current user: public

If you have questions about the server, please let us know.

Query: HGC00947 gi|162844524|dbj|BABA01000185.1|4.0 TMP01280;, from HGM_OVER

Results of FFAS03 search in CSGID
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .
# Score Template Links and tools%idFirst MRKLVKLILLCLIAYPIISIVSSCSEEEDCSMNARPMMQCYLYKIDGETERVVNDTLDSLTITAFGTDSIILNNQKRVHGLSLPLRYTADSTVLVFHYSKDVKIKKDTIVIRQKNTPYFLSMDCGYQMKQSITGRSYSRHLLDSIYIQTAEVSIYGTENLKLFYRNLast
1 -12.000IDP91374 outermembrane lipoprotein [Vibrio vulnificus CMCP6] VV1_1919 [Vibrio vulnificus CMCP6]  ali follow..  1MKN-------IGLLLLASLFLAGCTTPTHLPLSGSQAIEIRIDDQFNPKHCQYLGTVTGNE--GHWYSYLFFSNDTMMQGAVNDLKNNAKEDTIFVIAPQAFVTSFSLLGTAYR---------C.......................................... 109
2 -11.800IDP04197 putative lipoprotein [Clostridium perfringens ATCC 13124] CPF_2510 [Clostridium perfringens ATCC 13124]  ali follow..  1MKK---LLVPVLVIIIFALLFVGCTNSSNSSSDSSVEIINSNQQNSNSNNNNSSNNDTKKSDSNNASHKDNKDNNVSNNKNTNKKLDNKAEKLLKDIKEKAVKGEIIDYDFKLGDSIYDVIDKLGNYFNFDSYNLSFKGDQIFEIRSLNKDLKSLDLNNVE..... 174
3 -11.600IDP05592 putative lipoprotein [Bacillus anthracis str. Ames] BA_3194 [Bacillus anthracis str. Ames]  ali follow..  1MKI----LKFGIIGALSITLLIGCTSNSNETKASNKEASTAVKEKEIVYENVMFEQKEVRKLEISPVNSKSSNQVVNTENIKTIFTSMESAEKKTLLLDQEAKNYIHKMKVTYQDNSI------EFFVWIESDSDIVIAKASDETHGEGYDLREDNSKKIIQFFEK 158
4 -11.200IDP05010 putative lipoprotein [Bacillus anthracis str. Ames] BA_4934 [Bacillus anthracis str. Ames]  ali follow..  14  1MKKV---LMLFVLLLTASILLIGCSTKKE-GMNLEKAQKVEIESLTDSSEKKVITDKKEIEFEVMKMDKWEMQSAPLDTPQGKTFKMYQEDTTKLSESSKDKKELHEIGTMTYKDVPYVEVEMKNKKMSFK--------------------VPEDVAKDLLKY... 144
5 -11.100IDP05588 putative lipoprotein [Bacillus anthracis str. Ames] BA_2883 [Bacillus anthracis str. Ames]  ali follow..  11  1MKVYVKIALLCLTFTCI-FALAACKGTDEKKETNPTS------NSKNEQNTSSEGKKEPEVKSNTDSNSKDIVINQKSINHVKNLFELAKEGKVPNVPFAAHTGDIEEIEKAWGKADKTEQAGNGMYATFTNKNVSFKGSQVFDVRSYHAELKSITLQEIE..... 158
6 -10.500IDP05121 conserved hypothetical protein [Bacillus anthracis str. Ames] BA_0915 [Bacillus anthracis str. Ames]  ali follow..  1MLK---KFTTCILGGALVFNLSGCGNTSDKTSSESKETNSK--EAKTKENTKQKNTEQTKEKSKIKEKEYAVNKDFHTPKFDVTVKKPEDGHVFIVVEAEGKNITSEPMKLAFLPSVDLVDEN-DNAYQSDVWAASSYDVEKGETSSITKELKPGEVKRQNKVYV. 185
7 -10.300IDP05503 putative lipoprotein [Bacillus anthracis str. Ames] BA_4863 [Bacillus anthracis str. Ames]  ali follow..  1MKR-------ALFFFISIFFLGSCSIWYVTFSSESKSWTGQYKGHIKDDSEDGMFTFRYKGGDGNTEFKNLEIAINGAFSTMTQTSENHKGAKIEMKSSCVSCAPLSEIVIKWDDKYE................................................ 116
8 -10.200IDP05580 putative lipoprotein [Bacillus anthracis str. Ames] BA_0936 [Bacillus anthracis str. Ames]  ali follow..  2LKK----LGILVLGSAVALSLVACGDSTKEASNEKKEEPKQEAKKENKENKESKKK.............................................................................................................. 53
