIADDAAALFYSKLFELDPSLKSMFK---------------SDMADQRKKLMQILGVAVSSLHNLAAIVPAVQDLGRRHVKYGVRPQHYNTVAEAILWMLGQTLGASFTPAIKQSWTEVYTVLAETMVAAANE. 135
291 3.000e-40UniRef50_A0A0P6B1R4 Neuroglobin n=5 Tax=Daphnia magna TaxID=35525 RepID=A0A0P6B1R4_9CRUS  ali  26  89LTDLQKTLLQQSWKRLEMDIAQVGIIVFINLFESHPDMQSVF--LPFTGLVLDDLKKSKLLSEHALRVMGAVQRAVHRLEEPEKLHAFLSDLGRRHDKNGAKLEYIDYIGPQFLSAIRPILGGDWTAETEKAWTLLLGYMIATMKQALLE. 236
292 3.000e-40UniRef50_K0KJ85 Flavohemoprotein n=5 Tax=Phaffomycetaceae TaxID=115784 RepID=K0KJ85_WICCF  ali  21  3LTDKQKEIITASIPFLESNGVELTANFYAYMLETYPEVRPFFNKTHQKTKS------------QPKILAFALVNYAKNINDLTPLLGFVRQIVEKHVGLQVTPEQYDIVGTCLLKTLSEMLGEAATEEFIEAWKVAYFDLANILI-GLEKE 140
293 3.000e-40UniRef50_W1DIL4 Flavohemoprotein (Hemoglobin-like protein) (Flavohemoglobin) (Nitric oxide dioxygenase) n=3 Tax=Enterobacterales TaxID=91347 RepID=W1  ali  19  2LDAQTIATVKATIPLLVETGPKLTAHFYDRMFAHNPELKEIFNMSNQRNGD------------QREALFNAIAAYASNIDNLPALLPAVEKIAQKHTSFQIKPEQYNIVGSHLLATLDEM----FSPEVLDAWGKAYGVLANVFI-GREAE 137
294 3.000e-40UniRef50_A0A2K9UYP9 Globin-like protein n=4 Tax=Hexacorallia TaxID=6102 RepID=A0A2K9UYP9_EXAPA  ali  25  20LSTAQKYLVRETWETIEQHKNPVGKKTFLRFFDMNPDFQKLFPE--FVGLNREELEKANALHGHAKRVMKAVENAVTAMDDAESFTAYLEGLGQRHVNRALKPSYLDAMQVALMDTLKDLLQSQWTQETCDAWNILFRFIADTMKRGLQ.. 166
295 3.000e-40UniRef50_F4CV93 Nitric oxide dioxygenase n=63 Tax=Actinobacteria TaxID=201174 RepID=F4CV93_PSEUX  ali  32  33.....VETIRRSWAAMEDQADALGRHFYATLFHIAPETRDLFPVN---------------MEVQRSRLLRALVHVVQMVDQLDDLVPFLQQLGRDHRKFGVIAGHYDAVGKALLSAIGTHAGDGWTPEVEKAWTDAYTLAGQAMSQAADAE 163
296 3.000e-40UniRef50_A0A239GBZ1 Ferredoxin-NADP reductase n=5 Tax=Actinobacteria TaxID=201174 RepID=A0A239GBZ1_9ACTN  ali  26  4....DIELIRRSWSLVEPAAAKVAAHFYGKLFADHPGVRELFP---------------PAMGDQRDRLLGALTRVVLNLEAGPGLVDYLGQLARDHRKYGVRPEHYPAVGACLIAAMRANAAGSWRPEYSEAWAEAYQTIADVMIKAAAQD 135
297 3.000e-40UniRef50_A0A2I4BLA0 neuroglobin isoform X1 n=10 Tax=Euteleostomi TaxID=117571 RepID=A0A2I4BLA0_9TELE  ali  50  49LSVKDKELIRDSWESLGKNKVPHGVIMFTRLFELDPELPSLFNYSK-NCGSKQDCLSSPEFLDHVTKVMLVIDAAISHLDDLHSLEEFLVNLGKKHQAVGVSTQSFAVLGEALLFMLQCSLGQAYTAPLRQAWLNMYSIVVATMSRGWEED 201
298 3.000e-40UniRef50_K2HBC4 Flavohemoprotein n=14 Tax=Bacteria TaxID=2 RepID=K2HBC4_9BACI  ali  18  9LDERTREIVKATVPVLAEHGEAITTHFYKRMLTERPELKNYFNMTHQKDGKQPRALANAV------------YAAASHIDDLSAIAPAAETIAEKHVSLNIRPEHYPIIGEYLLKAIKEVLGDAVDEEVIDAWELAYGEIADLFISIEDE. 146
299 4.000e-40UniRef50_UPI000DCD8962 hemin receptor n=1 Tax=Chryseolinea sp. SDU1-6 TaxID=2059302 RepID=UPI000DCD8962  ali  25  1MTERQILLVKNSWSYVIVKSEEAGQLFYHRLFEIAPELKSLFKSEP---------------KGQSRKLINMVTLMVSKLQKLDEIQGEIKSLATRHHKYGVDPAYYRIVGAAFLWTLQQGLKDKWNEELEEAWVDMYAVISNAMIK..... 131
300 4.000e-40UniRef50_A0A1R1EP31 Flavohemoprotein n=5 Tax=Bacillales TaxID=1385 RepID=A0A1R1EP31_9BACL  ali  24  2LDSKTIEIVQSTAPVLKQHSEQIGKKFYELLFAKAPDLYNLFNQTNQKRG------------LQQEALGYAVYAAGEHITNLDAIMPVITRVTQKHRAIGVKPEQYPLVGETLLEAVKEVLGSAATDEIIGAWGKAYEYIAEAFIQ..... 135
301 4.000e-40UniRef50_A0A225NHY4 Uncharacterized protein n=3 Tax=Rhodobacteraceae TaxID=31989 RepID=A0A225NHY4_9RHOB  ali  26  2LTQTEIAAIRSSWLAVVADRDRAGELFYDNLFRTAPETKSMFN---------------ASARVQGRKLMETLAIVVEGLDQFDALLPTLRHLGQVHAELGVRREHYEIVGTTLIKTLGDAAGGKLDPQQEAAWRKAYWTVADIMKAAA... 134
302 4.000e-40UniRef50_K8YWN8 Nitric oxide dioxygenase n=2 Tax=Nannochloropsis gaditana TaxID=72520 RepID=K8YWN8_NANGC  ali  20  27LSPHIVSVVKSTAPVLAAQGPRITQVFYPLLFSRYPAVQELFNKRNQAPEPDGTP------ARQPQALANAVWAYAANIDNLSALSAAVSLIAHKHASLHVLPEHYPMVGECLLAAIAQVLGPEATVEVLKAWEQAYGFLAAVFVQTED.. 170
303 4.000e-40UniRef50_A0A1W1USN6 Hemoglobin-like flavoprotein n=6 Tax=Bacteria TaxID=2 RepID=A0A1W1USN6_9DEIO  ali  30  1MTDDQIQLVQHSFTFIETQAEFVAARFYERLFALDPALKALFR---------------GDLAEQGRKLMSALRLVVRGLDHLPPLLPAVRELGARHASFGVQHTHYALVGTALLGTLNEVLGDAFTTETREAWLEAYETLATVM....... 129
304 4.000e-40UniRef50_A0A1W6B9V0 Nitric oxide dioxygenase n=2 Tax=Gammaproteobacteria TaxID=1236 RepID=A0A1W6B9V0_9GAMM  ali  16  2LSERQKELVKATVPVLKENGEALTDYFYKRMLKNNPHLKETFNMGHQRSG------------AQAKALAGAVLAYAENIDDPSVLMPVVELICHKHVSLNIQAPDYNIVGENLLHSISEVLNIPMDDELIAAWGVAYQQLADIFIATEKQ. 139
305 4.000e-40UniRef50_V4ARY3 Uncharacterized protein n=1 Tax=Lottia gigantea TaxID=225164 RepID=V4ARY3_LOTGI  ali  24  21LTQREVDIVQKTWAILSTDMMGTGVYMFQRLFEIQKDLQKLFRKLLLPSETADYFFDEVKLQSHAMIVMQGLGAAVESLDDSVYLTNILLTMGEKHSQYNVQPEMISLLWPAIRDALKHKLKEDFTPETELAWRHVFDYISSNMAEG.... 167
306 4.000e-40UniRef50_UPI000D146B18 hypothetical protein n=1 Tax=Streptomyces sp. NRRL F-5123 TaxID=1463856 RepID=UPI000D146B18  ali  27  7......QALKDSFALVGKSGDEVPRYFYSYLFLIAPEVRPMFPVN---------------MGVQRDRLVNALGQIVSDVDDPDTLVPFLQQLGRDHRRFQVVAQHYDAVGRALLATLGYFLGEAWTPELEKGWTEAYTVVAGAMVQAAEAD 136
307 4.000e-40UniRef50_Q5FSL1 Flavohemoprotein n=30 Tax=Gluconobacter TaxID=441 RepID=Q5FSL1_GLUOX  ali  18  9LTPETIAIIKATIPALEAHGVTITSEMYRRLLA-DPAIAEMFDPTHQSTGT------------QPRALAMAVLAYAKNIDNLGVMGSAVERIAQKHASLEIQPEHYPHVATALLGAISSVLGEAATPEILDAWGKAYWALADILI...... 140
308 4.000e-40UniRef50_A0A1Y0D3Y9 Flavohemoprotein n=14 Tax=Gammaproteobacteria TaxID=1236 RepID=A0A1Y0D3Y9_9GAMM  ali  18  2LDSRTREIVKSTVPLLEAANTALTEHFYKRMFRDNPELKDVFNLSNQASG------------RQPAALFNAVLAYAKNIDNPAVLASAVERIAQKHTGFAITPSQYDIVGHHLLETIKELAPDAATPEVIDAWAQAYGALAGLFI-GREEQ 139
309 5.000e-40UniRef50_A0A2P9F1U1 Naphthalene 1,2-dioxygenase system ferredoxin-NAD(+) reductase component n=27 Tax=Streptomyces TaxID=1883 RepID=A0A2P9F1U1_9ACTN  ali  27  118.......LIRRTMAEVGPVADKVTSYFYALLFVQHPDLRSLFP---------------PAMDAQRDRLLKALLTAAEHIDNTPVLVDYLQNLGRGHRKYGTQPEHYPAVGECLIGSLSRYAPTTWDDETEAAWVRTYTTISQVMIDAAAAD 246
310 5.000e-40UniRef50_A4C946 Probable bacterial hemoglobin n=2 Tax=Pseudoalteromonas TaxID=53246 RepID=A4C946_9GAMM  ali  30  1MTPHQVELVQASWEKVVPIAKDAADLFYGKLFELNPALRPLF---------------HGDVEEQGKKLMQILTTVVRGLKQFDKLEMAVWQLGRRHVAYQISIQDFNTVAEALLWTLQQGLQQAFSAEVKQAWVEAYTIVAGVMQAGMEYE 136
311 5.000e-40UniRef50_A0A1L6LXQ4 Putative bacterial hemeoglobin n=1 Tax=Minicystis rosea TaxID=888845 RepID=A0A1L6LXQ4_9DELT  ali  31  20......ALLRVSFQRLLPMADLVAELFYGRLFLLDPSLRALFR---------------GDMKSQGRKLMSVLQVAVNNVDRVETILPVVQGLGRRHVGYGVRDEHYETVRSALIWTLQQGLGDDLTPATAAAWADMYDMIASVMRGASRE. 148
312 5.000e-40UniRef50_K1QF07 Neuroglobin n=5 Tax=Crassostrea TaxID=6564 RepID=K1QF07_CRAGI  ali  29  6ISEDEKRLVKDSWNLFVSRGDDTGSHMYKVLLQDNPHLKTLFSFMKVNGAPFD----SPMFKSHVRNVFTVIGDAVNHIDDLDSLSPILKDLGVKHQGYGAKKEYLEPVGNALLCTIEKHLEDDFTQEVHSAWRTFFAVMSYSFAQGLDED 154
313 5.000e-40UniRef50_W0RNE9 Globin n=1 Tax=Gemmatirosa kalamazoonesis TaxID=861299 RepID=W0RNE9_9BACT  ali  28  1MTPEHAQLVRSTWPAVAADVDALASRFYRHLFELDGAAAGLF--------------ATVDMTAQRAKLARTLGVIVATLDDPDALLPVIGALGKRHVGYGVEQRHYDTVGDALLWALRDTLGTAFTPEVHDAWAEAYTLVASVMRRAL... 134
314 5.000e-40UniRef50_A0A1H5FDF8 NAD(P)H-flavin reductase n=4 Tax=Streptomyces TaxID=1883 RepID=A0A1H5FDF8_9ACTN  ali  25  62.......LVRRTMAEVAPVADKVTSYFYALLFVRHPELRSLFP---------------AAMDTQRDRLLKALLTAAEHIDNTEVLVAYLQNLGRGHRKYGTRPEHYPAVGECLIGALNKYASDVWDAETEAAWVRAYTTISQVMIDAAAAD 190
315 5.000e-40UniRef50_A0A1L7T827 Probable flavohemoglobin n=21 Tax=Fusarium TaxID=5506 RepID=A0A1L7T827_FUSMA  ali  14  3LTTSQVDIVKSTAPVLKIHGETITSLFYKNLIGTYPELRNIFNLSHQHDG------------AQAKALAGAVLAYATYIDKPEFLASTIERIAQRHVSLKVTEDQYALVGEQLIKAIGEVLGDTLTDDIADSWTAAYGQLANIFI...... 135
316 5.000e-40UniRef50_R7V3H8 Uncharacterized protein (Fragment) n=5 Tax=cellular organisms TaxID=131567 RepID=R7V3H8_CAPTE  ali  17  1LSEQTIQIVKATAPVLAEHGETITRHFYQQMFSQNPELLNIFNATNQKTGRQQAALANAV------------YAYAANIDNLGVLTAAVQRIAHKHASFNILPEQYPIVGKHLLEAVAHVLGDAATDEILNAWKEAYGFLAALFIEVEE.. 137
317 6.000e-40UniRef50_G8SE21 Flavohemoprotein n=146 Tax=Actinobacteria TaxID=201174 RepID=G8SE21_ACTS5  ali  27  6......RLLKESWSLVEEHQDKVAGYFYARMFLSYPDLRDLFPV---------------QMDVQRTRLLHAIVTAVQTLEDPERFEDYLRSLGRDHRKFHVLPEHYEVVGGALIESMRAFAGEQWGVEYDQAWADAYAVIAAKMLAGAESD 135
318 6.000e-40UniRef50_I2K714 Nitric oxide dioxygenase n=2 Tax=Proteobacteria TaxID=1224 RepID=I2K714_9PROT  ali  20  3LSQSTITTVKATAGAVSQHAEAITTKMYEILFSQHPELKELFKDADPD---------------QHKKLASAVGAYAANIDNLDVLSKAVEKMAQSHVRTHVKPEHYPMVGTAILGAIKEVLGDAATDEILDAWKEAYFFLADILIAREKE. 137
319 6.000e-40UniRef50_A0A2N9N0S6 Uncharacterized protein n=2 Tax=Candidatus Sulfopaludibacter sp. SbA3 TaxID=2043164 RepID=A0A2N9N0S6_9BACT  ali  26  9LSERQKRLVRESFESIGEYSDSVVLLFYGRLFELAPQVRGLFKI---------------EIREQAVKLLDMLKTVVDALDRFEELRPQLAELGRKHAGYNVQPAYYQVLVTALMWAFGQALGLEFTRETRTAWEALLGAISSVMLEGAA.. 142
320 6.000e-40UniRef50_A0A1Z4ISC4 Uncharacterized protein n=4 Tax=Cyanobacteria TaxID=1117 RepID=A0A1Z4ISC4_9CYAN  ali  24  1MSSLNVKLLEKSFAGIKPYATQFASRFYYNLFTDNPQLEPLF--------------ANTNMQEQDKKLMMTLVLVIYNLRNFAYLKTILRDLGERHVRYATIEEHYPMVGTALLKTFEFYLGTDWTPEVKQAWTDAYAEIVNIMLEG.... 133
321 6.000e-40UniRef50_A0A142BGA4 Flavohemoprotein n=3 Tax=Endozoicomonas TaxID=305899 RepID=A0A142BGA4_9GAMM  ali  14  3LSAETVQTVKATVPVLEEHGVAIVEYFYKDMLSENPELLNVFNAANQRSG------------RQQAALTGAIYAYAANIDNLDALTSTVQRIAYKHVSFNILPEHYGIVGRHLIKAMAHVLGDKASSRILDAWSEAYNYLASLFID..... 136
322 6.000e-40UniRef50_UPI000B912BAA cytoglobin-1-like isoform X1 n=3 Tax=Acanthaster planci TaxID=133434 RepID=UPI000B912BAA  ali  24  43LTKEQKEHIRKSWAVVCTMKTKFGVELFAKLFTNYPSSQQHFAQLKD-LKDIDVLKKNPKMRAHGYRVVSAFCSLVENLDTPDIFIELLKNTGYSHSMRNVPHHYFEELGLVFLEVMSEQLGDKFTPKAKEAWGLAYGFMCKVILGAMDE. 191
323 6.000e-40UniRef50_A0A165T7F8 Hemin receptor n=1 Tax=Halioglobus sp. HI00S01 TaxID=1822214 RepID=A0A165T7F8_9GAMM  ali  25  1MPPEQIHLVKTALAAMTPIAEQAADTFYARLFEQNPPYRALF---------------TGDMRAQGKMLIAILNTTVMSIDRREAVVPAIQALGKRHVGYGVTAADYDAVGEALLWTLARWLGEAFTPDTRTAWTTTYSVLADTMNEAAA.. 134
324 6.000e-40UniRef50_A0A0P7CHQ3 Hemin transporter n=4 Tax=Actinobacteria TaxID=201174 RepID=A0A0P7CHQ3_9ACTN  ali  24  2LSIESAAVVRATAPVVAAHSVEITSAFYPRLFSAHPELLRLFNQGNQANGD------------QRRALAASVVAYATQLIDPQAFQPVLERIAHKHASLGVLPEQYTVVGRNLLAAVGDVLGDAVTPEIAAAWDEVYWLFACQLIA..... 137
325 6.000e-40UniRef50_A0A2R5GMN0 Flavohemoprotein n=1 Tax=Aurantiochytrium sp. FCC1311 TaxID=2023137 RepID=A0A2R5GMN0_9STRA  ali  19  3LSRKTIDVVKATAPVVAEHAVEITSTFYPLMFKNNPEVLTFFNKGHQKEG------------RQPRALADAVVAFASHIEDLGAIKPAVDKIAARHVALSVKPEHYAIVHKNLMAAIGQVLGDAVTPEIGQAWSDAVLALAGICIDAEEA. 140
326 7.000e-40UniRef50_V4PJ00 Uncharacterized protein n=3 Tax=Bacteria TaxID=2 RepID=V4PJ00_9CAUL  ali  27  1MTPAQIRLVQASHAEVVTLGATAAEVFYTHLFVLDPSLKPMFR---------------SDLAAQGKKLLQALNFVATQLHQPERILPAVRELGLRHVAYGVQPEHYVTVGAALIATLAQALGERFDLATRQAWTEAYGLLSSTMIDAA... 133
327 7.000e-40UniRef50_A0A1D7UZS6 Hemin receptor n=5 Tax=Leptospira TaxID=171 RepID=A0A1D7UZS6_9LEPT  ali  31  6...EEIELVRASFEKVYTNKDEVAALFYSKLFELEPSYKSLFK---------------GDMNEQGRKLMLMLRTLVSGLGDLANLVPVIQDMGKRHVKYGVQSKDYDVVGAALLATLQQGLGAEFTPKLRGLWTDIYQIVAKTAIEGSQQ. 137
328 7.000e-40UniRef50_A0A0L0FSV3 Uncharacterized protein n=1 Tax=Sphaeroforma arctica JP610 TaxID=667725 RepID=A0A0L0FSV3_9EUKA  ali  20  48LSQKTIDIVKSCAPVLEVHGYDIAANMYKRMFANHPEVAELFNPSHQVPNKDGKAM-------QPWGLSCAVHAYALYIDDLGMLAEAVERIAQKHVSLDVLPEHYGIVGENLLWSIKDTLGDAATPEIMAAWEEAYGFLAWVFIQ..... 186
329 7.000e-40UniRef50_D3D7N7 Transcriptional regulator, ArsR family n=5 Tax=Frankia TaxID=1854 RepID=D3D7N7_9ACTN  ali  24  322LSIESAAVVRATAPVVAAHSVEITSAFYPRLFTAHPELLRLFNQGNQANGD------------QRRALAASVVAYATQLIDPQAFQPVLERIAHKHASLGVLPEQYTIVGRNLLAAVGDVLGDAVTPEIAAAWDEVYWLFACQLIA..... 457
330 8.000e-40UniRef50_A0A2G2G493 Uncharacterized protein n=1 Tax=Arcobacter sp. TaxID=1872629 RepID=A0A2G2G493_9PROT  ali  20  1MTQNTMEIIKATAPVIKEHGEAITTAMYKLLFEAHPEAKELFKDAEPD---------------QYKKLAAMVYAYAANIDNLGALGKGVEKVANLHVNVNIEPKHYPWVGQALLGAIQEVLGEAATPEIMNAWKEAYFFLADVFINKEKE. 135
331 8.000e-40UniRef50_A0A225B4J8 Uncharacterized protein n=2 Tax=leotiomyceta TaxID=716546 RepID=A0A225B4J8_9EURO  ali  18  3LTEEQINIIKATVPVVQEHGNTITSVFYKNMLHENPELNNYFNTTNQLNGHQQGALARAL------------YAYAANIDNLAVLGPAVETITHKHASLHILPEHYKVVGTYLLAAMKEVLGDALTPDIHDAWAAAYWQLADLFIAKED.. 139
