current user: public

If you have questions about the server, please let us know.

Query: PB050904 Q64SA2_BACFR/1-230 PB050904; Pfam-B_50904;, from HGM_OVER

Results of FFAS03 search in CSGID
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230
# Score Template Links and tools%idFirst MKSRIISLGLVASLVCLLPQVAEAQIAASNPLEWTALAEGNELINGQIEKQIKGQTQTALLQNSIATEFNQIHKWEKQYNSYLKTASGYASSLKACTHLYNDGVRIFLTLGKLGKAIQNNPQGIVASMNMNNLYIETATELVSVFTLLNDAVAKGSNENMLTGAERSKTLWALNDQLSDFSRKLHLLYLSIRYYTFNDVWNNVTAGMLDRDNGEAARMALSHWHRAAALVLast
1 -8.460IDP91951 general stress protein GSP-781 [Streptococcus pneumoniae str. Canada MDR_19A] SpneCM_010100010278 [Streptococcus pneumoniae str. Canada MDR_19A]  ali follow..  10  1MKKKILASLLLSTVMVSQVAVLTT--------------AHAETTDDKIAAQDNKISNLTAQQQEAQKQVDQIQEQVSAIQAEQSNLQAENDRLAESKKLEGEITELSKNIVSRNQSLEKQARSAQTNGAVTS-YINTIVNSKSITEAISRVMLEQQKADKKAISEKQVANNDAINTVIANQQKLADDAQALT...................................... 190
2 -8.330IDP04197 putative lipoprotein [Clostridium perfringens ATCC 13124] CPF_2510 [Clostridium perfringens ATCC 13124]  ali follow..  1MKKLLVPVLVIIIFALLFVGSNSSSDSSVEIINSNQQNSNSNNNNSSNNDTKKSDSNNASHKDNKDNNVSNNKNTNKKLDNKAEKLLKDIKEKAVKGEIIDYDFKLGDSIYDVIDKL-GKPSSENYVAEAKGNYFNFDSYNLSF-DQIFEIRSLNKDLKSLDLNNVENFFGK--KEKIIGYKITKDFKILFVFNTSTYKLDHYSVLYPSITHNSMAGDNGREW....... 237
3 -8.030IDP95159 type IV secretion system VirB5 component [Klebsiella pneumoniae subsp. pneumoniae NTUH-K2044] YP_002920282 [Klebsiella pneumoniae subsp. pneumoniae NTUH-K2044]  ali follow..  11  1MK---TRFRTLILACFIASPLAHAGIPVAVDADPMRDVQWVQELKRWMETARHYQSQIQAYKDQLATQAKGLKADLEKLRKPGQALGGSSGQFDALYEKYKIFDTCNTAQSGSYANVQQVINKAIQLEQTDEVQNQVSQTLGEINSLSNRVALAKDSKESQDLANSIQLLNTLTTQWEMSVKAAEK............................................ 207
4 -7.480IDP05582 putative lipoprotein [Bacillus anthracis str. Ames] BA_1978 [Bacillus anthracis str. Ames]  ali follow..  1MKYGKVAVVGALSVGLLTGCFGEKPEENLYTAFETAATQEKSLVDEAKKLEKLEKEGQELYSQILQEGKDHNDAVMKKIEQATANVDDREKVLKNEKEMLEKAQKETKSVQGNIEKLEDKKL-QKQAKAVEESYKNRYDAFQKMNENYTKALATEKELYEKLKVKETKL-KEIGEKVKAVNELTVEAQKSKQFNNFTKEYNDSKLAFYKDAEIKIKDK............ 217
5 -7.330IDP00762 staphylocoagulase precursor SACOL0209 [Staphylococcus aureus subsp. aureus COL]  ali follow..  15  1MKKQIISLGALAVASSLFTWDNKADAIVTKDYSGKSQVNAGSKLNSALYYLEDYIIYAIGLTNKYEYGDNIYKEAKDRLLEKVLREDQYLLERKK-QWYANYKKENPRTDLKMANFHKYNLEELS-MKEYNELQDALKRALDDFHREVKDIKDKNSDLKTFNAAEEDKATKEVYDLVSEIDTLVVSYYGDKDY-HAKELRAKLDDNPHKITNERIKKEMIDDLNSI.... 247
6 -7.250IDP06510 WxL domain surface protein [Enterococcus faecium DO] AFK58238 [Enterococcus faecium DO]  ali follow..  10  1MNQCVKKLIFVFPLLMVTSVFADVEKTNESTQSENQSFDKTTSEESITSETTESQSEASTNKRQEENKTSETSEVAEQTSDSSEAALARAVSADGYSEA--------ATTEELAQLLADESVTKI------RLIQPLTLDRELEIK--RDIVIDFGGFAH...................................................................... 149
7 -7.040IDP05429 hypothetical protein lmo0791 [Listeria monocytogenes EGD-e] lmo0791 [Listeria monocytogenes EGD-e]  ali follow..  1MKKGLFSMVLVLAMVLVLSACGASR---VEPKKAGEITVN-AVVYNKDTDKVKDVYGEDGSKFEKEFETSFKESFISTFTASFSSDVNLDKQVDEFYD--ALRKQVNEKTSYTTKVTNDDKESPEIQFAIKGL--DMKGVQTELVEELTKAATADPSIASDDQKMAEKTMEIYTKAVQNADAVSEAKTVTLKLKADPSLWK-------MENDMAFMQELTTAF....... 211
8 -6.920IDP01310 outer membrane protein OmpH VC2251 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  1MKNMIKAASLGLIILSSSMMANAAEA-YINTAQVFQALPQREVVLQKMQEEFKDK------AAELQAIQADAKTKIEKLKRDGQLMGQDEVEKLR-IEIGQLDSKYKIKAQALEQASAR---------REAEEKQKLFKVIQDAVKKVADIVLDTSS--MQYGKPEHNLSEKVIKAIK.................................................... 169
9 -6.920IDP95474 hypothetical protein VC1224 [Vibrio cholerae O1 biovar El Tor str. N16961] NP_230869 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  11  1MSLLLRTTALMLLLLSRAPAMAAVPLTTNSTEDNREESQQNEVSSKLFRHSLSGLYGIANQNYPIVQPYQDFDVLYSKAHQAQIELETLCKSTALLTHTQAYFAGTKSRQRALEKVELE-----------------------------------DGQAERITDLARATI---VAHDVASLVTAYETLSREATVVKVKNRFKNPAESGYRDLNVLV............... 178
10 -6.660IDP04045 outer membrane protein [Francisella tularensis subsp. tularensis SCHU S4] FTT1747 [Francisella tularensis subsp. tularensis SCHU S4]  ali follow..  11  13MKKTILGAMIAGGLMVSATTAMAGGVGFANVQDIFETSPLGKAKVTADEKKLKPQ------MDQLKQNITALQEKVNAYTQEKDDVQTDDSKGDT-KVENQDKQQAQADLEKAMKDYQNLMNQV--QKMASDDADAFKDALTKASAQVADAILPAEM--SLYNVDSIDVTKDVIAKMQ.................................................... 191

FFAS is supported by the NIH grant R01-GM087218-01
1 4 3 0 4 3   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Zhang Y, Stec B, Godzik A. Between order and disorder in protein structures: analysis of "dual personality" fragments in proteins. Structure. 2007 Sep;15(9):1141-7.