|
current user: public |
|
Query: HGC00962 gi|162759780|dbj|BAAZ01005693.1|3.0 TMP01305;, from HGM_OVER |
. 10 . 20 . 30 . 40 . 50 . 60 . 70 . 80 . 90 . 100 . 110 . 120 . 130 . 140 . 150 . 160 . | |||||||
# | Score | Template | Links and tools | %id | First | MYFGAILCKKARQLRVYKAFGGRRHTEGRCSSIDENGKSRHSVWLSDDVWQEVDAFYKLDNCPIRNEFAEKALRQYCGRLHAERTGAYLPRALQGVLEGTLGVFGERLGRLLLKLAVEHNMTNHLLGGDMDMTRDEYSKMRGSSVREVSATHGTISFKDVMVFYKED | Last |
1 | -9.970 | IDP06052 hypothetical protein jhp0557 [Helicobacter pylori J99] NP_223275 [Helicobacter pylori J99] | ali follow.. | 28 | 61 | ...............................KMSKERRIHHNLLLSPSFMAKVDEYMKEKGFPNRSLLFEKALEFYM.......................................................................................... | 106 |
2 | -6.820 | IDP91018 hypothetical protein y2737 [Yersinia pestis KIM 10] y2737 [Yersinia pestis KIM10+] | ali follow.. | 12 | 93 | ............................RHFNAEHQHTRKKSIDLEFLVWQRLAVLARRRGN-TLSDTVVQLIEDAERKEKYASQMSSLKQDLKDILDKEV.................................................................. | 164 |
3 | -6.530 | IDP04078 gene: YPCD1.09c; hypothetical protein YPCD1.09c [Yersinia pestis CO92] YPCD1.09c [Yersinia pestis CO92] | ali follow.. | 15 | 13 | .....................................AHVTSVTLGEHLTGFVGEMIQSGRYGNISEVLRDALRLM----AREQRVQHVRDMVLAGTNV.................................................................... | 71 |
4 | -6.320 | IDP91407 cAMP-binding proteins - catabolite gene activator and regulatory subunit of cAMP-dependent protein kinase [Vibrio vulnificus CMCP6] VV1_0729 [Vibrio vulnificus CMCP6] | ali follow.. | 10 | 62 | .................................EDGKEFSKEFYWEVDWMIGFESAILQQASPFLLETLTPVHLLTFPIELLQHWRSTHHPLYTHLLETQLVYKERKERFLLLHTPEQERLSDRQIAAYLGITPVSLSRIKNR........................ | 184 |
5 | -6.250 | IDP90124 unknown [Monkeypox virus] MPXV_ZAI1979_005_036 [Monkeypox virus] | ali follow.. | 10 | 22 | ...............................EASDNDDRDYVYPLPENMVYRFDKSTNLDYLSTERDHVMMAVQYYMSKQRLDDLYRQLPTKTRSYV--------DIINTYCDKVNNDYNSDMNIMCDMASTESFTVYDINNEVNTILMNNKG.............. | 136 |
6 | -5.730 | IDP02557 gene: fliA; flagellar biosynthesis sigma factor [Campylobacter jejuni subsp. jejuni NCTC 11168] Cj0061c [Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819] | ali follow.. | 10 | 125 | ...............................CEPDDEYLAKKLDLDVEKIKEVRTAHAISYTLPIDEQIELY--------EDNTLEKIEKEELLEKIHEVLDDLKER-DQLIIQLYYYEELSLKEISEILQISESRISQIHKKLLKKLRE................. | 235 |
7 | -5.510 | IDP05057 gene: fliA; RNA polymerase sigma factor for flagellar operon [Clostridium difficile 630] CD0266 [Peptoclostridium difficile 630] | ali follow.. | 9 | 111 | ............................KELKVSEKELHDIESNIDMLNIVSLNYVIFEDTNETVQDVISDR--------EEAPENIIEEEEKLEILSKAISNLNER-EKLILSLYYYEDLNLKEIGKVLGVSESRVSQLHRKSIRNLRNKIKELKYS......... | 232 |
8 | -5.480 | IDP91271 prophage LambdaBa01, positive control factor Xpf, putative [Bacillus anthracis str. Sterne] NT05BA3690 [Bacillus anthracis str. Sterne] | ali follow.. | 13 | 90 | ..................................................................................HQQEHSIGEWDKVRLEDALSLLTER-EKEVYLMSRGYCLTYREIARYLDITCSTVQSMIERAEKKIAR................. | 156 |
9 | -5.300 | IDP91757 VF01_VACCW [Vaccinia virus WR] | ali follow.. | 11 | 28 | ...............................EASNNVDHDYVYPLPENMVYRFDKSTNLDYLSTERDHVMMAVRYYMSKQRLDDLYRQLPTKTRSYI--------DIINIYCDKVSNDYNRDMNIMYDMASTKSFTVYDINNEVNTILMDNKG.............. | 142 |
10 | -5.230 | IDP06400 gene: ORF55; ORF55 [Human herpesvirus 8] YP_001129408 [Human herpesvirus 8] | ali follow.. | 15 | 56 | ................................................................QSNLGTTALQTYLLAVQSNKITDYLKRDVAKIPAGCQETVKTQVKKLQSIQNVVWNTMLALAVGEITVDDSALQSLLNKSLMEMEKLATAMASDDSVIWASE. | 165 |
FFAS is supported by the NIH grant R01-GM087218-01
|
![]() ![]() ![]() ![]() ![]() ![]() |
Selected papers from Godzik Lab Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9. Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018. Pawlowski K, Pio F, Chu Z, Reed JC, Godzik A. PAAD - a new protein domain associated with apoptosis, cancer and autoimmune diseases. Trends Biochem Sci. 2001 Feb;26(2):85-7. |