332 8.000e-40UniRef50_B3DUZ1 Hemoglobin-like flavoprotein fused to Roadblock/LC7 domain n=3 Tax=Methylacidiphilum TaxID=511745 RepID=B3DUZ1_METI4  ali  32  1MTREEIKMIQKSWLRVIDKMDEAGLLFYRRLFDVEPKVRPLFKI---------------DIEKQGRKLMDVLNWIVLNLQDIDAALDAARELARRHVKYGVKAEHYPVVGHTLIWTLRKMIGSEWTKQLEQLWTQAYEALAQVMIE..... 131
333 9.000e-40UniRef50_A0A0M6YRD6 Soluble cytochrome O n=1 Tax=Labrenzia alba TaxID=311410 RepID=A0A0M6YRD6_9RHOB  ali  26  1MNRREIKIVQETFGKAATLGDKVPEIFYQELFAIDPTLKKMFR---------------GNMKSQGRKLLTALTMVVNNLEHTDVIVPAAEKLAVKHIDYGVTERHYTFVGNALLRTLKKGLGDEFTPEVRNAWISAYQLLADVMRAAA... 133
334 9.000e-40UniRef50_A0A1Q7BWH8 Flavohemoprotein n=1 Tax=Actinobacteria bacterium 13_2_20CM_2_71_6 TaxID=1803494 RepID=A0A1Q7BWH8_9ACTN  ali  26  6......RLLKESWTLVEEHQDRVAGYFYARVFLSHPQVRDLFPV---------------QMDVQRARLLGAIVTAVQTLDDPERFDEYLRSLGRDHRKFHVNPEHYDVVGAALIESLRTFAGEHWSIEYDQAWRDAYAVIARKMMAGAEE. 134
335 9.000e-40UniRef50_A0A2P9HXX3 Flavohemoprotein (Hemoglobin-like protein) (Flavohemoglobin) (Nitric oxide dioxygenase) n=12 Tax=Actinobacteria TaxID=201174 RepI  ali  24  23......RLVKESFSVVEPMADKATAYFYGRLFAENPHLRGMFP---------------PAMDVQRDRLFGALTRIVWSLDSPDSLAAFLGQLGRDHRKYGVIAEHYTAVGNALLATIRRFAADVWNHEIEAAWVSAYTAAANLMIESAESD 152
336 9.000e-40UniRef50_E5A9L7 Uncharacterized protein n=1 Tax=Leptosphaeria maculans (strain JN3 / isolate v23.1.3 / race Av1-4-5-6-7-8) TaxID=985895 RepID=E5A9L7_  ali  19 1149LTPDQVAIIKATVPVLAEHGITITSKFYADMLTAHPELKNVFNNTHQVTGHQPAALAGAL------------YAYASNIDNLGALSPAVELICHKHASLFIRPEQYDIVGEYLLKTMATVLGDAATPEILNAWGAAYWQLADIMI-GAEA. 1285
337 1.000e-39UniRef50_A0A168BN42 Flavohemoprotein n=5 Tax=Hypocreales TaxID=5125 RepID=A0A168BN42_9HYPO  ali  20  3LTPSQVTIVKSTAAVLKDKGGEITRIFYANMLAAHPELRNLFSLRNQATGAQQAALGAAVL------------AYAAYIDDLPRLQSAVERIAHKHASLFVRPEQYAIVGEHLVGAFAEVLGDALTPEVADAWTAAYAQLADVFI...... 135
338 1.000e-39UniRef50_A0A0F4K3A3 Flavohemoprotein (Fragment) n=1 Tax=Streptomyces sp. NRRL S-444 TaxID=1609134 RepID=A0A0F4K3A3_9ACTN  ali  26  2....DARILKSSFAVVERRAEHAVKYFYSHLFWHNPGIRELFPSS------------GEDMERQRDRLFAALTHVVAHLDD-EGLLPYLHHLGRDHRKFLARPEHYAAVGSSLLAALARTSGEAWTPGVEKAWSEAYQVIADAMMEGAAA. 134
339 1.000e-39UniRef50_A0A254W6J0 Uncharacterized protein n=1 Tax=cyanobacterium TDX16 TaxID=1503470 RepID=A0A254W6J0_9CYAN  ali  30  5.....VELLESSFAQIKVNSLEVTKQFYTVLFTDYPEVQPLF--------------ANTNMEKQRKQLFQSLVFTVNNLGKPATLSDTLRGLGTRHTQYGVLPQHYPMVGSSLLKAFEVSLGTAWTPDVQQAWTEAYEVVTQLMLKGAD.. 134
340 1.000e-39UniRef50_I0JWG1 Hemoglobin-like flavoprotein fused to Roadblock/LC7 domain n=1 Tax=Methylacidiphilum fumariolicum (strain SolV) TaxID=1156937 RepID=I  ali  29  1MTQERIKLIQKSWLYVMDKADEAGRLFYKRLFEVEPNVRSLFK---------------ENIEKQGKKLIDVINWIVLNLQDIDTVFGGAKELARRHVRYGVQVEHYPLVGHTLIWTLGNIIGKEWTKELEQAWTEAYEALSQVMIE..... 131
341 1.000e-39UniRef50_A0A1I6PAG7 Methyl-accepting chemotaxis protein n=73 Tax=Bacteria TaxID=2 RepID=A0A1I6PAG7_9RHIZ  ali  28  690.SAAQVAIVQRSFATVQALGDTAAELFYGRLFDIAPQVRSLFPD---------------DMTAQKRKLVAMLALAVANLDKPEALVAAVRDLGDRHVGYGALQAHFEAVGAALLWTLEQGLGPDFTPEVREAWTETYRVIAGLM....... 817
342 1.000e-39UniRef50_K9YEZ7 Globin n=1 Tax=Halothece sp. (strain PCC 7418) TaxID=65093 RepID=K9YEZ7_HALP7  ali  23  10.....VELLENSYSEIRPRANEFAISFYQNLFSLYPETQPLF--------------AHVDMAKQQQMLISALNLVVKNLRKPNLFKQTLKGLGSRHVRYGALPEYYPLLKEALLKTFQDYLQDRWTAETRQAWTEAFDAITKLMLDGY... 138
343 1.000e-39UniRef50_A0A244CTZ1 Hemin receptor n=1 Tax=Pseudoalteromonas ulvae TaxID=107327 RepID=A0A244CTZ1_9GAMM  ali  30  1MTPVQVELVQSSWEKVVPIAKQAADLFYGRLFELNPQLKRLFKD---------------DIDEQGKKLMQILTTVVRGLKQFDRLEMAVWQLGRRHQVYRIAPEDFNTVAEALLWTLEQGLQRAFTPDVKQAWVEAHTIVASVMQAGM... 133
344 1.000e-39UniRef50_UPI000C047112 uncharacterized protein LOC111298175 isoform X5 n=1 Tax=Durio zibethinus TaxID=66656 RepID=UPI000C047112  ali  20  209.TEEQEALVVKSWNSMKKNAGELGLKFFLRIFEIAPSAKKLFTFLRDSDIPLEQ---NPKLKPHAMTVFVMTCESAIQLRKTGKVESSLKDLGATHFKYGVVDEHFEVTKFALLETIKEAVPEMWSPEVKNAWGEAYDQLAAAIKSEMN.. 356
345 1.000e-39UniRef50_UPI0006B0D619 non-symbiotic hemoglobin 2-like n=1 Tax=Limulus polyphemus TaxID=6850 RepID=UPI0006B0D619  ali  25  23LTPRQVELVRETWTLLSVDMTATGIFIFNRFLTDYPELCDLFPFVSIAN-DGRYIWDDQGLERHALGVMQALEGAVNNLENTQLLSTILFDLGQKHARYNVEESMLDKLWRSLRGSLKEALQEKMTDEVEHAWFCVFRFVARQMIDGMR.. 170
346 1.000e-39UniRef50_A4XYB2 Flavohemoprotein n=837 Tax=cellular organisms TaxID=131567 RepID=A4XYB2_PSEMY  ali  17  2LSHAQRDLIKATVPLLESGGEALTTHFYRMMLSEYPEVRPLFNQAHQASGD------------QPRALANGVLMYARHIDRLEALGPLVAQIVNKHVSLQILPEHYPIVGTCLLRAIREVLGAEATDAVIEAWAVAYQQLADILIGAEESQ 141
347 1.000e-39UniRef50_A0A0P5J1V4 Neuroglobin n=3 Tax=Daphnia magna TaxID=35525 RepID=A0A0P5J1V4_9CRUS  ali  26  50LTDLQKTLLQQSWKRLEMDIAQVGIIVFINLFESHPDMQSVF--LPFTGLVLDDLKKSKLLSEHALRVMGAVQRAVHRLEEPEKLHAFLSDLGRRHDKNGAKLEYIDYIGPQFLSAIRPILGGDWTAETEKAWTLLLGYMIATMKQALLE. 197
348 1.000e-39UniRef50_UPI0005EDA302 uncharacterized protein LOC100889989 n=1 Tax=Strongylocentrotus purpuratus TaxID=7668 RepID=UPI0005EDA302  ali  28  311..AREQELVQKTWGVLSLDTEQHGAAMFAKLISAHPAVAQMFPFG--ENLSYSQLVQNPTLRAHGKRVMETIGQTVGSLDDLDILVPILRDLARRHVGYSVTRQHFEPVGEALMHAIQEGLGRSFSEEVERAW.................. 439
349 1.000e-39UniRef50_K9VX73 Globin n=8 Tax=Cyanobacteria TaxID=1117 RepID=K9VX73_9CYAN  ali  29  5.....VELLEQSFEKIKPHADEFAASFYENLFQLYPEVQPLF--------------ANTEMAKQQKKLLNALVLVVENLRSPEALEPVLKVLGERHIGYGAIANSYPAVGEALITTFEQYLQQDWTTEVKQAWIDAYGAITALMLKGA... 133
350 1.000e-39UniRef50_F5UFD7 Globin n=6 Tax=Cyanobacteria TaxID=1117 RepID=F5UFD7_9CYAN  ali  26  174.....VEILESSFEKVKPRADEFAASFYENLFIAHPEFKPLF--------------ANIELEKQQKKLINALVLVVENLRSPEALGPVLNALGGRHIGYGVIPKYYGPVGDALLMSFEQSLQEDWTPEVKLAWTDAYRAITGLMLKGAGAD 305
351 1.000e-39UniRef50_A0A1A8MK29 Neuroglobin n=3 Tax=Clupeocephala TaxID=186625 RepID=A0A1A8MK29_9TELE  ali  61  10.............................RLFELDPELLSLFNYST-NCGSKQDCLSSPEFLDHVTKVMLVIDAAVSHLDDLHSLEEFLLNLGKKHQAVGVSKQSFAVVGEALLYMLQCSLGQAYTAPLRQAWLNMYSIVVSAMSRGW... 127
352 2.000e-39UniRef50_UPI000B794C43 non-symbiotic hemoglobin 1-like isoform X1 n=1 Tax=Hevea brasiliensis TaxID=3981 RepID=UPI000B794C43  ali  19  90.TEEQEALVVKSWNSMKKNSGELGLKFFIKIFEIAPSAKKLFSFLNDSDVPLEQ---NPKLKPHAVTVFVMTCESAVQLRKAGKVESSLKDLGATHFKYGVVDEHFEVTKYALLETIKEAVPEMWSPEMKNAWAEAYDQLAAAIKIEMK.. 237
353 2.000e-39UniRef50_UPI0008350B6C flavohemoprotein n=1 Tax=Actinoplanes sp. TFC3 TaxID=1710355 RepID=UPI0008350B6C  ali  26  6......RLLKESWSLVEENQDKVAGYFYARMFLSNPELRELFPVY---------------LEAQRTRLLRAIVTAIQTIEDPDRFDSYLHALGRDHRKFHVEPEHFEVAGGALLEALRHYGGEQWSIEYDQAWADAYTVISTKMIAGAAAD 135
354 2.000e-39UniRef50_Q87F90 Flavohemoprotein n=49 Tax=Proteobacteria TaxID=1224 RepID=HMP_XYLFT  ali  18  6.SPHTITLIKSTVPLLAEHGTTIIEAMYHRLFE-DPQIEALFNQANQKNGT------------QIHALAGAILAYARNIDNPGVLASAIERISQKHVGYAIHPEHYPHVATALLGAIKQVLGDVATSEVLEAWGEAYWFIANLLKD..... 137
355 2.000e-39UniRef50_A0A2W1JHN3 Bacterial hemoglobin n=2 Tax=Acaryochloris sp. RCC1774 TaxID=1764569 RepID=A0A2W1JHN3_9CYAN  ali  26  16.SPMNIELLERSFEQIRPQAIAFSNHFYETLFRHNPGIKPLFANISQ--------------QAQGKKLIFSLAAIIENLRSPEVLEPALKSLGARHFEVGTLEEHYPLVGQALFETFAAYLGSDWTPATMDAWQEAYEAIATIMLEGAQ.. 149
356 2.000e-39UniRef50_UPI000B5A9DAB hemin receptor n=1 Tax=Granulosicoccus antarcticus TaxID=437505 RepID=UPI000B5A9DAB  ali  29  3..PHQHHLVRESWKKLSPIRDTAAELFYQRLFSVYPELAPMFK---------------GDMKVQGEKLMQMLDKAVDSLENMESSIEPLKQAGRAHRSYGVNEEDYEKFANCLFWTMKEGLGKAFDAPTREAWANTYATLSSIMIEGAN.. 134
357 2.000e-39UniRef50_A0A0K8RR11 Uncharacterized protein (Fragment) n=10 Tax=Ixodoidea TaxID=297308 RepID=A0A0K8RR11_IXORI  ali  22  51LTPREKGLVRDTWALVRKDVKANAIAIFLTLFQRHPEYQKLFSG--FADVPPEALSTNPRLGAHAMSVAYAITSLVDSLDDAECLVELVRKVAVNHTRRPVSVTHFENLTVVIVDTLKERLGGKMSPAAVAAWEKTLRLVVTVTADVYKEQ 199
358 2.000e-39UniRef50_Q8ZCR0 Flavohemoprotein n=995 Tax=root TaxID=1 RepID=HMP_YERPE  ali  19  2LDTQTIAIVKSTIPLLAATGPKLTAHFYERMFKHHPELKNIFNMSNQSSGD------------QREALFNAICAYATNIENLAALLPTVERIAQKHTSLNIQPEHYPIVGEHLIATLDEL----FSPAVLDAWAKAYGVLADVFIQ..... 133
359 2.000e-39UniRef50_F0XSA6 Flavohemoprotein n=1 Tax=Grosmannia clavigera (strain kw1407 / UAMH 11150) TaxID=655863 RepID=F0XSA6_GROCL  ali  23  3LTYKQSKLVRESIPHLREHGERISSIFYATMLDEHPELRSYFNTVNQQNG------------RQPRALTTIILAFATNISHTSELIPRLERVCHKHCSLGIQPQQYAIVGEYLIRAFRDVLGTAMTTELQSAWTDAYCVLARMMM...... 135
360 2.000e-39UniRef50_V4ABF4 Uncharacterized protein n=1 Tax=Lottia gigantea TaxID=225164 RepID=V4ABF4_LOTGI  ali  20  2......DLVRETWNIAREDIARVGVVAFLSLFEKYPETQNIF--LPFRGLTVDELQHSARLREHGLRVMLTVEKCIARLDKPEKLQDLLHDLGQKHVEFNTKVDYIDMVGPQFIQAIRPVVKSDWTPEVEDAWEDFFKLLIYFMKEAM... 141
361 2.000e-39UniRef50_A0A2U1VPX2 Uncharacterized protein n=1 Tax=Azospirillum sp. TSO22-1 TaxID=716789 RepID=A0A2U1VPX2_9PROT  ali  37  1MSPDDMETVRRSFCKVAMLNARVGLQFYERLFALDPDLRALF---------------GEDVHPQAEKLVATLASAVRHLSNPAALEGSLRAMGERHRGYGVRDEHYATVGEALLSTLETNLGPEFTPDVRGAWLALYGMVARMMR...... 130
362 2.000e-39UniRef50_A7RJ19 Predicted protein n=1 Tax=Nematostella vectensis TaxID=45351 RepID=A7RJ19_NEMVE  ali  27  39LTERQIKLVQDTWRLLIPSQKKTAMIFYLKLFTLDPIFKEVFS---FHTENEGQLEQDERFLFQSRKFMEMINSAVDRLNDISLLVMILKSLGEVHTKFKIKPEYYEPVGKALIYSISKGLGSLFNDEIGEAWQAMYDLMSGAMISGTKA. 186
363 2.000e-39UniRef50_V8QYU3 Dihydropteridine reductase n=33 Tax=Proteobacteria TaxID=1224 RepID=V8QYU3_9BURK  ali  19  9LSPETVAIVKATVPALQTHGSAITAKMYDRLFRDE-HIRSLFNHANQANG------------KQINALAGAILAYASNIDNLGALLPAVERIAQKHVGFHILPEHYPYVATALLGAIGDVLGEAATEDILNAWGEAYWFLAGIL....... 139
364 3.000e-39UniRef50_B7FYB0 Predicted protein n=1 Tax=Phaeodactylum tricornutum (strain CCAP 1055/1) TaxID=556484 RepID=B7FYB0_PHATC  ali  20  5ISDESFQLVRATAPVVAEHIEEITGTFYPKMLGRHPELYQFFNESNQRAVPGLCPAASGVVTRQSKTLGDAVVQYALNIDKLENLNEAVLRIAHKHCALGVKAEHYQIVHDNLMEAIGEVLGSAVTPEVAAAWSEAVMALGKIFIE..... 151
365 3.000e-39UniRef50_A0A2P8ADH4 Flavohemoprotein n=36 Tax=Streptomycetaceae TaxID=2062 RepID=A0A2P8ADH4_9ACTN  ali  28  46.TDEDVALVRASLTVVTPHVSELAAHFYSILFSRYPQVRDLFP---------------AELDVQRERLVRALLRIVELVDDPDNLVAFCSRLGRGHRKFGTQSGHYPAVGECLLQALSHFAGPAWHPALATAWQRAYTAAADVMVRAAEED 180
366 3.000e-39UniRef50_UPI0001CB9E5C extracellular globin-E1-like n=1 Tax=Saccoglossus kowalevskii TaxID=10224 RepID=UPI0001CB9E5C  ali  25  33LTARQKFSIQKSWKAIQRNMEGVGMDIFIRLFKAHPEYQDLFPE--FKGMSEEKLRNSINFETHVGIFMNVIDECIDSLEDADHVINLLTKKGRKHANYGVKPEFISDIEEPFLASVKQLLEDRYSEKIEEIYKLTIKFILEHFINGLKE. 180
367 3.000e-39UniRef50_A0A239UBQ6 Putative flavohemoprotein n=188 Tax=Staphylococcaceae TaxID=90964 RepID=A0A239UBQ6_9STAP  ali  19  2LTEQEKDIIKQTVPVLQDKGVEITSFFYNRMFNEHPELRNMFNQTNQKKG------------LQSTALAQTVLAAAANIENLGAIMPVVREIAYKHCALQVPPAGYEIVGENLIAAIMEVLGLEEDDPVIKAWTNAYWEIANVFIDVEKQ. 139
368 3.000e-39UniRef50_A0A0J9XEW3 Similar to Saccharomyces cerevisiae YGR234W YHB1 Nitric oxide oxidoreductase n=1 Tax=Geotrichum candidum TaxID=1173061 RepID=A0A0  ali  16  3LTPDQISVIKATIPVLKEGGVTLTTKFYENMLNEKPEVRPFFNPAHQASG------------MQPKALAHSLLLYATYIDDLGKLSDLVERIVSKHVTLLIQPDQYPIVGEYLIRTMKEVLGDLATDEVIGAWTAAYGDLANLLID..... 136
369 3.000e-39UniRef50_A0A1S6J0W9 Neuroglobin (Fragment) n=4 Tax=Sternopygoidei TaxID=1489621 RepID=A0A1S6J0W9_EIGVI  ali  52  2...KDKQLIRDSWESLGKNKVPHGIVMFTRLFELDPALLSLFSY-KTKCGVASDCLSSPEFLEHVTKVMVVIDAAVNHLDDLHSLEDFLLNLGKKHHDVGVKTQSFAVVGEALLHMLQCSLGAGYTTALRQAWLNMYSIVVSAMTRGWA.. 146
370 3.000e-39UniRef50_R7UKY8 Uncharacterized protein n=1 Tax=Capitella teleta TaxID=283909 RepID=R7UKY8_CAPTE  ali  26  20LTDKDKLLIRRNWKHLACNLTERGARVFLRIFVDNPSVKDLFP---FKKLQGEELTRDVNFRGHASRFMQAVGAVVDNIDDFEQLAPLLNGLGRKHIDHGFTPTHFNAFQDAMLAVWSEDLGGKLTPEGRDAWIKVFGFIMRELKKGY... 166
371 3.000e-39UniRef50_UPI00041900BD flavohemoprotein n=2 Tax=Pseudonocardiaceae TaxID=2070 RepID=UPI00041900BD  ali  30  26......ELTRRSWAVVEPRADEVGSQFYAILFHIAPEVRDLFPVN---------------LEVHRSRLIRALVHVAHQTDDMDELLPFLHQLGRDHRKFGVRPEHYDAVTTALVGGIRKVSGEAWTPEVEDAWRETLALAATAMRTAADTE 155
