current user: public

If you have questions about the server, please let us know.

Query: HGC00374 gi|162831834|dbj|BABA01012875.1|1.0 TMP00304;, from HGM_OVER

Results of FFAS03 search in CSGID
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200
# Score Template Links and tools%idFirst VKVEVHYFDELLERIRDIRASEKRVYRKVKEIFALSVDYDSKSQVAQSFFKSVQNKLEYAATGHTAPELIAKRADASKDNMGLTSFKGVKVRRGDVTVAKNYMTHEEISTLNLIVNMYLDYAELQAKGHIPMHMADWESKLGDFLRFNGREVLENFGTVKREVAEKLALEQYEQYDTHRRALEAADDVDELTADVKRLKRLast
1 -6.730IDP95146 hypothetical protein KP1_2907 [Klebsiella pneumoniae subsp. pneumoniae NTUH-K2044] YP_002919622 [Klebsiella pneumoniae subsp. pneumoniae NTUH-K2044]  ali follow..  10  53AQFSVKDGEKLVEMIKKN--------KPLSRIVITSGDPD-ATPEVVKHIAATKAAKLAYWGPQMKDGAPTQVYVPQALEANSFTIDGEKVTIMQPHDYAAFVWIRANKTILGGTGVAWGMHLWTADTQTPASRQQWRNTLDQMIALHPQRVIPGHYLGTPPEGDSAVRFTKTYLQQFEQALKTHSDSAGVIKAMEA... 259
2 -5.370IDP91199 gene: yybR; putative transcriptional regulator [Bacillus subtilis subsp. subtilis str. 168] BSU40540 [Bacillus subtilis subsp. subtilis str. 168]  ali follow..  18  35MIDGKKRFNEFRRICPSI--TQRMLTLQLREL-------EADGIVHREVYHQVPPKVEYSLT.......................................................................................................................................... 87
3 -5.070IDP91556 gene: ECs4657; hypothetical protein [Escherichia coli O157:H7 str. Sakai] BAB38080 [Escherichia coli O157:H7 str. Sakai]  ali follow..  15  570.....NFMHKIYNNLRTANPNGNRFYFDFAGLQVLYYDYENKNKPTQNLFLTVKNKAEEKINQEKYIEKPANVAHEIASFFDIEQYLLGGIDRNNNYINENF-KFQDLANLSGTRDAQLERKVYFNEKMLNLNDNDEKVKIENDIKKIDKKIEEIDNAIRDLSSEERFKIKYQQENTLNDVVQNRTWLKENQNMVKAIKK 790
4 -4.820IDP06556 beta-lactamase [Haliangium ochraceum DSM 14365] YP_003270512 [Haliangium ochraceum DSM 14365]  ali follow..  102TAWNDEQTAAILDWAERELG------RPVRGAVFTHAHED-ALALSNQLAAEGGVMPAEASLRLEAGGEPQTLGPVQVFYPGGGHTRDNIVVDGGVLFGGCLIRPGGTNSLGNTADA---------------DLDHWDEAVSAVAKRDRSVVIPSHGPPGGRELLDQTIQLVQSDEKKP..................... 278
5 -4.810IDP06398 gene: ORF52; ORF52 [Human herpesvirus 8] YP_001129405 [Human herpesvirus 8]  ali follow..  15........EDLTAKISQLTVENRELRKALGSPLTATEKEAQLTATVGALSAAAAKKIEARVRTIFSKVVTQKQVDDALKGLSLR.................................................................................................................... 97
6 -4.710IDP02296 hypothetical protein GBAA0020 [Bacillus anthracis str. `Ames Ancestor`] GBAA0020 [Bacillus anthracis str. `Ames Ancestor`]  ali follow..  14  9.......MNNMMKQMQKMQKEMAKAQEELGEK---------------------------TVEGTAGGGMITVIANGHKQILEVK-------------VKEEVVDPEDIEMLQDLVLAATNDALKKADELSNSTMGKFTKGLN.......................................................... 103
7 -4.700IDP06403 ORF68 [Human herpesvirus 8] YP_001129426 [Human herpesvirus 8]  ali follow..  312.......LQTLQCEVMGHIENNVKLVDRIAFVLDNPFAMPYVSDP--LLRELIRGCTPQEIHKHLFCDLCALNAKVVSEDVLFRLPREQEYKKLRASAAGQLLDANTLFDCEVVQTLVFLFKGLQNARVGKTTSLDIIRELTAQLKRHRLDLAHPSQTSHL....................................... 465
8 -4.680IDP05513 putative transcriptional regulator [Clostridium difficile 630] CD0278 [Peptoclostridium difficile 630]  ali follow..  16  43...NPIRYSSIKRKLDGI--TNTMLAQSLKDL-------ESTGIVHRKQYNEIPPKVEYTLT.......................................................................................................................................... 92
9 -4.630IDP91078 ABC transporter, ATP-binding/permease protein CBU_0856 [Coxiella burnetii RSA 493]  ali follow..  14  385...GKSTLINLLPRFYDASTGVIKI-INIKEFRLQELQFGLVSQHTTLFNDTILNNIAYGQAGSIDKRKIIEAARAAHAMEFIEQLPEG--QRQRIAIARALFKNAPIHILDEATSSLDTHSERHIQAALDNLMDQCTTLV-STIERADWIMVLEEGRLIEKGTHQQLLTLNGAYAELYRMQFAEK.............. 587
10 -4.610IDP90201 gene: CPXV215 CDS; CPXV215 Protein AAM13653.1 [Cowpox virus (Brighton Red)]  ali follow..  5...NDIRNRRIIRNISNLLIRDGEEIKAHKTILAAGSTY---------FKTMFTTPM---IARDLVTRVNLQMFDKDAVKNIVQYLYNRHISSMNV---IDVLKCADYLLIDDLVADCESYIKDYTNHDTCICMYHKLYEMIPIVKYIKRMLMSNIPTLITDAFKKTVFEILFDIISTNDNVYLYREGYKVTILLKWLE. 199

FFAS is supported by the NIH grant R01-GM087218-01
1 3 9 8 1 1   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Pawlowski K, Jaroszewski L, Bierzynski A, Godzik A. Multiple model approach--dealing with alignment ambiguities in protein modeling. Pac Symp Biocomput. 1997;:328-39.