9 -9.950IDP05698 hypothetical protein lmo2186 [Listeria monocytogenes EGD-e] lmo2186 [Listeria monocytogenes EGD-e]  ali follow..  1MKKVLVFAAFIVLFSFSFLSTGLTAQAAL--KDGTYSVDYTVIQGDSDSASMANDYF---------DKPATVTVNGGKSTVSLQVNHSKWITGLWVEGNAVSVTSKN-------------ASSDTRKVSFPVSTLSNPVNAKIKVDIDDDDLNYHHEYQIKLRFD. 141
10 -9.890IDP05125 putative lipoprotein [Bacillus anthracis str. Ames] BA_4310 [Bacillus anthracis str. Ames]  ali follow..  1MKK------LIMTLFIAMLALAGCNTNKEEPKKEQKLEAVKVAVQTNPKEIKPGEKTEVQALVTQGKEKV------------------TDADDVKFEVWKAGDEKHEMLEGKHKGKGVYAVE----------KTFETDGVYHIIAHTNAREMHVMPEVKVAV.... 128
11 -9.880IDP05460 putative lipoprotein [Bacillus anthracis str. Ames] BA_0985 [Bacillus anthracis str. Ames]  ali follow..  1MKK----IISICALTALSFTLIGCAS-----TSATDKSPQAKQEHKQNAFQLNSANITDIEILQTTNNTTSKSQTDNKEMIQSIVSAVQKGTPKTITLDQKKRKSAHTITVTYKD................................................... 107
12 -9.860IDP05694 hypothetical protein lmo2007 [Listeria monocytogenes EGD-e] lmo2007 [Listeria monocytogenes EGD-e]  ali follow..  11  1MKK---KWGVIIASLCLLLGLSACGSDEKADANEVPTLKWYMIGTPQKDTEEVMKEVNKYTEEKIG---------VKVEMTQIDWGDYGKRMQTVI----NSGENFDIAYSAAGEFVSYSQK--GAFLPLNKYLDKEGKKMKAEL---NDVLWEGATIDGNIY... 142
13 -9.720IDP05148 putative lipoprotein [Bacillus anthracis str. Ames] BA_0177 [Bacillus anthracis str. Ames]  ali follow..  1MKK----IIFVSSLVLAISLGVGCSNEKTAKTDEPKKESVQKEKELTAKDVFKKTNEAFKNEEHVTMTYGVGVKAEGTEMDIVKAKMQLEPKTKNSRSEMNISGTDVVVYTVDGKVAGEVK............................................. 117
14 -9.650IDP05670 hypothetical protein lmo0617 [Listeria monocytogenes EGD-e] lmo0617 [Listeria monocytogenes EGD-e]  ali follow..  14  1MKK-LKSILLLMGIITFALALTACGGTEDKASTEKI-------ETAKAETKKKSNPNELGDYKVEILSSEVVKDFEGNNAIAIKTKFTNNSKE......................................................................... 85
15 -9.560IDP95390 set238a-027 [Vibrio cholerae]  ali follow..  11  1MTYYKFIALLSFLYCGSSFLYFSCDTKKLEESQGV--VSYTLVKDKKNEIVFESKG--------DGFLGFKYNHYSRFQTDYFNVSFINLEYKYTIFSNYESNQEKRGIIVANINNKKESSYEC-------------ETVHIDRLSDLSTKLACDTDSAL...... 144
16 -9.500IDP06088 hypothetical protein jhp0340 [Helicobacter pylori J99] NP_223059 [Helicobacter pylori J99]  ali follow..  1MKN-------LSTLLVFLFFCLGCVSNFNEDTYTLDLVLEKKIQASRKGEITQDNVPIIT-AIATHLNDVDSGTYYDHEYFLVEINDWIDDGYISYELFGTKPTGSEPLWVREITRDEFDG-------------LETTNRWSRAFLIAFDKLDYLAVQEAKLELDA 150
17 -9.490IDP05607 putative lipoprotein [Bacillus anthracis str. Ames] BA_4862 [Bacillus anthracis str. Ames]  ali follow..  1MDRHMKFSMFMFLGV-VLIILAACTTKSVEQVAVKEVPKEGY-----------------------------IILRNETVFLADDKTFETKIELQNYIEQQMNQDYPSDIVLIFKDKDAYDQLKTGDKIKVWSSQTFESKMIVEKFEIAEK................ 123
18 -9.460IDP05677 hypothetical protein lmo1068 [Listeria monocytogenes EGD-e] lmo1068 [Listeria monocytogenes EGD-e]  ali follow..  11  1MKK----WMVIISIISLVALLGACGNNDN-DKSTTDSTTKKAKSSSNESNKAAETKENDTNDKAATTDKGSSNPTKEEKDTSTTTDTPKKETPKSPAKTEAFSFSPSGFKVSTDVTTTYLSSSKSFQKDFEALTLFINQYKVEHVIVITLDISIKNNSKKDKMYK. 193