372 3.000e-39UniRef50_UPI000C03C159 cytoglobin-2-like n=1 Tax=Stylophora pistillata TaxID=50429 RepID=UPI000C03C159  ali  19  29LTDEQIKILKETWGIIEPTKKEIGVNVYIRFLKMNPDIKSRF--TEFKEISIEEINKNN---GHPRRLMAAIENSICSLYDPETFAGYVLELGRRHVRLRFKPSHFIDLRKAFISTIKEFLTTDWRPEVEESWVLLFDFMAAVMMKGFNA. 175
373 3.000e-39UniRef50_P49852 Flavohemoprotein n=1418 Tax=root TaxID=1 RepID=HMP_BACSU  ali  22  2LDNKTIEIIKSTVPVLQQHGETITGRFYDRMFQDHPELLNIFNQTNQKKKTQRTALANAVIAAAANI------------DQLGNIIPVVKQIGHKHRSIGIKPEHYPIVGKYLLIAIKDVLGDAATPDIMQAWEKAYGVIADAFI...... 134
374 3.000e-39UniRef50_A0A076MRI5 Globin n=2 Tax=Amycolatopsis TaxID=1813 RepID=A0A076MRI5_AMYME  ali  32  2....DIPRLRASWATVAERGDEVPLWFYATLFLLRPSLRDLFPVS---------------LASQRTRFVSALGQIVTHVDDLDAAVPYLRRLGRTHREAGVRPEHYPVVGQALLATLEHFLGERWTPELAADWTSAYAVVAEVMTNA.... 129
375 4.000e-39UniRef50_I3CJ89 Hemoglobin-like flavoprotein n=2 Tax=Beggiatoa TaxID=1021 RepID=I3CJ89_9GAMM  ali  26  2LKASDIQLVCRSWEKLSPNIPELGQKFYKNLFTLDPSLKTLFK---------------GDLTEQSIHFMHIMDTIVNAIDKVDDLSDVVARLGVRHVGYGVQEADYAVFGKALLMTIEQTLADAFTPELKQAWENTYNTLAELMKKGAEA. 139
376 4.000e-39UniRef50_A0A0B6YIN5 Uncharacterized protein n=4 Tax=Mollusca TaxID=6447 RepID=A0A0B6YIN5_9EUPU  ali  28  22LTARQLELVQDTWDVMKQDLPTLGLTVFVKLFQTEPDLKRLFPKIVQMNEKNEEWEVDKDMQRHAVTVMEGLGAAVESLDDSDFLNSVLVSIGQTHVRRSVKPQMLRRLWPSLNHGFEKILGEQYTKETMEAWRRLYNYIIFQMKKGMQD. 173
377 4.000e-39UniRef50_A0A239E2Y4 NAD(P)H-flavin reductase n=4 Tax=Actinomadura TaxID=1988 RepID=A0A239E2Y4_9ACTN  ali  25  2....DAQRLKDSFDRVAEQGDAVALFFYSDLFVRNPHLRDMFPVG---------------MSGQRDKLLRALGHIVARVDDLPALVPFLQQLGRDHRRFGIVAEHYPHVGASLLATLRHFAGDGWTDDVEGDWNAAYSLVAKVMLEAADE. 132
378 4.000e-39UniRef50_A0A1Z4S992 Globin domain protein n=6 Tax=Terrabacteria group TaxID=1783272 RepID=A0A1Z4S992_9NOSO  ali  25  5.....VEVLEQSFQQVKPRASEFVTSFYDNLFIAHPEVKPLF--------------ANIDMARQHNMLLNALVLVVENLRKPEVLGQALKGLGARHVGYGASPQHYGAVGEALLVTFEEYLQQDWTPEVKQAWLGAFEVIEAEMLQGAGE. 135
379 4.000e-39UniRef50_A0A2E0L7P3 Hemin receptor n=1 Tax=Anaerolineaceae bacterium TaxID=2024896 RepID=A0A2E0L7P3_9CHLR  ali  30  3ITQIQIRLVRRSFGRAATKKRLIAALFYDRLFELDPALRPMFK---------------GDMEEQGRKFMRMLALIVSHLDNPDQLKTKLQSSNQRHTTIGVRPEHYETVGAALLWALEMGLGKEFTPAMREAWLTAYEIIAQL........ 130
380 4.000e-39UniRef50_A0A2H5B1T3 Oxidoreductase n=2 Tax=Streptomycetaceae TaxID=2062 RepID=A0A2H5B1T3_9ACTN  ali  27  6......AVIRASFAIVELRADHAAKYFYTHLFAHNPELRQLFP---------------ADLAEQRDRLFASLTELVLRTDDLDGLTGYLRALGRDHRKFQAQPEHYPAIGASLIAALRQFSGHSWTPEIEKAWTEAYTVISQVMIEGA... 132
381 4.000e-39UniRef50_A0A022RUM2 Uncharacterized protein n=4 Tax=Erythranthe guttata TaxID=4155 RepID=A0A022RUM2_ERYGU  ali  20  68.TEEQEALVTKSWNIMKKNASELGLKFFLRIFEIAPSAKKLFSFLNDSDIPLE---LNPKLKPHAITVFVMTCESAVQLRKAGKVTSTLRDLGTTHFKYGVADEHFEVTKYALLETIKEAVPEMWSPEMKCAWADAYDQLVAAIKLEMN.. 215
382 4.000e-39UniRef50_UPI0009B12FDE hypothetical protein n=1 Tax=Spirosoma rigui TaxID=564064 RepID=UPI0009B12FDE  ali  24  30MTPMQLAAIKSSWALAVPHADAVGKAFYANLFTIDATLRPMF---------------ADDINGQSGKFVAMVTRLVNHLDDADTVTREITGLAQRHTHYGVRPAHYTTAGQALVQTLSDGLGEHWTPPVQEAWGALYQTIASAMISGAAEQ 166
383 4.000e-39UniRef50_A0A087UB53 Globin (Fragment) n=1 Tax=Stegodyphus mimosarum TaxID=407821 RepID=A0A087UB53_9ARAC  ali  22  27LTPRQKDIVRNTWKSIRADTRNNGIKLFLKFFEAYPEYQLLFK--SFANVPLSDLPRNGRLLGHVTSVMYALNSVVDNLEDPECLIEILQKTGISHRPRNVNRQHFNNLKVVLIKLLVEILGSNMNESAVEAWEKTLDVANSIIIKSLEAE 176
384 4.000e-39UniRef50_A0A2K6V6J0 Neuroglobin n=2 Tax=Saimiri boliviensis boliviensis TaxID=39432 RepID=A0A2K6V6J0_SAIBB  ali  97  66..............................LFALEPDLLPLFQYNCRQFSSPEDCLSSPEFLDHIRKVMLVIDAAVTNVEDLSSLEEYLASLGRRHRAVGVKLSSFSTVGESLLYMLEKCLGPAFTPATRAAWSQLCGAVVQAMSQGWDGE 186
385 5.000e-39UniRef50_M2X487 Nitric oxide dioxygenase n=1 Tax=Galdieria sulphuraria TaxID=130081 RepID=M2X487_GALSU  ali  31  9...EEIQIVQQSWNKLEDRQYLIGEAFYHSLFETYPSVKPLFR---------------SDMEKQKRLLIHMINKGVKLLNDIDKLESALSSLGKRHIKYGVKEEHFPCVGETLLKVLKQFLGDEFDEKTLKAWESVYQYWAVFMLDGMK.. 139
386 5.000e-39UniRef50_S9QGF4 Putative bacterial hemoglobin n=2 Tax=Salipiger mucosus TaxID=263378 RepID=S9QGF4_9RHOB  ali  30  2LTQGEIKAIRASWLLVAANRAELGERFYKNLFRAAPEVRPMFTNGP---------------RVQGRKLMETLAIVVDSLDDLAPLLPTIRQLGASHAALGVRPEHFDLVGRILLQTLVEAAGEEMPNGATDAWTKAYQAVASAMI...... 131
387 5.000e-39UniRef50_A0A1I2UKR5 Flavohemoprotein n=5 Tax=Oceanospirillaceae TaxID=135620 RepID=A0A1I2UKR5_9GAMM  ali  18  6.....IEIIKQTVPVIQERGEEITQHFYHLLFEENPELKDVFNMASQSNG------------RQPASLANAILGYAANIDRLAALGDAVNNIATKHFSLDIQPEQYPIVGRNLLKAIREVLGAEASDDVINAWAEAYGQLANILIGAEKA. 139
388 5.000e-39UniRef50_A0A2T6DZ03 Hemin receptor n=1 Tax=Opitutaceae bacterium EW11 TaxID=2161865 RepID=A0A2T6DZ03_9BACT  ali  34  20LTPEETHLIRTSFDAVLRRPVEAAAQFYEALFSEAPGVRGLF---------------HGDMRTQGQKLIATLSLLVSRLDDLPSLEPALAELGRRHRNYRVDRDHYSLVRRALLRMLSVNSGPEWSPAAECAWGRIYDHVAATMMAAADGQ 155
389 5.000e-39UniRef50_A0A1I6VYH6 Hemoglobin-like flavoprotein n=1 Tax=Yangia pacifica TaxID=311180 RepID=A0A1I6VYH6_9RHOB  ali  30  3LTPQNISDIRASWQVLAADADGFTADFYAALFRRDPGLRPLF--------------AHTDLPAQRKKLVAALALVVRHADDLSPVLGPLEEMGARHVGYGVKNSDYATVGGALIETMEAHLCEAFSSEIREAWTAAYGAVASTMMAGAQA. 138
390 5.000e-39UniRef50_A0A2D9KZA2 NO-inducible flavohemoprotein n=2 Tax=Methylophaga sp. TaxID=2024840 RepID=A0A2D9KZA2_9GAMM  ali  20  1MKPETFDIIHQTVPLLEQHGEQLADCFYKNMFRNNPEVNVFFNPAHQQSG------------AQQHALASVICAYARHIDNPGQLRQALEVIFHKHVSLGIKPEHYPIVGNNLLLTLREVLGEAATTEVIESWTEAYGVLAGIFID..... 134
391 5.000e-39UniRef50_A0A1W2DDC8 NAD(P)H-flavin reductase n=30 Tax=Actinobacteria TaxID=201174 RepID=A0A1W2DDC8_KIBAR  ali  25  35.....VRLIRESFAVVEPKADEVAKFFYGMLFSLSPNAREMFP---------------ANMEVQRSRLLRALVHIVQLVDRPDDLNPFLRQLGRDHRKFGVISAHYEAVGTALIAAVKKFSGKSWTDEIERAWAEAYTIMARAMLDSANTD 165
392 5.000e-39UniRef50_A0A1H8TRS9 Flavohemoprotein n=197 Tax=Bacteria TaxID=2 RepID=A0A1H8TRS9_9RHIZ  ali  17  5LTETTKAIVRATVPALTTNGTEITAAMYKRLFE-NSNVRDLFNQSNQGEEG-----------RQTKALAQAILAYAQNIDNLAVLTGAVERIAQKHVGLHIRPDHYPHVATALLGAIRDVLGEVATDDILNAWGEAFWFLANILI-GREKQ 142
393 5.000e-39UniRef50_A0A261RD21 Flavohemoprotein n=7 Tax=Proteobacteria TaxID=1224 RepID=A0A261RD21_9BORD  ali  20  2LSQEVRTLVKSTAPVLKTHGEALTCHFYARMFQHNPELKQVFNQGHQEGGQQQQALAAAV------------AAYAEHIDDPSVLAPVITRIVHKHVSLGIRPEHYAIVGKHLLASIREVLGEAATDELVAAWAAAYGQLADLLIA..... 135
394 5.000e-39UniRef50_B4WP36 Globin domain protein n=2 Tax=Cyanobacteria TaxID=1117 RepID=B4WP36_SYNS7  ali  26  4....DVELLEQSFELVKPKADDFVASFYNNLFTDYPDAKPLFEHTN--------------MAAQQQMLKGALVMVVDNLRRPEVLSKSLKGLGARHIKYGALPEHYPLVGNSLIKTLEQYAGPAWNSKLESAWAGAYSAITELMLEGA... 133
395 6.000e-39UniRef50_UPI000C04D831 non-symbiotic hemoglobin 1-like isoform X6 n=3 Tax=Durio zibethinus TaxID=66656 RepID=UPI000C04D831  ali  20  87.TEEQEALVVKSWNSMKKNAGELGLKFFLRIFEIAPSAKKLFTFLRDSDIPLEQ---NPKLKPHAMTVFVMTCESAIQLRKTGKVESSLKDLGATHFKYGVVDEHFEVTKFALLETIKEAVPEMWSPEVKNAWGEAYDQLAAAIKSEMN.. 234
396 6.000e-39UniRef50_A0A1W0WNA7 Uncharacterized protein n=1 Tax=Hypsibius dujardini TaxID=232323 RepID=A0A1W0WNA7_HYPDU  ali  23  71LTHEQKAMIRESFEVLKQTVGDVGVVFFMRLFETHPEVQDVF--VPFQGLSQEDLMHSHQLRNHGLRVMGFVEKCVARLEQPEKLVALCLELGARHAKYQVPAPYLLLIPPQFIYAIKPALNDKWSAEMEAAWGTLFRIAIYYM....... 212
397 6.000e-39UniRef50_UPI0009DA4C24 hypothetical protein n=1 Tax=Pannonibacter phragmitetus TaxID=121719 RepID=UPI0009DA4C24  ali  25  10.TPEQIRLVQASFDRLRPQGASIVSGFYCRFFELSPTLRPLFRTP---------------LPAQELRLLEALSAVISMLSNLQMLLPELEALAKRHVTYGVSAAHYHAAGDALLWTLERHLGEAFTPAVRSSWIAAYATLSDIMIASAE.. 142
398 7.000e-39UniRef50_W7YVL1 Flavohemoprotein n=2 Tax=Bacillus TaxID=55087 RepID=W7YVL1_9BACI  ali  18  4..QETIKTIKATAPVLAEHGLAITTHFYTLLLEQHPELWHVFNHANQKRGI------------QQQALADSLYAAAVHIEQLEAIVPVVKKIAHKHRSIGVQAEHYPIVGDYLLKAMKDVLKEDATDSILTAWEEAYSVIAKLFIE..... 135
399 7.000e-39UniRef50_UPI00047F7324 hemin receptor n=1 Tax=Mesorhizobium sp. WSM2561 TaxID=1040985 RepID=UPI00047F7324  ali  24  1MTPDQIRLVQDSFHEVLPIRVAAAALFYERLFAIDSDLRALF--------------LASDMPKQGAELMASLGSVVRGLDRANTVLPTVRELAKRHGACGFKEHHYPIVGQALIDTMAAGLGTAFTPAVGEAWEAAYALLASVMIAAARED 137
400 7.000e-39UniRef50_A0A1H8K2Y1 Nitric oxide dioxygenase n=3 Tax=Proteobacteria TaxID=1224 RepID=A0A1H8K2Y1_9BURK  ali  19  2LSVEQKAIITATVPILEQGGETLTRHFYLTLFRDFPHVKPFFNQANQQDGN------------QQRALANAVLMYAKNIDRLEQLGPLVSTIVNKHVSLQIQREHYPLVGASLLKAIREVLGDTATDAVIDAWAAAYGQLAD-ILAGAEQ. 139
401 7.000e-39UniRef50_A0A293MVL4 Uncharacterized protein (Fragment) n=2 Tax=Ornithodoros erraticus TaxID=265619 RepID=A0A293MVL4_ORNER  ali  23  18LTPREKNLVRDTWALVRKDVKSNAVAIFLMLFERHPSYQKLFSG--FADVPADQLASNPRLAAHAMSVAYALTALVDNLDDADCLVELVRKTAVNHTRRPVTLQHFENTVVVIVDTLKERLGNKMSPAATAAWQKTLRLVVSVTADVYKQQ 166
402 7.000e-39UniRef50_A0A226NW70 Uncharacterized protein n=2 Tax=Tetrapoda TaxID=32523 RepID=A0A226NW70_COLVI  ali  69  6LSRTQQALIRESWRRVSGSPVQHGVVLFSRLFDLDPDLLPLFQYNCKQFGSPQECLAAPEFLDHIRKVMLVIDAAVSHLEDLPCLEEYLCNLGKKHQAVGVKVESFSV........................................... 113
403 8.000e-39UniRef50_A0A2J5PGG5 NO-inducible flavohemoprotein (Fragment) n=4 Tax=Enterobacteriaceae TaxID=543 RepID=A0A2J5PGG5_KLEPN  ali  19  2LDAQTIATVKATIPLLVETGPKLTAHFYDRMFAHNPELKEIFNMSNQRNGD------------QREALFNAIAAYASNIDNLPALLPAVEKIAQKHTSFQIKPEQYNIVGSHLLATLDEMLG----QEVLDAWGKAYGVLANVFI-GREAE 137
404 8.000e-39UniRef50_K0RES8 Vesicle transport protein n=1 Tax=Thalassiosira oceanica TaxID=159749 RepID=K0RES8_THAOC  ali  27  152..ARRKGAIQTTWVAVGDSGIEATRLFYERLFDQHPEVKPMFSDPD-------------DMEEQAAKLLKTISVAVESLSDIATLVPILQDLGKKHAKWNVQRNHYDAVGECLIWTLKTGLGDSWTEDVADAWSWVYGVIAKTMGDAGQE. 288
405 8.000e-39UniRef50_A0A1G8ZND7 Nitric oxide dioxygenase n=1 Tax=Bradyrhizobium sp. Rc2d TaxID=1855321 RepID=A0A1G8ZND7_9BRAD  ali  28  1MNTAQRELVQTTFARLAVMPEVAGALFYERLLAKNPSFRPLFNNN---------------MRIQGLKLMSMLAMVVYNLPEPDQVSTALRDLAVRHVEYGVKPADYDAMREALLWTLEQALGEDLTPAAREAWTVCYNELAGEMKAAA... 133
406 8.000e-39UniRef50_UPI0003F065FF neuroglobin-1-like n=1 Tax=Saccoglossus kowalevskii TaxID=10224 RepID=UPI0003F065FF  ali  26  26.TERQRRIVRKTWRPLANDMTGNGTKVFLHIFEMNPKVKQLFPC---RDKTGEELLKDLNFKGHASRFMQSVGAAVDNLDNLETLAPLLMNLGKSHNHFGFELNYFDSFTGAMLHVWELELQDRFTPEVMEAWKLVFDYMMGKMKDGY... 171
407 9.000e-39UniRef50_A0A258C1Q6 Nitric oxide dioxygenase (Fragment) n=1 Tax=Pseudomonadales bacterium 32-61-5 TaxID=1970544 RepID=A0A258C1Q6_9GAMM  ali  17  1MTAEQTAIIKATVPILETGGETLTKHFYGHMLTSHPEVVPFFNKAHQASGD------------QPRALANAVLMYAKNIERLGNLGPLVGQIINKHVSLNINPAHYAVVGACLLKAIRDVLGAEATDAVIDAWAAAYGQLADILIGAEK.. 138
408 9.000e-39UniRef50_A0A2S9YM25 Flavohemoprotein n=2 Tax=Enhygromyxa salina TaxID=215803 RepID=A0A2S9YM25_9DELT  ali  24  1MHPKQIELIRASLPILREQAVAITQAMYRRMFTANPEVAKMFNPSHMHPD------------GQQGALAGAIVAYAEHLDELEVLHDALAVIVHKHVAVQVQPAQYEVVGEHLLAAIAEVLGDAATPELMHTWAAAYRELADVCIAAER.. 137
409 1.000e-38UniRef50_UPI00035CEF7B hypothetical protein n=16 Tax=Actinobacteria TaxID=201174 RepID=UPI00035CEF7B  ali  26  8........LQASWARVVAHGDAVPAYFYAALFTRNPQLRQLFP---------------ASMAGQRDRLVTALGRIVAGVGQPDVMLPFARGLGRDHRRFDVRPEHYPPVGEALLATLSQFLGPDWDADLAAGWTEAYGLVAQVMCDAAAE. 134
410 1.000e-38UniRef50_T0RU19 Globin n=3 Tax=Oligoflexia TaxID=1553900 RepID=T0RU19_9PROT  ali  23  4....DINMIRSSFEKAKPIAGDVANKFYEFLFQDYPASKGLFTDVN--------------MAAQKKALINSLVYIVDHLEDGEKLTNYLKKMGSRHVNYGTEPEHYSWVGQSLLKTFAFFFGDEWTPELKSQWTQAYTFIAETMLEGAE.. 134
411 1.000e-38UniRef50_K1RJ02 Nacrein-like protein F n=1 Tax=Crassostrea gigas TaxID=29159 RepID=K1RJ02_CRAGI  ali  22  390LSEDQLELLEKSWNSIKVNIANIGVVAFMNLFQTHPEVKDAF--LPFQQLAEDDMEHSAILRSHALRVMGTVDKCLTRIRTPEKLQSLMHELGERHVNYSAKYDFIDMVGGQFVHAIKPHLQDSWSEELGEAWVQLFRVLCYYMKKGMRD. 537
412 1.000e-38UniRef50_A0A2G2JR25 Flavohemoprotein n=1 Tax=Blastopirellula sp. TaxID=2024826 RepID=A0A2G2JR25_9PLAN  ali  24  5.....IKLLEDSFELLAPQGDALVERFYDNLFNDYPVVRPLF--------------ENVEMQEQRSKLLAGLALVVANLRSPDQLVPALEEMGQRHVEYGAVEDYYPAVGATLLKSLAEIAGDAWNDELEQAWSDAYGEISKIMLAG.... 132
413 1.000e-38UniRef50_A0A1M3HDM8 Uncharacterized protein n=2 Tax=Sphingobacteriales bacterium 50-39 TaxID=1895841 RepID=A0A1M3HDM8_9SPHI  ali  28  1MTLRQIELVRYSWARVTADEVTFGIGFYNRLFEIAPEIEPMFKRP---------------ILEQSRKLTTILDHVIEKLDALDDIVENIVKLAHRHENYGVKPEHYTLVGEALLWTLERELGDLWNDELKFAWTMCYVGISTAMLQAMK.. 135
414 1.000e-38UniRef50_UPI0004E0AF16 Hemoglobin-like flavoprotein fused to Roadblock/LC7 domain n=1 Tax=Methylacidiphilum infernorum (isolate V4) TaxID=481448 RepI  ali  32  1MTREEIKMIQKSWLRVIDKMDEAGLLFYRRLFDVEPKVRPLFKI---------------DIEKQGRKLMDVLNWIVLNLQDIDAALDAARELARRHVKYGVKAEHYPVVGHTLIWTLRKMIGSEWTKQLEQLWTQAYEALAQVMIE..... 131
415 1.000e-38UniRef50_A0A1I3GIY1 Nitric oxide dioxygenase n=4 Tax=Bacteria TaxID=2 RepID=A0A1I3GIY1_9RHOB  ali  27  3LDDEQIAAIRGSWAPVYAARDLAAGLFYGRLFQIAPESRALF---------------SGDPTEQGRKLTETLAYVIEALDRPEALVEPVEALARRHVDYGVRPEDYAAVGRALIWMLERHLGGGFTPQARLAWVAAYDHLARRMIAAA... 135
416 1.000e-38UniRef50_F2Q9X4 Globin n=6 Tax=Branchiostoma TaxID=7737 RepID=F2Q9X4_BRAFL  ali  22  19LTANQIQLIRDTWQIVYKNKRENCFAIFRMLFTDHPSTKSLFRLMDAVDLDPGEFEKNVAARAHMVRFMHSFATFMDTLDEPAELRQLLFDLGKNHAKHQVGPELFDALGPILMKALPIVLDGKFTPEVKTAWLTAYTFMSTHLKEGVEE. 169
417 1.000e-38UniRef50_UPI000B795192 plastid division protein PDV2-like isoform X2 n=1 Tax=Hevea brasiliensis TaxID=3981 RepID=UPI000B795192  ali  19  384.TEEQEALVVKSWNSMKKNSGELGLKFFIKIFEIAPSAKKLFSFLNDSDVPLEQ---NPKLKPHAVTVFVMTCESAVQLRKAGKVESSLKDLGATHFKYGVVDEHFEVTKYALLETIKEAVPEMWSPEMKNAWAEAYDQLAAAIKIEMK.. 531
418 1.000e-38UniRef50_A0A2B4SX20 Neuroglobin-2 n=1 Tax=Stylophora pistillata TaxID=50429 RepID=A0A2B4SX20_STYPI  ali  34  30LTDLQTELIRGSWEKVKTNKKYHGERLFHKLFDVAPHLQELFPFGSD--------LTNPMFTMHALNIMNTLDLAVQNLDKLDILVPKLRELGQMHAAFELTEVEFQYVGESLIWVLETGLGDDFTPKLKRAWCDAFAIISSVMLGAIKD. 171
419 1.000e-38UniRef50_B4WLV9 Globin domain protein n=5 Tax=Cyanobacteria TaxID=1117 RepID=B4WLV9_SYNS7  ali  25  2....DVALLEKSFEQISPRAIEFSASFYQNLFHHHPELKPLFAETSQTI--------------QEKKLIFSLAAIIENLRNPDILQPALKSLGARHAEVGTIKSHYPLVGQALIETFAEYLAADWTEQLATAWVEAYDVIASTMIEGAD.. 132
420 1.000e-38UniRef50_A0A2U1FLN9 NAD(P)H-flavin reductase n=1 Tax=Actinomycetospora cinnamomea TaxID=663609 RepID=A0A2U1FLN9_9PSEU  ali  27  188.....VSLIRQSWASIQHRSDELTKLFYAWLFRLSPETRELFPVT---------------MELQRTRFLRGLLHVIQMVDRPEELSVFLRQLGRDHRKFGVVDKHYDQVGEALVGALKEVTGERWNNEIEQAWLGAYSLTASIMLDAAEGE 318
421 1.000e-38UniRef50_D3B1S6 Flavohemoglobin n=1 Tax=Polysphondylium pallidum (strain ATCC 26659 / Pp 5 / PN500) TaxID=670386 RepID=D3B1S6_POLPP  ali  19  4LDAKTIEIVKSTIPALAGTGSKLTQHFYARMLGNNPELKNVFNEANQRSN------------AQSEALFGAVCAYAQNIDNLAPLLPAVEKIAQKHCSLNIKPEQYSIVGENLLATIDELLAPP--KEVIDAWAAAYGVLADIFIQREKE. 139
422 1.000e-38UniRef50_A0A2K1QKL9 Uncharacterized protein n=1 Tax=Elsinoe sp. CQ-2017a TaxID=1983410 RepID=A0A2K1QKL9_9PEZI  ali  23  3LTTDQKTLITSSLPALQEHGATVTTSFYTTLLSENPSLRSTFNLTHQRTAS------------QPFALASVLAAYARHITDPSVLGPAVEAINHRHVSLGVTAEQYSVVGTYLLRAMSEVLGQAFTEDLKGAWGAAYGDLASGMVKAEEE. 140
423 1.000e-38UniRef50_A1ZN75 Neuroglobin n=2 Tax=Cytophagales TaxID=768507 RepID=A1ZN75_9BACT  ali  31  1MTTQDINLVRNSWVSVLAHRDEAGDIFYNYLFKQNPQVKRLF-------------QSNTHIQNQ--KLMSSITLIVTKLNKLDNIKEEVKFLAKRHVNYQVKPAYFTAFGNAFLYMLAQVLGNAWTHEMKTAWKKVYQLISQAMIEGL... 133
424 1.000e-38UniRef50_A0A100JLH0 Ferredoxin--NAD(P) (+) reductase (Naphthalene dioxygenase ferredoxin-specific) n=43 Tax=Streptomycetaceae TaxID=2062 RepID=A0A100  ali  26  119.......LIRRTMAEVGPVADKVTSYFYALLFVQHPDLRSMFP---------------PAMDAQRDRLLKALLTAAEHIDNTLVLVDYLQNLGRGHRKYGTQADHYPAVGECLIGALSRYAKASWNDETEAAWVRTYTTISQVMIDAAAAD 247
425 1.000e-38UniRef50_A0A239P0B9 Methyl-accepting chemotaxis protein n=2 Tax=Asanoa hainanensis TaxID=560556 RepID=A0A239P0B9_9ACTN  ali  29  10..QADAKLLTASLEVVADRADALIASFYDRLFTEYPAVRPMFP---------------ASMDAQHDKLLGAIVALVTNYEDPEALRPTLLALGAKHDGWGVQPAHYTAVAGCLLATLREYAGDAFTPEVEGAWVRAYTFAAGTMMQGAA.. 141
426 1.000e-38UniRef50_Q0UPY5 Uncharacterized protein n=51 Tax=Fungi TaxID=4751 RepID=Q0UPY5_PHANO  ali  18  4LSPSQVQIIKSTVPVLAQHGEAITAKFYTDLLTANPSLKNVFNTTHQATG------------HQSRALAGALYAYAANIDNLGALSPALELICHKHVSLFIQPAQYAIVGEFLLATMKTVLGAAATGEVLDAWGAAYWQLADIMIAKEE.. 140
427 1.000e-38UniRef50_A0A212CU06 NGB (Fragment) n=1 Tax=Cervus elaphus hippelaphus TaxID=46360 RepID=A0A212CU06_CEREH  ali  98  1....................................................................MLVIDAAVTNVEDLSSLEEYLASLGRKHRAVGVKLSSFS-----------KCLGPAFTPATPAAWSQLYGAVVQAMSRGWDGE 72
428 2.000e-38UniRef50_A0A0P9TRY3 Bifunctional nitric oxide dioxygenase/dihydropteridine reductase 2 n=1 Tax=Pseudomonas amygdali pv. dendropanacis TaxID=235272 Re  ali  17  28LSTAHHDIIKATVPILETGGEALTTHFYRIMLNDYPQVRPLFNQANQANG------------AQPRALANAVLMYARNIDRLENLGPLAAQIVNKHVALQILPEHYPIVGACLLRAIREVLGAEATDAVIDAWAAAYQQLADMLINAERD. 166
429 2.000e-38UniRef50_A0A1H3TY46 Methyl-accepting chemotaxis protein n=1 Tax=Asanoa ishikariensis TaxID=137265 RepID=A0A1H3TY46_9ACTN  ali  28  10..QADAKLLNASLEVVADRADALIASFYDRLFTEYPAVRPMFP---------------ASMDAQHDKLLGAIIALVTNYENPEALRPTLLALGAKHDGWGVQPAHYTAVAGCLLATLREYAGDAFTPEVEGAWVRAYTFAAGTMMQGAA.. 141
430 2.000e-38UniRef50_A0A1M6D0U9 Nitric oxide dioxygenase n=1 Tax=Rubritalea squalenifaciens DSM 18772 TaxID=1123071 RepID=A0A1M6D0U9_9BACT  ali  19  4LSKETIETVKATIPFLAENATKLTAHFYQRMFRENPEVRAYFNAAHQVSGS------------QQGALAASVCAFARNIETPENLATAVSLIANKHASLGVQPEHYPIVGKHLLASIDELLNPA-PPEILQAWGEAYGFLAEVLIQ..... 136
431 2.000e-38UniRef50_A0A2J7RQJ1 Uncharacterized protein n=1 Tax=Cryptotermes secundus TaxID=105785 RepID=A0A2J7RQJ1_9NEOP  ali  24  61LTQRERQAVVSTWAVVKLDAKRTGVELFMRLFEAHPEYQKRFP--SFRGMNLTELRGSTKLSAHATNVMYSLTGVVDNLEDPECLTELLRKLGENHRRHEITEKEFRDLKVVLMDLLKEKLGEQLTPQGERAWNKTVDLAYTFIFQGLK.. 207
432 2.000e-38UniRef50_A0A143PM95 Nitric oxide dioxygenase n=1 Tax=Luteitalea pratensis TaxID=1855912 RepID=A0A143PM95_9BACT  ali  31  12ITRTQRDLVRQSLDRLTVDAVPVTLLLYGKLFELDPSARRLF---------------HNDLAVQGRKLMDTLDAVASSLDNLESLRPRLLQLGRRHADYGVGPADYDRLITALLWAFAQALGPDFDKPTREAWRVALSAVAAVMQEG.... 143
433 2.000e-38UniRef50_R7URJ5 Uncharacterized protein n=1 Tax=Capitella teleta TaxID=283909 RepID=R7URJ5_CAPTE  ali  25  95LTDRQMTLIEDTWSIVQRDISTVGLDMFSRMFEAFPGIKESF--GPLSSMVPEDHRYRKEISEHGVRVLNTVDTILRLRHDPDKTIETLHDLGGKHISFNAKVDYIDLLGQHFLFAMEPVLKQHWTPEVEQAWADLFRLMSHVMKEGM... 240
434 2.000e-38UniRef50_A0A0N0MML0 Nitric oxide dioxygenase n=28 Tax=Actinobacteria TaxID=201174 RepID=A0A0N0MML0_9ACTN  ali  23  30.......LIRRTLEEIGPVADRVTSYFYALVFTGHPEVRGMFP---------------AAMDAQRDRLLKALLTAAEHIDNPDVLVPYLRRLGSGHRKYGTMAGHYPVVGEALISALARYADRSWGPETQAAWVRAYTAMSQIMIDAAAED 158
435 2.000e-38UniRef50_K1PM52 Cytoglobin-2 n=5 Tax=Crassostrea TaxID=6564 RepID=K1PM52_CRAGI  ali  21  28LSEAELDILESSWGKLKKDISRVGVVMFMNLFQTHPEVQDAF--MPFQKLAQEDMEHSAILRSHALRVMGTVDKCLARIRTPEKLQTLMHELGERHVNYNARYDFVDLVGSQFVYAIKPHLEDGWSKELEEAWLQLFRVMSYYMKKGMQD. 175
436 2.000e-38UniRef50_Q9I0H4 Flavohemoprotein n=787 Tax=root TaxID=1 RepID=HMP_PSEAE  ali  17  2LSNAQRALIKATVPLLETGGEALITHFYRTMLGEYPEVRPLFNQAHQASGD------------QPRALANGVLMYARHIDQLQELGPLVAKVVNKHVSLQVLPEHYPIVGTCLLRAIREVLGEQATDEVLEAWGAAYQQLADLLIEAEE.. 139
437 2.000e-38UniRef50_A0A2P8AIT6 Glutathione synthetase n=1 Tax=Elsinoe australis TaxID=40998 RepID=A0A2P8AIT6_9PEZI  ali  19  3LADDQVSLVQSSIPALEEHGTKITSTFYTTMLSENPSLRNIFNLTNQRTNS------------QPLALASVLAAYATHITNPSALAAPVEAINHRHVSLGVTAEQYNIVGTYLLRAMSEVLGAALTEELKGAWGAAYMELAGMMIKAEEA. 140
438 2.000e-38UniRef50_UPI000B9EBEF1 hypothetical protein n=1 Tax=Zooshikella ganghwensis TaxID=202772 RepID=UPI000B9EBEF1  ali  19  2LDARTIATVQATIPLLEQANTALTTNFYQRMFKWNPELKHIFNVSNQHNSS------------QPKALFNAILAYAKHLHEPGRLAEMVEHIAQKHTGFMILPEHYPIVGQHLLATLQELAPEAATAEVLAAWDKAYAALADIFIQ..... 135
439 2.000e-38UniRef50_S3FIT4 Globin family protein n=17 Tax=Bacillales TaxID=1385 RepID=S3FIT4_9BACL  ali  19  2LDQQTIEIVKATAPVLKDHGVAITSHFYKRMFANNPEVRQFFNHTNQQRGRQPEALANAV------------YAAAVHIDRLEAILPAIQPALHKHQSLNIRPEHYPIVGANLLGAIQDVLGEAATPEIIDAWAKAYGVIADVFI...... 134
440 2.000e-38UniRef50_A0A061DX38 Hemoglobin 1, GLB1,NSHB1,ATGLB1,HB1 n=4 Tax=malvids TaxID=91836 RepID=A0A061DX38_THECC  ali  19  87.TEEQEALVVKSWNSMKKNAGELGLKFFLRIFEIAPSAKKLFKFLRDSDIPLEQ---NPKLKPHAMTVFVMTCESAVQLRKAGKVESNLKDLGATHFKYGVVDEHFEVTKFALLETIKEAVPEMWSTEMKNAWGEAYDQLAAAIKNEMN.. 234
441 2.000e-38UniRef50_A0A2C6DL71 Flavohemoprotein n=349 Tax=cellular organisms TaxID=131567 RepID=A0A2C6DL71_9GAMM  ali  17  2LDSQTIAIVKSTIPVLVETGPKLTGYFYERMFKHNPELKDIFNLSHQQSG------------AQREALFGAICAYASNIENLSAILPAVERIAQKHASFNIQPEQYNIVGHHLLATIDELLHPG--TEVIEAWGKAYQVLANVFIQ..... 133
442 2.000e-38UniRef50_UPI000D335C23 hemin receptor n=1 Tax=Mangrovicoccus ximenensis TaxID=1911570 RepID=UPI000D335C23  ali  22  11LTPEQISTVKQSFARIFPIKAKLAYDFYERLFEIAPDLRPLF---------------SEDISIQREKLADTLAWAVRNLDSPAVLAEVVQGLARRHVTYGALPEHYPVVGAALIHALQLNAPGGLSEAETGAWTAAFETLSDIMIDAARPD 146
443 2.000e-38UniRef50_UPI00089D11D8 flavohemoprotein n=1 Tax=Micromonospora pattaloongensis TaxID=405436 RepID=UPI00089D11D8  ali  26  6......RLLKESWTLVEEQQDKVAGYFYARMFLSNPHLRELFPV---------------HMDVQRARLLGAIVTAVQTIDDPERFDEYLRSLGRDHRKFRVEPEHYNVVRDALLEAFRTFAGEQWSIEYDQAWIDAYDLIARKMLSGAADD 135
444 2.000e-38UniRef50_E9EJD6 Flavohemoprotein n=1 Tax=Metarhizium robertsii (strain ARSEF 23 / ATCC MYA-3075) TaxID=655844 RepID=E9EJD6_METRA  ali  19  74LTSEQMKIVQSTIPALEQHGMAITSLLHKRLLDSHPELKNVFNTTHQVTG------------EQPAALAHAVWAYASNIDNPAALQTTLSRIGHKHASLGITPEQYPILGEGLLAAIKTVLGAAADDQVLDAWGAAYEKLAEYCIR..... 207
445 2.000e-38UniRef50_UPI000575FE1E neuroglobin n=1 Tax=Bison bison bison TaxID=43346 RepID=UPI000575FE1E  ali  96  216............................ARLFDLEPDLLPLFQYNCSQFSSPEDCLSSPEFLDHIRKVMLVIDAAVTNVEDLSSLEEYLAGLGRKHRAVGVKLSSFSTVGESLLYMLEKCLGPAFTPATRAAWSQLYGAVVQAMSRGWGGE 338
446 2.000e-38UniRef50_A0A091HLG0 Neuroglobin (Fragment) n=5 Tax=Amniota TaxID=32524 RepID=A0A091HLG0_CALAN  ali  74  1.............................RLFDLDPDLLPLFQYNCKQFASPQECLSAPEFVDHIRKVMLVIDAAVSHLENLSCLEEYLCNLGKKHQSIGVKVDSFSTVGESLLYMLERCLGTAFSPDMREAWITLYGAVVKAMQRGWD.. 120
447 2.000e-38UniRef50_A0A099ZC65 Neuroglobin (Fragment) n=5 Tax=Amniota TaxID=32524 RepID=A0A099ZC65_TINGU  ali  74  1.............................RLFDLDPDLLPLFQYNCKQFASPEECLSAPEFLDHIRKVMLVIDAAVNHLEDLPCLEEYLCNLGKKHQVAGVKVESFSTVGESLLYMLENCLGTAFCPDVREAWTKLYDAVVKAMRRGWDA. 121
448 3.000e-38UniRef50_A0A1W2GDV4 Nitric oxide dioxygenase n=2 Tax=Reichenbachiella faecimaris TaxID=692418 RepID=A0A1W2GDV4_9BACT  ali  23  7ITPYNKKLVRATFWMVEPKADEAAEIFYTKLFEMSPELRPLFK---------------GNMRDQGKRMMEMLSTVVKGLNTLDVLAPLVRSMGRRHVNYGIKTEHYNMAAAALMYSLKEELQENWNEEVESAWLEVYQTVSDIMQSA.... 138
449 3.000e-38UniRef50_A0A2K9UYQ6 Globin-like protein n=2 Tax=Exaiptasia pallida TaxID=1720309 RepID=A0A2K9UYQ6_EXAPA  ali  30  20LTEEKKTLLRKTWAIASQPSVQAGNKLFKTLFQIAPSASTYFSSTD---------IDADDFQRHIQLVMGTLGTAIDNLDDLSVIVPGLQGLGATHDSLGVRIEYFKYVKQALLQTLSQELQDAFTDDCREAWTLAFDVIVGAMISGM... 158
450 3.000e-38UniRef50_A0A164IVT5 Flavoprotein n=17 Tax=Nocardiaceae TaxID=85025 RepID=A0A164IVT5_9NOCA  ali  27  1MDSRTVALIRTTFKAVAAEPEKLARSFYAILFTEHPFVRDFFP---------------AALDSQRDRLVKAIAYVVDRLEEPDQLLPFLAQLGRDHRKYGVSTEHYAAVGKSLHAALRAYAGTEWTDEVERAWNEAIGVIAETMMRAADQE 140
451 3.000e-38UniRef50_A0A2H8TK81 Cytoglobin-2 n=6 Tax=Neoptera TaxID=33340 RepID=A0A2H8TK81_9HEMI  ali  24  56LTMRQKELLTEMWKLLEEDIAKVGVITFVSLFETHPDVQQSF--MPFKGVELEDLKHSRQLRDHALRVMAFVQKAVARLYEPDKLETLLRDLGKKHYHYGAKQKYVDLIGPQFIMAIQPSLVDRWTDEMHSAWTALFLNMAYIMKGSMAAE 204
452 3.000e-38UniRef50_UPI000D6FBE35 hemin receptor n=1 Tax=Roseomonas sp. CQN31 TaxID=2184016 RepID=UPI000D6FBE35  ali  32  4LTEEELDRVRGSFRALAALGEDGAATFYDRLFATSPGLRALFP---------------EDIGPQCTKLMSMLGVIVARLHDHAALQPLLADLARRHVGYGARPEHYAGVGEALLWTLGQRLGPEFTPAHADAWRRAYAALSATML...... 133