19 -9.400IDP06508 extracellular solute-binding protein, family 1 [Enterococcus faecium DO] EAN10305 [Enterococcus faecium DO]  ali follow..  1MKG--KKWLIGSLLVAATGILGACGGGSSAESDSDKEVTLTFWNGFTASDGEILQEI------------VNEFNKTNDKNIKIEMDIMTANLNEKLPTAISSKKAPDFIALNYPDFAQYVENGAVQPLDDFWEYDGVDKSDFKETAIELGEVEGKQVQGMYMYWNN 159
20 -9.380IDP05009 putative lipoprotein [Bacillus anthracis str. Ames] BA_4237 [Bacillus anthracis str. Ames]  ali follow..  11  1MKA----WKSIFVLCSFLLMLSGCFHQEEKKVEPKKKESIPETKEYGGRELKKVGQKVKETGWGTFKLEQIHSVNQTFEVAPMKIHVQDVKVISLSQMSKDAKNTLKVYTALTPEEVKRRLGDKVSQEDAELYASLSGTEISDTIRYVEITYKVENSGNKNMQFFS 162
21 -9.320IDP05554 hypothetical protein CD3669 [Clostridium difficile 630] CD3669 [Peptoclostridium difficile 630]  ali follow..  11  1MKN--KKIMLVLSILSISIFAVGCTNAQNGSDSSKKETKSNTNVEQPKEENNTEKEVPNNKAKPTPKEETIYSFDVDKTDLKVDLNKIDENTLFELQKLKVVPESAKLNSFTTKDIDGVKTGILDVSSDFTKSNLGSDAETLMLDSVARTYIKNMNVEQIKITVDG 174
22 -9.310IDP05267 hypothetical protein lmo0255 [Listeria monocytogenes EGD-e] lmo0255 [Listeria monocytogenes EGD-e]  ali follow..  13  1MKK----FLSILSILVLALLVTACGSDSS--------------KKSAKKEEKMETVTYIADINGAKLEATFSHVGDNLRKVDQKMVYPLTALGLESGANLDDATKKQLEEQVASQYSAYKESK-GASLETKFTD----EALELTMSVDLYKADKDSVASL...... 138
23 -9.250IDP92716 sugar ABC transporter substrate-binding protein [Streptococcus pneumoniae D39] YP_817037 [Streptococcus pneumoniae D39]  ali follow..  12  1MRK---GTMLSVVAGLSLAILAGCSGGTN-SKQASSSNDIKVWVQFSDETNEGKAWQKVVDNFNQSGKSKY-----KVVTEYIPRSGSGGGYEDKVNAAITTNSLPDVITLDGPNTAAYAKS--KVITPLDDYLKDNNMDDVLDSIKQQGTYNGKSESNVGVYYNK 161
24 -9.220IDP06529 gene: acm; collagen-binding MSCRAMM Acm (Fms8) [Enterococcus faecium DO] AFK59905 [Enterococcus faecium DO]  ali follow..  15  1MKKCRNIILSMLFIITNITSLIP-------------------VHVYADAGRDISSNVTSLTVDPTNITD---------GNIKVKFS---------FDEKKQNIQPGDYLWINWPSEGNIRGEG-----FQKEIPLMIENKNVGTLTVRKDSAQVVFNENIK..... 120
25 -9.210IDP04240 extracellular solute-binding protein [Clostridium perfringens ATCC 13124] CPF_1077 [Clostridium perfringens ATCC 13124]  ali follow..  10  2IKRKKALSLILSGIVCSSLILTGCGNSKEEESKETVNLTWYVIGDEPADNDIVEEEVNKYLKDKIN---------ATVDIKHIPFGDYTKKMSVIS----NSGEPYDLAFTCSWAFPYLEYARKGAFLELNDLLDTEGAPLKKEI---NKELWKGAEIDGKIY... 148
26 -9.060IDP05442 putative lipoprotein [Bacillus anthracis str. Ames] BA_0171 [Bacillus anthracis str. Ames]  ali follow..  1MSK--KLLSLFSAVIVAAFVITGCGQSDTTNKEQKENAAKENKTEKTDTTKENKPEEKNPKTRKLKIKRRKIPLLAPAIILNLPTWKKKQAEKQKFFLKIRNHKSINLKMFQYR.................................................... 113
27 -9.040IDP05763 hypothetical protein lmo2331 [Listeria monocytogenes EGD-e] lmo2331 [Listeria monocytogenes EGD-e]  ali follow..  10  1MKKGI--ALLAGFMLAFSIFLTGCGGTDNTRKENHSDGSAEVKNKKDNNTSDEYVEDGLLLKVGEWTKD----------------KDYDTKVTLEKIATPKIKVGLGDLNMLIKDVKIFKRENVSDAEKEEFSGGKVPVTDPYYTIQVKYDLENTGKNVLNFN... 145

FFAS is supported by the NIH grant R01-GM087218-01
1 4 3 4 4 7   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Li W, Godzik A. Discovering new genes with advanced homology detection. Trends Biotechnol. 2002 Aug;20(8):315-6.