453 3.000e-38UniRef50_A0A220SM61 Flavohemoprotein n=18 Tax=Bacteria TaxID=2 RepID=A0A220SM61_9GAMM  ali  19  2LTADQLAVIQQTVPVLQEHGETLTRHFYQRLFRENPEVKAYFNPAHQRSGS------------QQRALAGAICAYAQHVDNPAALMGAVELIAQKHASLGIRPEHYPIVGANLLASIREVLGEAASDDVIN.................... 120
454 3.000e-38UniRef50_W0LFP8 Hemin receptor n=1 Tax=Chania multitudinisentens RB-25 TaxID=1441930 RepID=W0LFP8_9GAMM  ali  28  1MSADRIKLIQESWKKVGPIADSAAQIFYEKLFTLDPSLRSLFRTEAY---------------VQRKKLIDILTLGVKGLENIERLIPTLQSLSLRHVNYGVKEEYYDTVGAALIYTLGASLKEEFTEEIKQAWVEFYALLSGVMKSA.... 132
455 3.000e-38UniRef50_UPI000D729BE4 neuroglobin-like n=1 Tax=Pomacea canaliculata TaxID=400727 RepID=UPI000D729BE4  ali  28  24LTVEEIEVIRHTWAIVKQDIPGTGMFMFTRLFELQSDFKKFFKRMMTQTETGEYDFDRNKLGNHANVVMTALDKAVDSLDDSSFLSKGLAELGERHKMYNVKSEMIPYMWPAVRDALKKALAEDFTVEAELAWKHVFDYIVSKMAQG.... 170
456 3.000e-38UniRef50_UPI000BAF2000 neuroglobin-like isoform X3 n=1 Tax=Crassostrea virginica TaxID=6565 RepID=UPI000BAF2000  ali  20  28LSEKDLDILETSWGKLKKDISKVGVVMFMNLFQTHPEVQDAF--LPFQQLAKEDMEHSAILRSHALRVMGTVDKCLARIRTPEKLQTLMRELGERHTNYNARYDFVDLVGSQFVYAIKPHLEDCWSKELEDAWLQLFRVMSYHMKKGMQSQ 176
457 3.000e-38UniRef50_A0A2A4VU89 Hemin receptor n=1 Tax=Kordiimonadales bacterium TaxID=2030814 RepID=A0A2A4VU89_9PROT  ali  24  1MTPDDVAKLQYSFGQMVPKKDEIAKVFYERLFEVAPAVRPLFK---------------GSIEEQGQKLVMALRQIVLSLKQPNELTTFLKGLGERHVGYGAVAAHYDVVGGVLLWTFENVMGNDFTPELKELWGGAYGVISAAMQEAAA.. 134
458 3.000e-38UniRef50_A0A1Z4J4C8 Globin domain protein n=2 Tax=Scytonema TaxID=1203 RepID=A0A1Z4J4C8_9CYAN  ali  25  171......DLLEKSFATIKPRAQEFVASFYENLFIAHPEVKPLF--------------ANIDMVTLQKKLLNALILVVENLRNPESLGQVLSALGARHVGYGALPKYYPAVGEALLTTFEQYLQADWTPEVKQAWVNAFRAITAGMLQGAQAE 301
459 3.000e-38UniRef50_A0A146Z8V8 Neuroglobin (Fragment) n=3 Tax=Fundulus heteroclitus TaxID=8078 RepID=A0A146Z8V8_FUNHE  ali  56  71LSVKDKELIRGSWESLGKNKVPHGVIMFSRLFELDPALLSLFHYSTK-CDSKQDCLSSPEFLDHVTKVMLVIDAAVSHLDDLHSLEEFLLNLGRKHQAVGVSTQSFTEVGESLLYMLQCSLGQAYTAPLRQAWLNMYSIVVAVMSRGWNGE 272
460 4.000e-38UniRef50_UPI000D55BCBB hemin receptor n=3 Tax=Sphingorhabdus TaxID=1434046 RepID=UPI000D55BCBB  ali  25  11LTVAEIDIVRRSFLNLGDENARAGELFYQQLFDDKPELKSLF---------------LSDISVQSEKLTNMLGMIVSQIHNMPELLPMLADLARRHLGYGVEAEHYRDVGDALISTIRDVLGPKFGPDVEAAWTKAYEGIALTMIQ..... 141
461 4.000e-38UniRef50_A0A1Y1LBA0 Uncharacterized protein n=2 Tax=Photinus pyralis TaxID=7054 RepID=A0A1Y1LBA0_PHOPY  ali  22  22LTRKEKHLVERSWNLVKTNLKANGMELFLLLFKECPEAQNYFP---FRDIPLDELPNNGKFKAHAVTVMYSIGSIVDNLNENDVLIGLLQKNAESHSKRGIPEEAYWTLKKCMMQLLKNKLGPDFSKEVEEAWDKTLTVAFTVIIK..... 164
462 4.000e-38UniRef50_UPI000BB031AD neuroglobin-like n=1 Tax=Crassostrea virginica TaxID=6565 RepID=UPI000BB031AD  ali  26  40MSESEKRIVKKTWKYLARDMTYYGTRVFLRIFELKPDLKDLFP---FHNKEDEALVNDQNFIGHASRFMQAVGAAIDNINNLHLFGPLLVGLGRQHVEFGFKPEYWDVFTEAMIFVWEKELGDNFDGRCKIAWRKIFEFIMEQLKDGYKQ. 188
463 4.000e-38UniRef50_A0A2T5GUY2 Hemoglobin-like flavoprotein n=4 Tax=Sphingomonas TaxID=13687 RepID=A0A2T5GUY2_9SPHN  ali  30  1MDSRQINLVQDSFIHVLPIPDAVAAAFYARLFQLAPDTRPLFR---------------GDMVEQGRKLVLTLASVVDSLDRLDELLPVARELAIRHVGYGVLDRHYAVVGAALLDTLAVQLGDLFDTATHDAWAAAYTILADAMIEA.... 132
464 4.000e-38UniRef50_A0A2P2I3P9 Cytoglobin-2-like (Fragment) n=2 Tax=Amphipoda TaxID=6821 RepID=A0A2P2I3P9_9CRUS  ali  27  25LTPRQARAVLETWDIVRPNLKEHGVRFFIKLFKAYPQTQAKFKQ--FENMDPDTLYDNKRLAAHGNIVMLSISGVVDNLEDPDTLLEILKTTGVNHKRRGIEKESFNYVKVVMLEYLEENLGAEWTPIARQGWTLALSAIVKIVYCAYD.. 171
465 4.000e-38UniRef50_A0A2G7CD32 NAD(P)H-flavin reductase n=1 Tax=Streptomyces sp. 61 TaxID=2035242 RepID=A0A2G7CD32_9ACTN  ali  31  37LSDREISLIRASVAEVEPLAADMTVYFYAILFARYPEVRPMFP---------------PGMDAQRGRLLRALLRIVDLVDDPGGLVRFCGHLGRDHRKFGTLAAHFPAVGECLLAALARFAGPAWSADVAAAWTKAYGAVAQVMIGAAEED 172
466 4.000e-38UniRef50_V4SH90 Uncharacterized protein n=6 Tax=Spermatophyta TaxID=58024 RepID=V4SH90_9ROSI  ali  19  72.TEEQEALVVKSWNAMKKNSGELALKFFLRIFEIAPSAKKLFTFLKDSDIPVEQ---NPKLKPHATTVFVMTCESAVQLRKAGKVESNLKDLGATHFKYGVLDEHFEVTKYALLETIKEAVPEMWSPEMKNSWAEAYDQLAAAIKTEMK.. 219
467 4.000e-38UniRef50_A0A2A8HZX9 Uncharacterized protein n=1 Tax=Novosphingobium sp. PC22D TaxID=1962403 RepID=A0A2A8HZX9_9SPHN  ali  18  5LSAKTIATIKASAPALQQHGVAITTRMYERLF-INPEIEAMFDRAAQESG------------EQPRRLAGAILAYAQNADKLENLGGAVERMAARHVEAGVRAEHYPLVAQALLPAIRDVLGDEASDELLEAWGEAYWYLAEILINAENA. 141
468 5.000e-38UniRef50_UPI000D75B6E2 hemin receptor n=1 Tax=Sinimarinibacterium flocculans TaxID=985250 RepID=UPI000D75B6E2  ali  32  1MNAEQIRLVRETWKLILPMRAAVAELFYSKLFELEPRLRPLFK---------------SDLERQGEKLIAMLDAAVRGLDHPHVLGPALKDLGQRHVRYGASENDYGTVAVSLLWTLEQSLGAAFTVDARRAWTEAYATIVAMM....... 129
469 5.000e-38UniRef50_A0A1G9CS02 Nitric oxide dioxygenase n=1 Tax=Methylophilus rhizosphaerae TaxID=492660 RepID=A0A1G9CS02_9PROT  ali  24  10........IKASVPVLREHGVKITTVFYNSLFNTHPELRNVFNMRNQADGT------------QQQSLAAAVFAYAANFENPAALAPVVTRIVHKHASLGIVPEHYPIVGTHLLGAIKEVLGDAATPELIDAWAEAYGALANALITEEK.. 138
470 6.000e-38UniRef50_UPI000B3EFDEE non-symbiotic hemoglobin 1-like n=1 Tax=Herrania umbratica TaxID=108875 RepID=UPI000B3EFDEE  ali  19  87.TEEQEALVVKSWNSMKKNAGELGLKFFLRIFEIAPSAKKLFKFLRDSDIPLEQ---NPKLKPHAVTVFVMTCESAVQLRKAGKVESNLKDLGATHFKYGVVDEHFEVTKFALLETIKEAVPEMWSTEMKNAWGEAYDQLAAAIKNEMN.. 234
471 6.000e-38UniRef50_A0A1G7N3F9 Nitric oxide dioxygenase n=11 Tax=Halomonadaceae TaxID=28256 RepID=A0A1G7N3F9_9GAMM  ali  21  2LTKDQERLIDATAPVVAEHLNTITSRFYPLMFERYPDVAPLFNQTHQTNG------------AQPQALAGAVLAYVQLRREPARARQVLATVVSKHVSLGIRPDQYPIVGECLMAAIGEVLGDAVTPEIADAWGALYEELAGLLIE..... 135
472 6.000e-38UniRef50_A0A1Y5TN36 Bacterial hemoglobin n=3 Tax=Rhodobacteraceae TaxID=31989 RepID=A0A1Y5TN36_9RHOB  ali  28  3LTQRQLELVRESFSVLRDDPIPKSIDFYTSLFRQAPELKAMFR---------------EDLAGQGMRFMATLGAIVDNLHDTKAMADRYADLGRAHRALGVRAQDFEPMGKALIETLSATLGDAFTPEMQEAWETAYTEFSRDIIA..... 133
473 6.000e-38UniRef50_UPI000C6C8E7A non-symbiotic hemoglobin 1-like n=1 Tax=Centruroides sculpturatus TaxID=218467 RepID=UPI000C6C8E7A  ali  23  27.TYQQKVALVQTWNVLMENLSRVGVIAFMRLFETHPDVQEIF--IPFKGLDHESLRNSKELRAHALRVMSFVQKVVARLEQPRKLEMLLGELGKSHLNYGAKAEYIEKIGPQFIYAVKPMLEDHWNPGVENAWLQLFRYITHYMKVTME.. 172
474 6.000e-38UniRef50_A0A0B6YLQ8 Uncharacterized protein (Fragment) n=4 Tax=Gastropoda TaxID=6448 RepID=A0A0B6YLQ8_9EUPU  ali  24  1.....................KVGVVMFIKLFETHPEVQNVF--VPFKGQSKENLQDSTQLKSHALRVMGTVEKCVTRFQDPERIRQMLHELGARHVMYNAKVDYMDLIGPQFIWAIEPVIGDRWTPEVEQAWSDLFKYISYIMKDAM... 125
475 6.000e-38UniRef50_F7SSF2 Nitric oxide dioxygenase n=54 Tax=Gammaproteobacteria TaxID=1236 RepID=F7SSF2_9GAMM  ali  22  2LTHEQETLINATAPVVAEHLNAITQRFYPLMFSRYPEVKPLFNEVHQQSG------------GQPRALANAVLAYVQLRSNPAQARATLDVVVSKHVSLGILPEQYPIVGECLLAAIGEVLGDAVTPEIADAWGALYNELAALLID..... 135
476 6.000e-38UniRef50_A0A132MU45 Nitric oxide dioxygenase n=4 Tax=Streptomyces thermoautotrophicus TaxID=1469144 RepID=A0A132MU45_9ACTN  ali  28  11...EQARLIRESFQVIAQHGDRVALHFFAELFLRHPELRDLFPVA---------------MSELRGGLFDAITTIVQRIVSTGTLVPFLQQLGRDHRKYDIRTEHFAYVGEALMITLEKYAGEAWTPQVAEAWRSTYDLAAKVMLQAMQ.. 141
477 6.000e-38UniRef50_A0A125P2G0 Flavohemoprotein n=2 Tax=Variovorax TaxID=34072 RepID=A0A125P2G0_9BURK  ali  20  2LTPSTMAIVKATAPVLAEHGFTIIQRFYEHLFQAHPELKNLFNMRHQERG------------EQQRALAAAVLAYAANIDNLQALGPAVARITNKHASLNVVPEQYAVVGHHLLEAIKEVLGDAATEPILEAWALAYQALADLMIGAEAA. 139
478 6.000e-38UniRef50_UPI0009DC12DF hypothetical protein n=1 Tax=Planktothrix agardhii TaxID=1160 RepID=UPI0009DC12DF  ali  22  180.TTAQIELVETSFEKIKPRAVEFVSSFYQNLFETYPETQRLFGKT--------------DMDKQGKKLLNSLILLVEGLRTPEALIPVLKDLGARHKGYGTITEYYPLVGEILLKTFADYLQEDWTPQVAQSWVEIYTKTSQLMLEGA... 312
479 7.000e-38UniRef50_UPI000A3A41A6 flavohemoprotein n=4 Tax=Streptomycetaceae TaxID=2062 RepID=UPI000A3A41A6  ali  27  74.......LIRRTLAEIEPSADKAVSYFYALLFLRHPGLRALFP---------------AAMDTQRDRLFRALLTAARHVDDTATLTEYLSQLGRGHRKYGTESAHYPAVGECLIGALAHYARDSWNADAEAAWVRAYTAISQIMIDAAAED 202
480 7.000e-38UniRef50_A0A2N9BB92 Naphthalene 1,2-dioxygenase system ferredoxin-NAD(+) reductase component n=127 Tax=Actinobacteria TaxID=201174 RepID=A0A2N9BB92_S  ali  25  162.......LIRRAMAEITPVADKVTSYFYALLFVRHPDLRSLFP---------------AAMDTQRDRLLRALLTAAEHIDNTDVLVDYLQNLGRGHRKYGTRAEHYPAVGECLIGALSKYAAGVWDAEMEAAWVRTYTTISQVMIDAAAAD 290
481 7.000e-38UniRef50_UPI0009F9A05D hypothetical protein n=1 Tax=Bradyrhizobium sp. AS23.2 TaxID=1680155 RepID=UPI0009F9A05D  ali  26  333.......IVQSSFHQVAPRLMAFGERFYTVLFEENPELRGLFKN---------------DLAVQQRMLVSMLNSLVKGLNRLTEIEGGVRALGRRHCRYGVRSDHYGKVANALLLTLAEFLGDDFTPEIRASWIAIFGTISELMVDGAE.. 459
482 7.000e-38UniRef50_H6RLL7 Flavohemoprotein n=7 Tax=Geodermatophilaceae TaxID=85030 RepID=H6RLL7_BLASD  ali  24  2....DIPAMRANFAKAAATGDEAPLYFYSHLFLSHPETRQMFPVS---------------MAHQRDRFFAALGDVVTRVDDLDALVPILRQLGRDHLKFGVLPAHYPAAGGSLLATL-EHFDPEWTPELAKSWAEAYDVVATVMIQGAEE. 131
483 7.000e-38UniRef50_A0A0J9V4N9 CMGC/CDK/CDC2 protein kinase n=1 Tax=Fusarium oxysporum f. sp. lycopersici (strain 4287 / CBS 123668 / FGSC 9935 / NRRL 34936) Ta  ali  19  30..PEQIKVVQSTIPALEKHGLEITTLFYRQLLNKHPELKNIFNTAHQDTG------------EQPAALAHAVWAYAANIENPEAMKAAISRIGHKHASLGVTADQYPIVGQGLLSAIKQILGDEVNSRVLDAWDAAYYQLAEYFI...... 160
484 8.000e-38UniRef50_A0A0T9KLQ3 Monooxygenase n=2 Tax=Actinobacteria TaxID=201174 RepID=A0A0T9KLQ3_MYCTX  ali  22  2....DAQRLKDNFDHVAGQGDAVALFFYSDLFVRNPHLRDMFPVG---------------MSGQRDKLLRALGHIVARVDDLPTLVPFLRQLGRDHRRFGIIAEHYPHVGASLLATLRHFTGDDWTDDVESDWNAAYSLAAKVMLEAAEAD 133
485 8.000e-38UniRef50_A0A2S2QIF8 Globin n=2 Tax=Sipha flava TaxID=143950 RepID=A0A2S2QIF8_9HEMI  ali  25  77LSPVQISRIRRSWSALAQDPTELASALVIRMFKENPEYISLFKRL--KGLSIDELQSNSQFKAHASKVGGALGATIDHLDKPEKLEELLTDIGIKHRKYGLSPKHFEVIRNVLIAIIAEAIGDT-DPELLDLWKSSLTGVMSIIVAG.... 220
486 8.000e-38UniRef50_Q575S8 Cytoglobin-2 n=7 Tax=Clupeocephala TaxID=186625 RepID=CYGB2_DANRE  ali  24  19LTDVERGIIKDTWARVYASCEDVGVTILIRFFVNFPSAKQYFSQ-FQDMEDPEEMEKSSQLRKHARRVMNAINTVVENLHDPEKVSSVLVLVGKAHAKYKVEPIYFKILSGVILEILAEEFGECFTPEVQTSWSKLMAALYWHITGAYTE. 168
487 8.000e-38UniRef50_UPI0002B46EBE flavohemoprotein A-like n=1 Tax=Hydra vulgaris TaxID=6087 RepID=UPI0002B46EBE  ali  15  12LSESSIRLLKSTSAILSTEGTKVTSRMYEIMLSNYPIVKNLFNTSHVRKNG-----NSNTVAPQAQALANAVFRFAANADNLTALQDMLKLIAHKHVSFNILPEHYPIVGNCLLRAIKDVLQDAVTNEVMEAWREGYDYLADLFIK-MEND 156
488 8.000e-38UniRef50_D3V8J6 Flavohemoprotein n=37 Tax=Gammaproteobacteria TaxID=1236 RepID=D3V8J6_XENBS  ali  14  2LDSQVIATVKSTIPLIVSTGPKLTAHFYERMFKHNPELKDIFNMSNQLNG------------AQREALFNALCAYASNIDNLQALLPAVEKIAHKHTSLNIQPEHYQIVGTHLLATLDEMFHPG--DEVLNAWGKAYEVLADVFIN-REED 137
489 9.000e-38UniRef50_T2LEB6 Flavohemoprotein n=43 Tax=root TaxID=1 RepID=T2LEB6_9GAMM  ali  22  2LTHEQEKLINATAPVVAEHLNAITQRFYPLMFTRYPEVKPLFNEVHQQSG------------GQPRALANAVLAYVQLRSNPAQARATLDVVVSKHVSLGILPEQYPIVGECLLAAIDEVLGEAVTPEIADAWGALYNELAALLID..... 135
490 9.000e-38UniRef50_A0A0L1JAY5 Flavohemoprotein n=1 Tax=Aspergillus nomius NRRL 13137 TaxID=1509407 RepID=A0A0L1JAY5_ASPNO  ali  20  26.........QATVPVLQQHGTNITTVFYDNMLTAHPELNAVFNNANKTNG------------HQPRALAGALFAYASHIDDLGALGPAVELICNKHASLYIQPDQYQIVGKFLLEAMGQVLGDALTPEILDAWATAYWQLADLMI-GREAE 154
491 9.000e-38UniRef50_A0A084R652 Uncharacterized protein n=2 Tax=Stachybotrys chartarum TaxID=74722 RepID=A0A084R652_STACH  ali  23  3LTYKESQLVRASVPVLREHGEAVSRLCYSNLLTAHPELNNLFNPANQRNG------------RQPRAFTAVILAFASHINHTSELVPRLERMCNKHCSLGVRPEHYDLVGKFLLKAFAQVLGDAWNQPLYAAWAKAYSMLAK-MLTAREGQ 140
492 9.000e-38UniRef50_UPI0009E516CE neuroglobin-like n=2 Tax=Orbicella faveolata TaxID=48498 RepID=UPI0009E516CE  ali  27  22LSTKEKCLVRNSWGLIKMNSTLVGKTIFLRLFHMKPDLPKLFPEL--KSITSGQLDASSTVFGHAERVMRAVENAVSALDDAESFTAYLEELGRRHKVRALKPDYLEAMHKAFMWTLNDLLHSTWNSDTADAWSKLFLFVCDVMIRGLR.. 168
493 9.000e-38UniRef50_J3NI61 Uncharacterized protein n=4 Tax=Fungi TaxID=4751 RepID=J3NI61_GAGT3  ali  23  3LTYQQMKLVKSTVPVLKESGELIATTFYRDMLAENPRLREVFNSVNQKSG------------RQPRALTQVMLSFANNVSHTSELIPTLEKICNKHCSLGIQQADYSIVGRYLILAFAHVLGPAWTPDVELAWTKAYWVLAKMMIA..... 136
494 9.000e-38UniRef50_A0A0T6B576 Uncharacterized protein n=2 Tax=Scarabaeidae TaxID=7055 RepID=A0A0T6B576_9SCAR  ali  22  20LTPREKSLVVSSWNLVKKDPAGNGVELFRMFFEKKPEYQNYFP---FKGIPMDKLVNDPKLKAHAVSVMYAISSVIDNLDNSEVLITLLQKTGDSHRRRKIPEESFNILHRTMLELLEKGLGSKLSKEGLDAWDKTLTVAFKVVKDTLR.. 165
495 9.000e-38UniRef50_A0A1Y0RKQ8 Globin n=1 Tax=Nostocales cyanobacterium HT-58-2 TaxID=1940762 RepID=A0A1Y0RKQ8_9CYAN  ali  25  189.....VEILVSSFEKVKPRADEFAASFYENLFKAHPEVKPLFTKT--------------DMKNQEKKLLNSLVLVVENLRNPEALRSVLNALGDRHVGYGAIPKYYGPVGEALLVTFEQYLQQNWTSELKKAWVDAFRAITALMLNGTRQE 320
496 1.000e-37UniRef50_S8BSP3 Uncharacterized protein n=2 Tax=Orbiliaceae TaxID=47021 RepID=S8BSP3_DACHA  ali  16  11.TPEQAAIVKSTVPVLEQYGVTITSTFYQNMHRDIPELHEIFNQANQKNG------------HQARALATAVLAYAKYIDNLSVLGEAVELICQKHASLLIQPGHYDIVGKYLLAAIKEVLGGAAADEIVSAWGACYWQLAYIMIDREEQ. 147
497 1.000e-37UniRef50_A0A1H2HBP4 NAD(P)H-flavin reductase n=10 Tax=Jiangellaceae TaxID=1217100 RepID=A0A1H2HBP4_9ACTN  ali  28  95......EALRESMALVEDHLEAVGVDFYAQLFAIAPEARDLF---------------GAGMAVQRSRLVGALVRIVGNADDREVLAPYLEGLGRDHRKFGVIDQHYAPVGTALVLAIRRALGDAWTPRFEKAWVDAYDMIASIMAGAARRD 224
498 1.000e-37UniRef50_U3TZQ7 Globin n=1 Tax=Plautia stali symbiont TaxID=891974 RepID=U3TZQ7_9ENTR  ali  19  3.DAQTIATVKSTLPAIAQLGPQLTGHFYQRMLTQHPELKNVFNMNNQRSGN------------QREALFNAICAYGSNLENLAVLLPAVEKIAQKHASLNIQPAQYAIVGENLLATIKELLGD----EVLAAWGKAYGVLAEVFIQ..... 133
499 1.000e-37UniRef50_A0A1Q6Z9S4 Uncharacterized protein n=2 Tax=Ktedonobacter TaxID=363276 RepID=A0A1Q6Z9S4_9CHLR  ali  25  87.......LLKDSFNLVAPHKEAFAQHFYSQLFARYPQTRQLFPPTE------------EGMRRQESSLIATLAVIVAGVERGENLTQVIRNLGGRHQRYGAQAAHYPLVGQLLLQTFQDFLGDAFTPQMKDAWSKAYEIISTEMLKGA... 215
500 1.000e-37UniRef50_A0A2W4IVZ0 Flavohemoprotein (Fragment) n=1 Tax=Actinobacteria bacterium TaxID=1883427 RepID=A0A2W4IVZ0_9ACTN  ali  26  6......RLLKESWALVEDQQEEVAGYFYARLFLSNPELRDLFPV---------------QMNVQRARLLKAIVRSIQTIDSPEQFDDYLRSLGRDHRKFLVEPRHYDLVRDALLEALREHGGERWSLAYEQAWRDAYDMIAARMQAGAADD 135
501 1.000e-37UniRef50_A0A0X7JRV9 Uncharacterized protein (Fragment) n=113 Tax=Actinobacteria TaxID=201174 RepID=A0A0X7JRV9_9ACTN  ali  27  47.......IIRRTLDEIEPMADKVTSYFYALLFVRHPDLRALFP---------------AAMDTQRDRLFKALLTSVKNVDDTAYLTEYLSHLGRGHRKYGTLPEHYPAVGECLITALARYAATTWGPESEAAWVRAYTKISQIMIDAAAED 175
502 1.000e-37UniRef50_Q81T23 Flavohemoprotein n=521 Tax=Terrabacteria group TaxID=1783272 RepID=HMP_BACAN  ali  22  2LSEKTIEIVKSTVPLLQEKGVEITTRFYEILFSEHPELLNIFNHTNQKKGRQQQALANAV------------YAAATYIDNLEAIIPVVKQIGHKHRSLGIKAEHYPIVGTCLLRAIKEVAGAP--DEVLNAWGEAYGVIADAFI...... 132
503 1.000e-37UniRef50_A0A0E9MYQ4 Putative globin-like protein n=1 Tax=Flavihumibacter petaseus NBRC 106054 TaxID=1220578 RepID=A0A0E9MYQ4_9BACT  ali  29  1MTKEAIRLVQQTWVTVIPVSQTLGEAFYRKLFTAEPLVKHLFKT---------------DIKEQACKLTQMFTHIISHLDRLEDVRGDLHRLGQRHNQYKVKPEYYAIVGESLIATLEQQLGEKWTGATKAAWIDFLTIVFEAMMQG.... 132
504 1.000e-37UniRef50_A0A1W2TF38 Putative nitric oxide dioxygenase n=1 Tax=Rosellinia necatrix TaxID=77044 RepID=A0A1W2TF38_ROSNE  ali  24  3LTRREAELVNETIPALQQHGEHISTVFYKSMLRDHPELNNYFNTVNMHTG------------RQPRALTALILAFASNIVNISELTPKLERVAQKHASLIVRPEHYEIVAKYLIRAFSAVLGPAMTPEVNAAWTKAYWLMAK-MLTGREA. 139
505 1.000e-37UniRef50_A0A2C9U6P7 Uncharacterized protein n=5 Tax=Pentapetalae TaxID=1437201 RepID=A0A2C9U6P7_MANES  ali  19  90.TEDQEALVVKSWNSMKKNSGELGLKFFIKIFEIAPSAKKLFSFLKDSDVPVEQ---NPKLKPHAITVFVMTCESAVQLRKAGKVESSLKDLGATHFKYGVVDEHFEVTKYALLETIKEAVPEMWSPEMKNAWAEAYDQLAAAIKLEMN.. 237
506 1.000e-37UniRef50_A0A0A0DTI6 Flavohemoprotein n=24 Tax=Bacteria TaxID=2 RepID=A0A0A0DTI6_9BURK  ali  20  2LTQTHRELVKGTAALLKEQGVALTRHFYARMFEYNPELKAIFNQGHQREGSQQQALAMAV------------AAYAQHIDNPGVLMPVLELIANKHVSLGIRAEHYAIVGRHLLASIREVLGALATDELIEAWGAAYGQLADVLV...... 134
507 1.000e-37UniRef50_A0A251IW93 Uncharacterized protein n=4 Tax=Mesangiospermae TaxID=1437183 RepID=A0A251IW93_MANES  ali  19  12.TEEQEALVVKSWNVMKKNSAELGLKFFLKIFEIAPSAKKLFPFLKDSNVP---LHQNSKLKSHAMSVFIMTCESAVQLRKAGKVESSLKKLGAVHFKYGVVDEHFEVTKFALLETIKEAVPELWTPEMKIAWGEAYDQLVAAIKTEMK.. 159
508 1.000e-37UniRef50_A0A2G2M2M7 Methyl-accepting chemotaxis protein n=3 Tax=Methylophaga sp. TaxID=2024840 RepID=A0A2G2M2M7_9GAMM  ali  26  44....EIELLEESFAALAPQGEALAARFYERLFDKYPEVKPLFEGIP--------------IDGQQKKLLASLVLLVQNLHKPEILKDYLYSLGARHVQYGVIEAHYPLVAENLLAVMAEFAGELWTDEVKQAWQNTLNTVATIMIEA.... 172
509 2.000e-37UniRef50_A0A257FT98 Uncharacterized protein n=2 Tax=unclassified Burkholderiales TaxID=119065 RepID=A0A257FT98_9BURK  ali  18  10........IEATLPVVLEHGEAITRHFYQRMLGQHPELKNLFNLSNQSQG------------EQAQALARAVYAYAAHMDQPLLIAPVLERIAHKHVSLGITPAQYTIVGRHLLASIGEVLGAAITVDIASAWDEVYWLMASELIA..... 135
510 2.000e-37UniRef50_B9RZD8 Non-symbiotic hemoglobin, putative n=5 Tax=fabids TaxID=91835 RepID=B9RZD8_RICCO  ali  20  387.TEEQEALVVKSWNSMKKNAGELGVKFFLKIFEIAPSAKKLFTFLRDSDVPVEQ---NPKLKPHAMTVFVMTCESAVQLRKAGKVESNLKDLGATHFRYGVVDEHFEVTKFALLETIKEAVPEMWSPDMKNAWAEAYDQLVTAIKNEMK.. 534
511 2.000e-37UniRef50_A0A1R3HY75 Globin n=1 Tax=Corchorus capsularis TaxID=210143 RepID=A0A1R3HY75_COCAP  ali  20  989.TEEQEALVVKSWNSMKKNSAELGLKFFLRIFEIAPSAKKLFTFLKDSDVPAEQ---NPKLKPHAMTVFVMTCESAIQLRKAGKVESSLKDLGATHFKYGVVDEHFEVTKFALLETIKEAVPEMWSPEMKNAWGEAYDQLAAAIKTEMK.. 1136
512 2.000e-37UniRef50_UPI0009B763A7 hypothetical protein n=1 Tax=Bradyrhizobium elkanii TaxID=29448 RepID=UPI0009B763A7  ali  30  47....QQELVQTTFARLAAMPEVTGALFYERLFASNPNFRPLFRNN---------------MRIQGVKLMTMLAMVVYNLPAQDQLSPAIHDLALRHVEYGVKLEDYDAMREALLWTLEQALGEDLTPAVREAWTVCYDELAGEMKAAA... 175
513 2.000e-37UniRef50_UPI0009E50D0A globin C, coelomic-like isoform X1 n=3 Tax=Scleractinia TaxID=6125 RepID=UPI0009E50D0A  ali  23  22LTDDQKNVIKKTWITIEENRTKIGKQTFIRVFELNPQIKKMMPEFMTAD-PIEELNSSRKLFGHSKTLMTCLENAVKSLDDNERFVAYLVELGRRHQVRPLKAPYFEVIHEALMFSLKDVFQSDWTTETSESWSALFRYMSEAMIIGLND. 170
514 2.000e-37UniRef50_A0A137NSM0 Globin-like protein n=76 Tax=Fungi TaxID=4751 RepID=A0A137NSM0_CONC2  ali  20  59ISARQIELVKATAPVLANRGVEITTHFYKNMLGDNPELKNLFNLTHQATGAQAAALAHA------------VWLYADNIDNLDGLKSAISRIGNKHASLGVKPDDYSIVGKYLLFSIKSVLGDSIDDETLESWKEAYKQLAGVFIK..... 192
515 2.000e-37UniRef50_A0A292Z132 Flavohemoprotein n=16 Tax=Pseudonocardiaceae TaxID=2070 RepID=A0A292Z132_9PSEU  ali  27  25..ADTVATISRSWNLIEDRSDELGRHFYATLFHNAPETRDLFPVN---------------MEVQRSRLLRALVHVVQMVDQLDELVPFLQQLGRDHRKFGVLTEHYDAVGDALMSAVATYSGDSWTPDVEKAWNDAYAIAGTAM....... 151
516 2.000e-37UniRef50_UPI0009FE0A5D hypothetical protein n=1 Tax=Algiphilus aromaticivorans TaxID=382454 RepID=UPI0009FE0A5D  ali  27  28.TPRETRLIRESWRNIARDRDAIVVTFYDLLFRWKPELRGYF---------------SEDMSEQRRMMAVTLNLAVSHIDRIETIRESVRDLGRRHARYGARASYYDLVVEALVRAISQHAGPAFGPRVEAAWRRAFALIAEEMLAGAE.. 161
517 2.000e-37UniRef50_A0A157SS23 Flavohemoprotein n=33 Tax=Bacteria TaxID=2 RepID=A0A157SS23_9BORD  ali  23  2LSATVRELVKSTAPVLKTHGEALTRHFYARMFQHNPELKQVFNQGHQQSGQQQQALAMAV------------AAYAEHIDDPSVLGPVLERIAHKHVSLSVRPEQYAIVGKHLLASIREVLGDAATDELIDAWAAAYGQLVDVLV...... 134
518 2.000e-37UniRef50_UPI00064D999B plastid division protein PDV2-like n=1 Tax=Erythranthe guttata TaxID=4155 RepID=UPI00064D999B  ali  18  325.TEEQEALVVQSWSLMKKNAGEWGLKFFLKIFEIAPSAQKMFPFLRDSEVPLDQ---NPKLKPHAKSVFVMTCEAAVQLRKAGKVVSSLKKLGATHFKYGVADEHFEVTKYALMETIKEAVGEMWSAEMKKAWCVAYDHLVAAIKTEMK.. 472
519 2.000e-37UniRef50_A0A178XDP2 Ferredoxin--NAD(P)(+) reductase (Naphthalene dioxygenase ferredoxin-specific) n=120 Tax=Actinobacteria TaxID=201174 RepID=A0A178X  ali  29  33.....VQLIRDTWAKSEPYAPEISQFFYGMLFTLAPATRDFFPIN---------------MEVQGGRIIRALARVVQMVDRPDDLLPFLRQLGRDHRKFGVAPKHYEAVGTALLAALKNHLGPEWTPEVERAWAEAFTIV........... 152
520 2.000e-37UniRef50_A0A070A1K2 Dihydropteridine reductase (Fragment) n=1 Tax=Komagataeibacter rhaeticus AF1 TaxID=1432055 RepID=A0A070A1K2_9PROT  ali  21  5LDDKTRSIIKACVPALEAHGLAITTEMYRRLLA-NPDIRDLFNISHQKDGEQPKALALAV------------LAYARNIDNLGAMAGTVERIAEKHVGLNILPEHYPYVADALLGAIAHVLGDAATPDIMDAWGKAYWFLAEILI-GREEQ 141
521 2.000e-37UniRef50_W7T570 Cysteine desulfurase n=1 Tax=Nannochloropsis gaditana TaxID=72520 RepID=W7T570_9STRA  ali  23 1395..PQAIQLVQSSFEVIKPAGDAFCTCFYDRLFSQHPELETHFRYT--------------DMKHQHASLLSALVLVIQELLDPSSLRSRLLQLGKRHFYYGASPAHYGHVGAAMLWALSTHLGERMTQEIHDAWSDTITFIATVMIEGLEEE 1531
522 2.000e-37UniRef50_D3YW07 Neuroglobin n=1 Tax=Mus musculus TaxID=10090 RepID=D3YW07_MOUSE  ali  76  1MERPESELIRQSWRVVSRSPLEHGTVLFARLFALEPSLLPLFQYNGRQFSSPEDCLSSPEFLDHIRKTLAACHPLILDISALKA................................................................... 84
523 3.000e-37UniRef50_UPI000771BB3A cytoglobin-1 n=1 Tax=Cephus cinctus TaxID=211228 RepID=UPI000771BB3A  ali  21  24LTGKQKKIIQSTWITISKDSATSGAAIMLALLKKYPEYQKLF--TAFSNIPIDDLKNNPKFRAHGSGIINALSSAINSLDDSELLAAKLTMLGERHATRGQTKEQFNDLKPIILEVLKESLGSKFTSEVSEAWSKLIDGAYTFIFKGF... 169
524 3.000e-37UniRef50_A0A0U5L7X2 Flavohemoprotein n=32 Tax=Bacteria TaxID=2 RepID=A0A0U5L7X2_9GAMM  ali  16  3.TSEQKDLVKATVPVLRENGVALTDYFYKRMLKNNPQLKETFNMGHQRSG------------AQAKALAGAVLAYAENIDDPSVLAPVVELICHKHVSLNIQAPDYDIVGENLLHSISEVLNISMEDKLIAAWASAYQQLADLFIA..... 135
525 3.000e-37UniRef50_A0A1Y2TJI7 Globin-like protein n=11 Tax=Sordariomycetes TaxID=147550 RepID=A0A1Y2TJI7_9PEZI  ali  22  2LNYQETKLVKDTLPALKQHGEHISTVFYKTMLRDHPELHNYFNTVNMHTG------------KQPRALTQLILAFASNIINISELTPKLERVAQKHASLSIQPEQYEIVGKYLLRAFSAVLGPSMTPDVKLAWTKAYWVMAR-MLTGREA. 138
526 3.000e-37UniRef50_A0A061N5S4 Flavohemoprotein n=2 Tax=Geomicrobium sp. JCM 19055 TaxID=1460649 RepID=A0A061N5S4_9BACL  ali  21  2LQEQDIKNVKETAFVFKEYGREIGERFYETLFDQHPELHNLFNEANQKRGI------------QQRALMDSVYKAGIHIDELESLGPMITHVAEKHRALGVQPEHYEVVGTILLQTVRDVLGTNVTDDVLESWGKAYAVISGQFIEVERE. 139
527 3.000e-37UniRef50_A0A0U5EUZ4 Nitric oxide dioxygenase n=81 Tax=cellular organisms TaxID=131567 RepID=A0A0U5EUZ4_9PROT  ali  21  5LDDTTRAIITACVPALEAHGLDITREMYARLLA-DPAISALFNRSHQKNG------------EQPTALALAVLMYARNINDLGKLGGMVERIAEKHVGLNILPEHYPHVGTALLGAIKHVLGDAATPEIMDAWAKGYQFLADVLI...... 136
528 3.000e-37UniRef50_A0A1Z4SBX9 Globin domain protein n=3 Tax=Nostocales TaxID=1161 RepID=A0A1Z4SBX9_9NOSO  ali  23  189.....VDLLEISFEKIKPCAEEFAASFYENLFKAHPEVKQLF--------------TNIDMVNQHKQLLNSLVLVVENLRNPEALVPVLKALGRRHVAYGAIPRYYGPVGDALLVTFEQYLQEDWTHEVKKAWVDAFRAITALMLKGAGEE 320
529 4.000e-37UniRef50_Q54D73 Flavohemoprotein B n=3 Tax=Dictyostelium TaxID=5782 RepID=FHBB_DICDI  ali  20  2LSQKSIQIIKSTVPLLEKYGVEITSLFYKNMFEAQPQFLNIFNHSNQRN------------QKQPVALANTILQSAIHIEKLNEIN--LMPIVHKHVALGITPEMYPIVGAHLLGAMKTVMQDEATPEIMAAWTEAYRAVAQAFMDAEED. 137
530 4.000e-37UniRef50_A0A0Q4KPB2 Uncharacterized protein n=1 Tax=Sphingomonas sp. Leaf33 TaxID=1736215 RepID=A0A0Q4KPB2_9SPHN  ali  26  1MHARQIEQIRDTFVHVLFDPERAAGVFYGRLFDLAPETRPLFK---------------SDMDEQGRVLIRSLATIITGLSRFDAMVPTLTDLAIRHDGYGVRRDHYAIVGTAIIDMLEVVCPDDFDDSVRAAWIEAYGLIADTMIAAA... 133
531 4.000e-37UniRef50_A0A177HLN4 Flavohemoprotein n=36 Tax=Streptomyces TaxID=1883 RepID=A0A177HLN4_9ACTN  ali  24  2.............AEVGPVADKVTSYFYALLFVRHPELRSLFP---------------AAMDTQRDRLLKALLTAAEHIDNTDVLVAYLQNLGRGHRKYGTRPEHYPAVGECLIAALTRYATNTWDDETEAAWVRTYTTISQVMIDAAAED 124
532 4.000e-37UniRef50_A0A2M9JPB5 Flavohemoprotein n=13 Tax=Streptomycetaceae TaxID=2062 RepID=A0A2M9JPB5_9ACTN  ali  28  23......ALIRSSLAVAERRAEALTKYFYAHLFKHNPGVRAMFP---------------ERMEEQRDRLFAALTMAILNLEDTDALVGHLHTLGFDHRKFGTRIEHYPAVGRSLIAALKVFSGSAWTPKTEAAWRAAYELISKIMIAGAQ.. 150
533 4.000e-37UniRef50_W4XUE2 Uncharacterized protein n=1 Tax=Strongylocentrotus purpuratus TaxID=7668 RepID=W4XUE2_STRPU  ali  25  19LTKQQKALIKKSWTYVLEDKLRIGVIIFIKLFKAFPASQQLFEKLKDYT-DFEELARNKKMKAHATRVMAALTSLVENIDQPDILDELLRNTSVTHYRMRMPPHYFEDLGGVIIEALVENLGDKFTPKTKEAWLIYYGYMCRI........ 160
534 4.000e-37UniRef50_A0A210PPW3 Neuroglobin n=3 Tax=Mizuhopecten yessoensis TaxID=6573 RepID=A0A210PPW3_MIZYE  ali  25  69LTNKQRYIIKKTWKVMCSNITGHGIKVFLRIFQLHPHVKQLFPC---RDVEGEDLLRDSNFKGHASRFMQAVGAAVENIDDIEALTPLLTGLGKQHIQFGFKNEYFDAFTEAMMYAWHEELKGQFSGETSLAWATVFEFIMHKLKEGHAA. 217
535 4.000e-37UniRef50_A0A165G3Z1 Oxidoreductase FAD/NAD(P)-binding domain protein n=1 Tax=Exidia glandulosa HHB12029 TaxID=1314781 RepID=A0A165G3Z1_EXIGL  ali  17  16LTTEQRALVTATVPVLLEHGSEITRLFYATLLGENPELKNTFNLAKQQQG------------KQADALARAVLAYAQNIDDPTPLLPVVERIAHKHASLHILPQQYAIVGKYLLEAITQVVGDVFSGALYDAWGAAYWQLAHIFI-GREAQ 154
536 4.000e-37UniRef50_A0A2T7NWV6 Uncharacterized protein n=1 Tax=Pomacea canaliculata TaxID=400727 RepID=A0A2T7NWV6_POMCA  ali  28  26LSPAEVQMVQQTWRVLSKDLAGLGVAVFINFFETEPDLKMMFPKVRLNEVSQLEWYVDRDMQRHAVTVMEGLGAAVESLEDSQFLNSVLMALGQTHAKRNMKPTMLKRLWPSLDVGLKTMLGERYTPEVTEAWRKLYNYICLQMRRGME.. 176
537 5.000e-37UniRef50_A0A0B0EJ45 Uncharacterized protein n=1 Tax=Candidatus Scalindua brodae TaxID=237368 RepID=A0A0B0EJ45_9BACT  ali  16  3LTDKTIKIIKATAPVIEEKAIEFAKTFYPIMLSRYPGLIIFFNQAHMHNGT------------QPRAFAASIVEYANSIENLDAIKPLVNDIAEKHASLDIKPVQYKLVTACILETIEDVLGDRGTPEVMAAWKEAIDNFANIIIETER.. 139
538 5.000e-37UniRef50_A0A2W6E4M4 Flavohemoprotein n=1 Tax=Pseudonocardiales bacterium TaxID=2201155 RepID=A0A2W6E4M4_9PSEU  ali  28  32......EAITHTFSLVNQAGDRAVAYFYGRLFAENPELRPMFP---------------AAMDAQRDRLFHALTRIVHGLSSPEAMEPYLSQLGLDHRKYGVLTEHYPAVGRALLATMGRFSGDAWTPGAEAAWAGAYERATQLMTAAAD.. 159
539 5.000e-37UniRef50_UPI0004B39E39 hypothetical protein n=1 Tax=Chania multitudinisentens TaxID=1639108 RepID=UPI0004B39E39  ali  27  590LSADRIKLIQESWKKVGPIADSAAQIFYEKLFTLDPSLRSLFRTEAY---------------VQRKKLIDILTLGVKGLENIERLIPTLQSLSLRHVNYGVKEEYYDTVGAALIYTLGASLKEEFTEEIKQAWVEFYALLSGVMKSA.... 721
540 5.000e-37UniRef50_A0A246WU54 Flavohemoprotein n=19 Tax=cellular organisms TaxID=131567 RepID=A0A246WU54_9BURK  ali  19  2LTDAQLAIVKSTVPLLESGGEALTTHFYKMLMRDYPQVRPLFNRTHQASGD------------QPRALANGVLMYARHIDRLEALGPLAAQIVNKHVAVQIMPEHYPMVGDCLLRAIREVLGAEATDAVIDAWGAAYGQLADILI-GAEQQ 140
541 5.000e-37UniRef50_A0A261VK55 Flavohemoprotein n=6 Tax=Proteobacteria TaxID=1224 RepID=A0A261VK55_9BORD  ali  22  2LSVTVRELVKSTAPVLKTHGEALTRHFYARMFEGNPELKQVFNQGHQQSGQQQQALALAV------------AAYAEHIDDPSVLGPVLERIAHKHVSLGIRPEHYAIVGKHLLASIREVLGEAASEALIHAWAAAYGQLADVLIA..... 135
542 5.000e-37UniRef50_C1EC08 Uncharacterized protein n=2 Tax=Eukaryota TaxID=2759 RepID=C1EC08_MICCC  ali  30  5..PNHVQEVENSWNKVAALGVEVGVLLFKNIFTIAPEALELFSFRN-----EPNLYDSLTLKAHGVNVVNTVGKAVAGLREFYTLVPALAALGERHVEYGILEPHYDVVGKALLMTLEQGLGDAFTPQVKEAWTIVYEAVAVTMK...... 143
543 6.000e-37UniRef50_A0A258UVV7 Nitric oxide dioxygenase n=2 Tax=unclassified Thiotrichales (miscellaneous) TaxID=939858 RepID=A0A258UVV7_9GAMM  ali  16  2ISSDVMKTIQATVPVLAEHGQAITTIFYQKMFAAHPELKNMFNMAHQAKG------------EQQRALAEAVLNYASKIDQLVELGPMVKRIAHKHASLNIQPEHYPIVGKYLLEAIQVFLNLPQDHEILRAWGVAYSALAQIFID..... 135
544 6.000e-37UniRef50_P24232 Flavohemoprotein n=2080 Tax=root TaxID=1 RepID=HMP_ECOLI  ali  19  2LDAQTIATVKATIPLLVETGPKLTAHFYDRMFTHNPELKEIFNMSNQRNGD------------QREALFNAIAAYASNIENLPALLPAVEKIAQKHTSFQIKPEQYNIVGEHLLATLDEM----FSPEVLDAWGKAYGVLANVFIN-REAE 137
545 6.000e-37UniRef50_A0A2I0S660 Flavohemoprotein n=1 Tax=Cercospora zeina TaxID=348901 RepID=A0A2I0S660_9PEZI  ali  18  19LSQEQVKIIKATVPVLQQHGTDVTRLFYKNMLSERPELNNIFNQTNQVNDHQAGALAASLYAY------------ATHIDDLGALSPAVEKICHKHASLYIQPEQYGIVGEGVLRAFATILGDAFTPEIHEAWAAAYWQLANIMI-GREKQ 156
546 6.000e-37UniRef50_A0A1I3PRY4 NAD(P)H-flavin reductase n=18 Tax=Actinobacteria TaxID=201174 RepID=A0A1I3PRY4_9PSEU  ali  27  2....DTARLRSSWNTVAGFGGGVPLFFYSTLFLTRPHLRELFP---------------AGMSAQRDKLVRALGRVVASVDELDAAVPFLRQLGRDHRKFAVTADHYPAVGQALLTTLEHFLGEEWTPELAADWAAAYKIVADVMTAAAKE. 132
547 6.000e-37UniRef50_A0A1L6LK91 Adenylate cyclase n=1 Tax=Minicystis rosea TaxID=888845 RepID=A0A1L6LK91_9DELT  ali  29  351..ADDVREVTASFARIAPRSDDLAARMYERLFERHPHLRRLFPT---------------DMTAQRRKLVGSLVVIVDNLRRSDRLFPLLEDLGRRHAAYGVKVEHFEAVGQALLGAIAD-LDEQLDQKARAAWENAYASIASAMRRGLEGE 483
548 6.000e-37UniRef50_UPI000585BBB2 flavoprotein n=1 Tax=Nocardia cerradoensis TaxID=85688 RepID=UPI000585BBB2  ali  27  1MDSRTVALIRTTFKAVAAEPEQLARSFYALLFTEYPQLRDFFP---------------AALEVQRDRLVKAIGYAVDRLEEPEQLLPFLAQLGRDHRKYGVVAEHYAAVGNSLKSALRAHAGTEWTDEVEQAWDAGLGLISETMIGAAE.. 138
549 6.000e-37UniRef50_A0A0G4M2N6 Uncharacterized protein n=2 Tax=Verticillium longisporum TaxID=100787 RepID=A0A0G4M2N6_9PEZI  ali  19 1201ITEAQTAIVKSTAPILKEHSLTITTVFYKSMLGAHPELHNIFNISNQRSG------------AQQKSLANALLAYATHIDELQKLGPAVERIAQKHVSLGITPDQYAIVGEHLIKAIATVLGDGLTPEVADAW.................. 1321
550 7.000e-37UniRef50_A0A061NUD9 Flavohemoprotein n=2 Tax=Geomicrobium sp. JCM 19038 TaxID=1460635 RepID=A0A061NUD9_9BACL  ali  20  2LQEQDIKNVKETAFVFKEYGREIGERFYETLFEQHPELHNFFNEANQKRGI------------QQRALMDSVYKAGIHIDELESLGPMITHVAEKHRALGVQPEHYEVVGTILLQTVRDVLGTNVTGDVLESWGKAYASIAALFIEAERQ. 139
551 8.000e-37UniRef50_A7ICZ3 Globin n=17 Tax=Rhizobiales TaxID=356 RepID=A7ICZ3_XANP2  ali  26  1MHDDQIGLLETSFAELSTDRDAAAALFYERLFVLDPALKRLF--------------GDTDMAGQGQKLFAALDLVVASLRHLDKVVPVLEQLAVRHVHYGVRDAHYATVGAALIETLSLYFGPRFSMELRRAWSDAYEVVAGVMIAAA... 134
552 8.000e-37UniRef50_UPI000947A5A1 cytoglobin-2-like isoform X2 n=3 Tax=Branchiostoma belcheri TaxID=7741 RepID=UPI000947A5A1  ali  22  86LTPTQSRLVKESWKTFLSKKRENGFVIFRVLFTDYPITKKLFKGVEQMDMAPGQLENSISLRAHVTRFMHSFDTYMECLDEPEDLKQLLYDTGKGHLRHNIKPEYFDVLETVLMKSLRIVFGSKFTPQLEEAWQTAYSHFKVPIKQGLEDE 237
553 8.000e-37UniRef50_UPI000DCA02CA globin-like isoform X1 n=1 Tax=Sipha flava TaxID=143950 RepID=UPI000DCA02CA  ali  25  3LSPVQISRIRRSWSALAQDPTELASALVIRMFKENPEYISLFKRL--KGLSIDELQSNSQFKAHASKVGGALGATIDHLDKPEKLEELLTDIGIKHRKYGLSPKHFEVIRNVLIAIIAEAIGDT-DPELLDLWKSSLTGVMSIIVAG.... 146
554 8.000e-37UniRef50_A0A151TG77 Non-symbiotic hemoglobin 1 n=3 Tax=50 kb inversion clade TaxID=2231393 RepID=A0A151TG77_CAJCA  ali  20  9.TEEQEALVVKSWTVMKKNSGELGLKFFLKIFEIAPSAQKLFPFLRDSTVPLEQ---NPKLKPHATSVFVMTCDSAVQLRKAGKVESNLKKLGATHFKYGVANEHFEVTKFALLETIKEAVPEMWSPAMKNAWGEAYAQLVDAIKSEMK.. 156
555 8.000e-37UniRef50_UPI0002C33079 plastid division protein PDV2-like n=1 Tax=Fragaria vesca subsp. vesca TaxID=101020 RepID=UPI0002C33079  ali  20  290.TEEQEALVVKSWAAMKKNSAELGLQFFLKVFEIAPSAQKLFSFLKDSDIPLEK---NPKLKTHAMSVFVMTCESAVQLRKAGKVTSTLKRLGGVHFKSGVVDEHYEVVKFALLEIIKEAVPEMWSPEMKSAWGEAYDQLVAAIKLEMK.. 437
556 8.000e-37UniRef50_A0A1Q6YA85 Uncharacterized protein n=3 Tax=Chloroflexi TaxID=200795 RepID=A0A1Q6YA85_9CHLR  ali  25  4....QGELLETSFQAIVLHGEAFVTAFYERLFTRFPETRAFF--------------AATDMFEQRKKLQQSLALIVQHMQHPEVLGDMLRELGQRHVTYGIRPEHYPLVGAVLLETFADFLGKHWTQAHHDAWVKGYEAVSSLMLQGTQE. 135
557 9.000e-37UniRef50_A0A1Y1I094 Non-symbiotic hemoglobin n=1 Tax=Klebsormidium nitens TaxID=105231 RepID=A0A1Y1I094_KLENI  ali  26  23LTQEKVGLIQSSYAKIDEKIGAFGKEFYTVLFEMAPAAQALFKSGR---------------EAQSKMFAGMLTTLVKNIDNADKVVPVLQALATRHVRYGVKEAHFPIVGAGLLATLEKVLATDFTPPVREAWTELYGITQTVMWAKMEE. 159
558 9.000e-37UniRef50_A0A0B7KIA1 Uncharacterized protein n=1 Tax=Bionectria ochroleuca TaxID=29856 RepID=A0A0B7KIA1_BIOOC  ali  15  4.TQAQIDIVKATIPILKEHGTTVTSTMYKNMIGNNPELRNVFSMRSQATG------------AQPAALAASVLAYATYIDDLPKLQHAVERIAQKHVSLFIQPDQYMIVAKYLIEAFGIVLGDAFTDEIKDAWVAAYLQLADVFIQ..... 136
559 9.000e-37UniRef50_A0A2R8A7H0 Bacterial hemoglobin n=4 Tax=Rhodobacteraceae TaxID=31989 RepID=A0A2R8A7H0_9RHOB  ali  26  3IDDSDIRLVRKGWATAVAAADQTAQSFYANLFRIAPGTRPLFR---------------EDIDVQGRKLVETLDFIVDHLDELDTLLPAARDLAIRHTAYGVQTEHYDHVGTALITTLQDLLGRDFTDEDQAAWTRVYGTLSGQMIAA.... 134
560 9.000e-37UniRef50_A0A1G6VAC4 NAD(P)H-flavin reductase n=2 Tax=Glycomyces TaxID=58113 RepID=A0A1G6VAC4_9ACTN  ali  30  3....DAERLKKNWSLVASHGDQVPLYFYSTLFLTHPETRDLFPMN---------------MAAQRDKLVNALGAVVSNVDTIDAVVPTLQALGRDHRKFGALRGHYPAVGEALVATLEHFSGPHWTPAIAADWTAAYGLVSATM....... 127
561 1.000e-36UniRef50_A0A1Y2WZU6 Uncharacterized protein n=2 Tax=Hypoxylaceae TaxID=2033035 RepID=A0A1Y2WZU6_9PEZI  ali  22  3LNYKESKLVKDTLPSLRQHGEHISTVFYKTMLRDHPELHNYFNTVNMHTG------------KQPRALTSLILAFASNIVNISELTPKLERVAQKHASLNIQHEQYEIVGKYLLRAFSAVLGPAMTPEVKMAWTKAYWVMAK-MLTGREA. 139
562 1.000e-36UniRef50_UPI0009DC99C5 hypothetical protein n=1 Tax=Myxosarcina sp. GI1 TaxID=1541065 RepID=UPI0009DC99C5  ali  27  1..............................MFTAYPEAQPLF--------------ANTNMAKQKKMLVSSLVLVVENLRNPDVLTSSLKGLGARHVKYGALPAHYPLVGNALLTTFEQYLDDKWTPDVKQAWVDAYGAITEIMLDGAD.. 105
563 1.000e-36UniRef50_A0A1X4N3K0 Dihydropteridine reductase n=1 Tax=Thalassospira sp. MCCC 1A01428 TaxID=1470575 RepID=A0A1X4N3K0_9PROT  ali  17  5LSPRTIELVKATVPALGAHGTDITKVMYAKLFQDA-HIRALFNQSNQGESGSQVKALAAAILAYAR-----------NIDNLEALVPVVERIAHKHIGYHILPEHYAYVARALIGAIAEVLGDKVNEDILTAWGEAYWFLANILIE..... 138
564 1.000e-36UniRef50_A0A210PL01 Neuroglobin n=3 Tax=Pteriomorphia TaxID=6545 RepID=A0A210PL01_MIZYE  ali  20  32LTEEEIKMLEDCWITLKGDIEKVGVITFIGLFETHPEVQDSF--LPFRQLSKKDLELSAILKSHSLRVMGTVDKCIARASQPEKLRDLMSALGQRHISYSAQIEFIEMVGMQFVYAIEPHLKDSWSPELRESWLKLFRVMTYYMAKGMK.. 178
565 1.000e-36UniRef50_A0A0M0EDG7 Flavohemoprotein n=36 Tax=Alphaproteobacteria TaxID=28211 RepID=A0A0M0EDG7_KOMEU  ali  21  5LDDKTRSIIKACVPALEAHGLAITTEMYRRLLA-NPDIRDLFNISHQKDGEQPKALALAV------------LAYARNIDNLGAMAGAVERIAEKHVGLNILPEHYPYVADALLGAIAHVLGDAATPDIMDAWGKAYWFLAEILI-GREEQ 141
566 1.000e-36UniRef50_UPI00084B0125 flavohemoprotein-like n=1 Tax=Hyalella azteca TaxID=294128 RepID=UPI00084B0125  ali  21  10LDDTTRALVKATVPTLATHGEALTRHFYQRLFTHHPMLKEVFNQGHQHTGSQQQALAAAV------------LAYAQHIDEPSALQPALLHIAHKHVSLGIRPEHYPLVGQQLLAAMRDVMGDAATPELLAAWAAAYGQLAEVLID..... 144
567 1.000e-36UniRef50_A0A0C2D0H0 Flavohemoprotein (Hemoglobin-like protein) (Flavohemoglobin) (Nitric oxide dioxygenase) n=1 Tax=Enhygromyxa salina TaxID=215803 R  ali  24  3..PTQIELIRASLPTLREQAIPITQAMYRRMFAANPEVARMFNPAHMHPD------------GQQGALAGAIVAYAEHLDELEVLHDALAVIVHKHVAVQVQPIQYDVVGGHLLAAIAEVLGDAATPELMDTWAAAYGELADVCIAAER.. 137
568 1.000e-36UniRef50_F0SL04 Methyl-accepting chemotaxis sensory transducer with Pas/Pac sensor n=2 Tax=Planctomycetaceae TaxID=126 RepID=F0SL04_RUBBR  ali  25  4....DIPQLRDSFGLIAPRADQFAKSFYDRLFADHPELRSLF--------------AGTSMEDQRQKLIQSLLVTMRSLDQPEKLQPFLQDLGERHREYNVMPRHYDLVGGALLETLGEYLEESWTPDLAAQWKLAYQTIAQIMV...... 130
569 1.000e-36UniRef50_A0A1V1YLG9 Hemin transporter (Fragment) n=1 Tax=Streptomyces sp. WAC00263 TaxID=1917422 RepID=A0A1V1YLG9_9ACTN  ali  26  2LSEQSAATVRATLPAVGAAIGEIADRFYERLFAAHPELRDLFNRGNQASGT------------QRRALAGSIAAFATHLERPDVL---LNRIAHKHASLGIAPEQYATVREHLFAAIAEVLGDAVTPEVEAAWDEVYWLMANALIA..... 138
570 1.000e-36UniRef50_A0A1M4N9F6 Uncharacterized protein n=2 Tax=Donghicola TaxID=393277 RepID=A0A1M4N9F6_9RHOB  ali  22  1MTPFAISLVEETFAKIEPQSEAFARHFYDDLFASAPEVRPYF--------------EGVDTEQQGKKLMAALSALVKGLNDLETTIPMVEELAKRHVAYGVQPDDYDKVGASLMRTLARALEEDFHQEAEMAWDETYSTMATVMKAAYDED 138
571 1.000e-36UniRef50_E4NEB0 Putative oxidoreductase n=6 Tax=Streptomycetaceae TaxID=2062 RepID=E4NEB0_KITSK  ali  26  6......AVIRASFAVVERRADQLTKFFYAHLFTNNPGVEELFP---------------ARLAEQRDRLFAALTQLVTRLEEPEKLTGYLAALGRDHRKFQAAPEHYPAVGASLIAALKHFSGHSWTQEVEKSWLEAFTVISQAMIDAAAA. 134
572 1.000e-36UniRef50_A0A2G8BUM0 Nitric oxide dioxygenase n=1 Tax=Tatumella sp. OPLPL6 TaxID=1928657 RepID=A0A2G8BUM0_9GAMM  ali  18  2LTTHQKQLIQQTIPVLQANGQALTDYFYHRMLSQVPELKETFNMGHQRDG------------KQAKALANAVLAYAENIEDPSVLLPVINMICQKHVSLNIQAPDYAVVGEHLLHSISEVLSVPMEDELISAWAIAYHQLADLMIE..... 135
573 1.000e-36UniRef50_A0A1I6WLE6 Nitric oxide dioxygenase n=3 Tax=Rhodobacteraceae TaxID=31989 RepID=A0A1I6WLE6_9RHOB  ali  19  5LSEATLQIIEATAPVVAQHVDQIVPAMYRRLLADE-EIRALFNMSNQEGQAP-----------QHKALANALVAYATHIRTPNVLAEAVERIAQKHAGLQILPEHYPHVADALLGAISEVLGEAATPEILSAWGEAYWQLAHILI-GREED 142
574 1.000e-36UniRef50_A0A2M9AL56 NAD(P)H-flavin reductase n=11 Tax=Streptomyces TaxID=1883 RepID=A0A2M9AL56_9ACTN  ali  28  1MDANER--IRASFARVERRADHVAKYFYSHLFARNPGVRELFP---------------ADMSEQRDRLFAALTHVVQRLDDPD-LPRYLATLGRDHRKFDARPEHYAAVGESLIAALRFGLPNTWDEETEQAWLGAYKVLSEAMIGGSEE. 132
575 1.000e-36UniRef50_UPI00065B6D0F uncharacterized protein LOC101845586 n=1 Tax=Aplysia californica TaxID=6500 RepID=UPI00065B6D0F  ali  24  166LSEEQKVLLRQSWALITAHVAQVGVETFMGLFHTHPEAIESF-LAFKDYSTVRDIEQSVVLKAHALRVMQTVDKCVTRLDNLDKMSNVITALGRRHVDYRANIKIVPIIGQQFVSAIEPKLGDMWSPDVQCAWQGLFAVVNFHLQSGMAAE 315
576 2.000e-36UniRef50_M4AD09 Cytoglobin n=40 Tax=Osteoglossocephalai TaxID=1489341 RepID=M4AD09_XIPMA  ali  22  17LTDKERVMIQDSWAKVYQNCEEAGVAMLVRLFVNFPSSKLYFSQFK-HIEDTEELEHSPQLRKHAQRVMNALNTLVENIDDSEKVASVLKLVGKAHAKHKVDPVYFKILSGVIVEVLGEEYPEVVTPEVGAAWTKFLATVCSGLKAVYEE. 166
577 2.000e-36UniRef50_A0A0T9KLG1 Oxidoreductase FAD-binding subunit n=2 Tax=Actinobacteria TaxID=201174 RepID=A0A0T9KLG1_MYCTX  ali  27  8........LKDNFALVGANGVDVAEYFYADLFARAPQLRSMFP---------------AAMARQHEVLLAALSQIVSSVDDPESLVPFLQDLGRRHRGFGVIAEHYAPVGASLLATLAYFSGPAWSEDLERDWTAAYGVVAKVMTEAAAE. 134
578 2.000e-36UniRef50_A0A2P4ULE5 Flavohemoprotein n=6 Tax=Actinomadura TaxID=1988 RepID=A0A2P4ULE5_9ACTN  ali  25  2....DAQRLKENFARVAEQGDAVALFFYSDLFVANPHLRDMFPIG---------------MTGQRDKLLRALGLIVSRVDDLPELVPFLQQLGRDHRKFGIVAEHYAPVGASLIRTLKYFSGSYWTPELEADWGAAYGVVAQVMQEASADD 133
579 2.000e-36UniRef50_UPI000CF4EDC8 hypothetical protein n=1 Tax=Rubritalea profundi TaxID=1658618 RepID=UPI000CF4EDC8  ali  19  5LSTTMIETVKATIPFLQQNGQALTEHFYKRMFAGNPEVKEFFNQANQKTGN------------QQQALGAAICAFAQNIETPENLAEAVSRISNKHASLGIKPEHYPIVGEHQLDSIDDLLNPA-PKEILDAWAEAYGFLAGVLTGAEK.. 140
580 2.000e-36UniRef50_A0A146VJ71 Cytoglobin (Fragment) n=1 Tax=Fundulus heteroclitus TaxID=8078 RepID=A0A146VJ71_FUNHE  ali  22  121LTDKERVMIQDSWAKVYQNCEEAGVAILVRLFVNFPSSKLYFSQFKDIEDT-EELVHSSQLRKHAQRVMNAINTLVGNIDNSEKVASVLKLIGKGHAKHKVDPVYFKILSGVILEVLGEEYPEVMTPEVGAAWTKLFATVCAGIKAVYEE. 270
581 2.000e-36UniRef50_A0A1D1V5S9 Uncharacterized protein n=3 Tax=Parachela TaxID=210572 RepID=A0A1D1V5S9_RAMVA  ali  20  59ISDRDKKILLESFGTLRESITKLGILTFLCLFETHPEMIQFF--GNLRDLPPDMIKESKELRQHALRVMGFIEKCIARISSPEKLDAIIRQLGRHHVRYGAPPAFLQLVGPQFINAIRLHLETRWSPETEDAWLNLFSYIAYGMKQAM... 204
582 2.000e-36UniRef50_A0A2V1AIR1 Uncharacterized protein n=1 Tax=[Candida] duobushaemulonis TaxID=1231522 RepID=A0A2V1AIR1_9ASCO  ali  22  13LTTAQKELIKASVPILETSGLDLTKTFYNSMLSGNPEVRPFFNDTNQITY------------RQPKVLAFALLNYAKNIDDLTPLTDFVNQIVVKHVGLQVRAEHYPVVGSHLIATMGKLLGEKATPEFVEAWSIAYGNLAQLLIDAEFAE 152
583 2.000e-36UniRef50_A0A1G4K575 LANO_0F00254g1_1 n=4 Tax=cellular organisms TaxID=131567 RepID=A0A1G4K575_9SACH  ali  21  2LSQETCDTVKATVGVLEQHGTTITSVFYHNMLSEHEELKNVFNDTNQTRGVQSTALAATV------------LAAAKSIENLETLLTQVVQIGHKHRALQVKPEHYPIVGKYLLGAIKEVLGDAASPEIMNAWAEAYDAIAKILI...... 134
584 2.000e-36UniRef50_A0A2G8K001 Globin D, coelomic n=1 Tax=Stichopus japonicus TaxID=307972 RepID=A0A2G8K001_STIJA  ali  22  14LSEVEKNLIRSSWEQALKNKKVFGVNVFIKLFIQNPSSQDLFEQL--RGIPLEDLKTHRKMKAHALRVMASLNTLVEQIDEVEILTEMFNNVARTHVIHKVEKAHYDLLGQVLMEVFSEELGAKFDSATKGAWLKAYVIMENIILDKYAE. 161
585 2.000e-36UniRef50_A0A2L2XXN4 Globin n=2 Tax=Parasteatoda tepidariorum TaxID=114398 RepID=A0A2L2XXN4_PARTP  ali  19  23LTPRQRDTVQNTWKIVRSNIKENGLTFFVKFFQKYPEYQKLFP---FADVPLEKLRDDKKVLAHAMAVMYALNSIVDSLGDVDCLVQILVRIGSGHKPRSIQPIHFENLASFLVSFLIEALGKSMDDSAVEAWRTAFKAANGIIINALQ.. 169
586 2.000e-36UniRef50_A0A2U8HHM8 Hemin receptor n=2 Tax=Rhodobacteraceae TaxID=31989 RepID=A0A2U8HHM8_9RHOB  ali  35  7LTPQHITDIRLSWQVLASDADGFASGFYHRLFRRDPDLGPLF--------------ASTDLPAQRRKLIAAIALVVRHADDLSPVLGPLAELGARHLGYGVKTSDYTTVGGALIETMEAQMQGAFTPEVRDAWLTAYGAVAGTMM...... 137
587 2.000e-36UniRef50_A0A0L0K1T6 Flavohemoprotein n=26 Tax=Streptomyces TaxID=1883 RepID=A0A0L0K1T6_9ACTN  ali  30  2.............AAIGEVSDKVTSYFYALLFVRHPDLRPLFP---------------PAMDAQRDRLLKALLTAAEHVDNTPVLVEYLQNLGRGHRKYGTRPEHYPAVGECLIGALAKYAQSVWNPETEAAWVRTYTTISQVMIDAAA.. 122
588 2.000e-36UniRef50_A0A2E0VKI4 NO-inducible flavohemoprotein n=2 Tax=Cellvibrionales TaxID=1706369 RepID=A0A2E0VKI4_9GAMM  ali  17  3.SQKSKDIIAATLPAVRENAMNITSTFYPLMFERYPQVKAYFNESHQREGTQRQALANAV------------VAYAANLDRLEVLGDAVSLIVQKHASLNILPEHYPIVGECLLEAISIVFGDAATDEVLSAWGEAYQQLADILINAEEA. 139
589 2.000e-36UniRef50_F2Q9W6 Globin n=4 Tax=Branchiostoma floridae TaxID=7739 RepID=F2Q9W6_BRAFL  ali  22  37LTPTQSRLVKESWKMFLSKKRENGFVIFRVLFTDYPVTRKLFKGVEQLDLDPGQLESSITLRAHVTRFMHSFDTYMESLDDPEDLKQLLYDTGKSHLIHNIKPEYFDVLETVLMKSLRIVFGSKLTPQLEEAWQTAYSHLKVTIKQGLED. 187
590 2.000e-36UniRef50_A0A1C2HNM9 Uncharacterized protein n=1 Tax=Thioclava sp. SK-1 TaxID=1889770 RepID=A0A1C2HNM9_9RHOB  ali  26  1MTPEQIAHVQDSFRRIQPMSDTVATVLYADLFTHSPKLKPMFTGL--------------DMAHQGQQLMRAIGHVVANLSTPQAIWPMARTVAVHHAKCGVNPGDYDVFGTGLLRTLDRALGDAFTPEAKTAWIEAYSMLVGVMIKAA... 134
591 2.000e-36UniRef50_A0A0V1PQ05 Uncharacterized protein (Fragment) n=1 Tax=Debaryomyces fabryi TaxID=58627 RepID=A0A0V1PQ05_9ASCO  ali  21  14LTTREKELINASLPILEESGEILTSQFYTNMLADFPEVRPFFNESDQRTM------------KQPRILAFALLNYAKNIDELAPLTAFVNQIVVKHVGLQVKPEHYPIVGKCILDTMKSLLGPGATEEFLTAWATAYGNLAQMLINAEAE. 152
592 2.000e-36UniRef50_O24520 Non-symbiotic hemoglobin 1 n=76 Tax=Mesangiospermae TaxID=1437183 RepID=HBL1_ARATH  ali  20  10.TEEQEALVVKSWSVMKKNSAELGLKLFIKIFEIAPTTKKMFSFLRDSPIPAEQ---NPKLKPHAMSVFVMCCESAVQLRKTGKVETTLKRLGASHSKYGVVDEHFEVAKYALLETIKEAVPEMWSPEMKVAWGQAYDHLVAAIKAEMN.. 157
593 3.000e-36UniRef50_A0A173KSS9 Nitric oxide dioxygenase n=104 Tax=Bacteria TaxID=2 RepID=A0A173KSS9_9SPHN  ali  19  4LSAETIAIVKATAPALRSHGVEITTAMYKRLFQ-DPSIKDMFDQGAQDSG------------EQPKRLAAAILGYAENIDKLQALQGAVARMVQRHVETGVKAEHYPKVAEALLPAIRDVLGEEATDAVLNAWGKAYWFLAEILIQAYED. 145
594 3.000e-36UniRef50_A0A1C2HST2 Uncharacterized protein n=2 Tax=Thioclava sp. SK-1 TaxID=1889770 RepID=A0A1C2HST2_9RHOB  ali  31  1MDHKQIMLVRTSFDQVIKSRPELVEDFYTRLFVLHPELRPLFP---------------ASISAQADKLTATLQIALSSLDQLEGLTQILQDMGRMHRGYGVQDHQYQMVSEVLIDTLAAQLGSAWTVEVSAAWGTLLAFVTYEMIVGAA.. 134
595 3.000e-36UniRef50_UPI0008D21D70 NO-inducible flavohemoprotein n=1 Tax=Rosenbergiella nectarea TaxID=988801 RepID=UPI0008D21D70  ali  17  2LTSQQKKIIQQTIPILKANGTVLTDYFYHRMLSQVPELRETFNMGHQRDG------------KQAKALANSVLAYAENIDDPSVLLPVITMICQKHVSLNIQAPDYSIVGEHLLHSISEVLSVPMEDELIGAWGAAYQQLAALMID..... 135
596 3.000e-36UniRef50_P39676 Flavohemoprotein n=81 Tax=cellular organisms TaxID=131567 RepID=FHP_YEAST  ali  24  2LAEKTRSIIKATVPVLEQQGTVITRTFYKNMLTEHTELLNIFNRTNQKVGAQPNALATTV------------LAAAKNIDDLSVLMDHVKQIGHKHRALQIKPEHYPIVGEYLLKAIKEVLGDAATPEIINAWGEAYQAIADIFI...... 134
597 3.000e-36UniRef50_A0A0B0H4B5 Hemoglobin-like flavoprotein n=2 Tax=Solemya velum gill symbiont TaxID=2340 RepID=A0A0B0H4B5_SOVGS  ali  18  3LSQKTIVIVKESIPIIQEHGLEISSRMYDILFEKYPETKALF---------------SGPIEKQPKILTTAIAAYAENIDQIEKLHDKLMYIANTHVKSHVLEEHYPMVGDAILLAMKEVLADKATSEILEAWGEAYAYLAEIL....... 131
598 3.000e-36UniRef50_Q3SGG8 Flavohemoglobin n=14 Tax=root TaxID=1 RepID=Q3SGG8_THIDA  ali  16  2LSAETLATIKSTAPLLAEQGRAITDLFYSKLFSEHPELQHIFNMANQAQG------------EQSRALAESVFMYATHIDALQKLGPMVSRIAHKHASLQVAPEHYPIVGKYLLEAIRDHLGLEDGHPVLGAWSEAYAQLADIFITTEE.. 138
599 3.000e-36UniRef50_K1RMF6 Cytoglobin-1 n=3 Tax=Crassostrea TaxID=6564 RepID=K1RMF6_CRAGI  ali  25  23.TAEDIRLVKESWKIVGQDLDGAGMMVFHKLFEKNKDLKRLFQNMTHTEADGELVLDEERLRAHSRIVMDGLGAAVESLEDSVILTNILIVMGERHAGYNVRPEMFKLLWPAIRDTFKEKLEDDFTPDIARAWTHVFDYLKARFQEG.... 174
600 3.000e-36UniRef50_A0A1D1W003 Uncharacterized protein n=1 Tax=Ramazzottius varieornatus TaxID=947166 RepID=A0A1D1W003_RAMVA  ali  19  75LTERQKHILAVTFASLRQNIAEIGVVVFMRVFEAYPYAQQIF--DLLKNISQDNLVHSQALKSHAFRVVGFVEKCIARLHRPDKLDAILTNLGQKHRQWKVPPGYIDLLGLQFVAAMKSCLDQQWNAETEEAWIAMFGFITYHMKEAMK.. 221
601 3.000e-36UniRef50_J7L7S1 Globin family protein n=2 Tax=Nocardiopsis TaxID=2013 RepID=J7L7S1_NOCAA  ali  22  142.....IDLVRRSCADVPEGSTRLAKCFYDNLFAMVPEVRDMFP---------------SDIRPQQQRMADALLAVVRHLDSPDEIAEYLRRLGRQHHRLGVRPEHYPHVGRALVRAVSEVS-PTWTSSMSSAWVLVYQWITAHMMAGAQAD 272
602 3.000e-36UniRef50_A0A239E1V7 Hemoglobin-like flavoprotein n=3 Tax=Actinomadura TaxID=1988 RepID=A0A239E1V7_9ACTN  ali  26  6........LKDNFALVGANGVDVAEYFYADLFARAPRLRSMFP---------------ASMAKQHEVLLAALSQIVSSVDDPDALVPFLRDLGRRHGGFGVTADHYAPVGASLLSTLAHFSGPAWSADLERDWTAAYGVVAQVMTEAAAE. 132
603 3.000e-36UniRef50_F7EB40 Neuroglobin n=7 Tax=Xenopus TaxID=262014 RepID=F7EB40_XENTR  ali  60  6LSGPQKELIRESWQTVSQDQLHHGTVLFSSIFQLKSGL--YWPRECLIRVVHQDCLSSAEFTEHIRKVMTVIDAAVSSLDCLSSLDEYLTSLGRKHRAVGVKLESFNTVGESLLFALESCLGDAFTSDTREAWSLLYANVVQSMSRGWHRD 159
604 4.000e-36UniRef50_A0A2G3K4S2 NO-inducible flavohemoprotein n=7 Tax=Betaproteobacteria TaxID=28216 RepID=A0A2G3K4S2_9BURK  ali  23  2LSQTARPYIDASVPVLREHGAAITTQFYTTLFEDHPELMHIFNMGNQANGS------------QQQSLAAAVYAYAANIDNAAALTPVLTRITHKHASIGIKPEHYPIVGRHLLAAIQTILGEAATPALLAAWDEAYGLLATQLI-AMEKQ 139
605 4.000e-36UniRef50_A0A1R4G3V6 Flavohemoprotein (Hemoglobin-like protein) (Flavohemoglobin) (Nitric oxide dioxygenase) n=34 Tax=Actinobacteria TaxID=201174 RepI  ali  30  3.....IEMLKSTWADMSQAGDEAPLYFYSHLFITHPELREMFPVS---------------MASQRDKLFGALGHIVSNVEKLDSDTGFIEELGRDHRRFAVEPEHYSAVGSSLLATLKQFLGSQWTESVAADWSAAYGQIAKIMV...... 127
606 4.000e-36UniRef50_A0A2C9JUR8 Uncharacterized protein n=1 Tax=Biomphalaria glabrata TaxID=6526 RepID=A0A2C9JUR8_BIOGL  ali  21  55LTEEQGQLLKESWVIIKKHVTEVGVETFIGLFNTHPESIDSF--LAFKDKSVQDLERSAVLKAHALRVMQTVDKCITRLDKPERMTSLLLQLGKRHVDYQANIKLIPIIGKQFIGAIEPKMGNAWSHDIKASWAGLFSIINYNMRLGLMEE 203
607 4.000e-36UniRef50_A0A2W2BKA1 Flavohemoprotein n=2 Tax=Jiangellaceae TaxID=1217100 RepID=A0A2W2BKA1_9ACTN  ali  26  126......EALRETLSLVEDHLESVGVDFYAQLFTIAPEARELF---------------GAGMAVQRSRLVGALVRIVGNADDRETLVPYLEALGRDHRKFGVIDQHYAPVGTALVLAVRRAVGDAWTPRHERAWIEAYDKIAAIMSGAARRD 255
608 4.000e-36UniRef50_A0A0F7M597 Hemoglobin-like flavoprotein n=3 Tax=Gammaproteobacteria TaxID=1236 RepID=A0A0F7M597_9GAMM  ali  15  7.....INIVKSTAPILAKEGEKITQLFYQKLFVNHPELQNVFNMTHQIQGD------------QPRALADSVFKYASHIDKLEELGPLVKRIAHKHASLSVAPEQYPVVGKYLLEAIGEHLNLPSDDPILSAWSDAYQQLAAIFVNTEE.. 138
609 4.000e-36UniRef50_A0A1H0SZL4 Nitric oxide dioxygenase n=3 Tax=Actinobacteria TaxID=201174 RepID=A0A1H0SZL4_9ACTN  ali  22  1MSPSSSETVRATAGVVAENGDQITALFYASMLADHPELLRLFNKGNQATG------------EQPRALAASVVAYAGSLIDPDAFHHVMQRIAYKHVSLGIKPQQYTIVGHYLLGAVGEVLGDAVTPQIAEAWNEVYWLFATQLIA..... 136
610 4.000e-36UniRef50_V4A611 Uncharacterized protein n=1 Tax=Lottia gigantea TaxID=225164 RepID=V4A611_LOTGI  ali  27  26.TETQIDTIRSTWPLLSRNMVRVGTDVFVRIFTEVPTVKELFS--SFNIVDVNDLHKMPTFRAHAEMFMQVLHLVVDNLETPSELNHELMVLGARHATFGFKPEYFKFYVKCLIQVWELELGEEFILEVRDCWKIVFDFLVDNMTEGYE.. 173
611 4.000e-36UniRef50_A0A1Q6ZA02 Uncharacterized protein n=2 Tax=Ktedonobacter TaxID=363276 RepID=A0A1Q6ZA02_9CHLR  ali  26  10.....VALLQQSFAEVKSQQEAFAEAFYRRLFALYPQTIPLFATTN--------------MKRQQSLLMATLELVVAGVTRGDNVIPSVEQLGRRHAIYGVKAEHYPMVGQALLETFKQFLQDKWTAQVEATWAQAYAMITDLMRRAGE.. 139
612 4.000e-36UniRef50_M7TXL9 Putative globin-like protein n=2 Tax=Xylariales TaxID=37989 RepID=M7TXL9_EUTLA  ali  23  3LSYQEAKLVKGTIPALKEHGEHIATVFYKTMLRNHPELNNYFNSVNMQNGS------------QPRALTSLILAFASNISHISELIPMMERVAQKHTSLNIQAEDYDIVGKFLLRAFAAVLGPAMTPDVRLAWTKAYWLMSR-MLSTREAQ 140
613 4.000e-36UniRef50_A0A125BCZ6 Flavohemoglobin n=11 Tax=Proteobacteria TaxID=1224 RepID=A0A125BCZ6_THIDE  ali  16  2LSAETLATIKSTAPLLAEQGKAITDLFYSKLFAQHPELQHIFNMANQAQG------------EQSRALAESVFMYATHIDALQNLGPMVSRIAHKHASLQVAPEHYPIVGKYLLEAIQDHLGLEPGHPVLGAWAEAYAQLAGIFIKTEE.. 138
614 4.000e-36UniRef50_A0A0C9RKM4 Ngb protein n=33 Tax=Arthropoda TaxID=6656 RepID=A0A0C9RKM4_9HYME  ali  22  34LTAKQKYTVTSSWKAVARALEPTGIYMFVKLFEENAELLNLFTK-FRELKTKEEQTNSTALAEHAVKVMQTLDEGIKGLDNMDEFFDYLHQVGASHTKIGFNRSLFWKIEAPFLEAVSRTLGDRYTENVETIYKLTIKFIIETLIDGYD.. 182
615 5.000e-36UniRef50_A0A1D7YGQ5 Hemin transporter n=6 Tax=Streptomyces TaxID=1883 RepID=A0A1D7YGQ5_9ACTN  ali  26  2LSEPSAATVRATLPAVGAAIGEIAERFYARLFAAHPELRDLFNRGNQASG------------AQKQALAGSIAAFATHLEHPDTPDAMLGRIAHKHASLGVAPGHYPVVHEHLFAAIVEVLGEAVTPEVAAAWDEVYWLMANALIA..... 138
616 5.000e-36UniRef50_A0A132AHZ9 Cytoglobin-1-like protein n=1 Tax=Sarcoptes scabiei TaxID=52283 RepID=A0A132AHZ9_SARSC  ali  23  3LTNRDKE</