current user: public

If you have questions about the server, please let us know.

Query: HGC00248 gi|162576253|dbj|BAAV01029229.1|2.0 TMP00024;, from HGM_OVER

Results of FFAS03 search in H.sapiens
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120
# Score Template Links and tools%idFirst LSKEVNQEERAPRTVADVKEMLTKHSNGEIQRTIQNCITILQNDHVLADAIRLNLLSERIDIVKPVGWPRSGKTLNDTDMKYILRRMEKYGISSEKKIESAIRIVGNENPYHPIRDYLNGLLast
1 -7.940sp|O94812|BAIP3_HUMAN BAI1-associated protein 3 OS=Homo sapiens GN=BAIAP3 PE=1 SV=2  ali   10  206................................VLNNVELVRKAAGQALKGLAWPEGATGPEGVLPRPLLSCTQALDDDLQREAHTVTAHLTSKMVGDIRKYVQHISLDEAVAPLMKYLDE. 300
2 -7.710sp|Q9Y6J6|KCNE2_HUMAN Potassium voltage-gated channel subfamily E member 2 OS=Homo sapiens GN=KCNE2 PE=1 SV=1  ali follow..  1..............................MSTLSNFTQTLEDVFRRIFITYMDNWRQNTTAEQEALQAKVDAENFYYVILYLMVMIGMFSFIIVAILVSTVKSKRREHSNDPYHQYIVE. 90
3 -6.840sp|Q6ZTW0|TPGS1_HUMAN Tubulin polyglutamylase complex subunit 1 OS=Homo sapiens GN=C19orf20 PE=2 SV=2  ali follow..  15  28...........................................................................AAGAAESEEDFLRQVGV--TEMLRAALLKVLEARPEEPIAHYFENM 74
4 -6.630sp|A2RUB6|CCD66_HUMAN Coiled-coil domain-containing protein 66 OS=Homo sapiens GN=CCDC66 PE=1 SV=4  ali   14  168...EHPFSAVKQELQRKWIEELNKQIEDDRQRKIEEKIIYSKGEEHDRWAMHFDSLKSYPGSQSQLFSQSTHKQPEYFCVSPDTQELADVSSVCTPTTGSQVEPSEEEHIAKPIKDFLRSM 295
5 -6.190sp|Q9BZH6|WDR11_HUMAN WD repeat-containing protein 11 OS=Homo sapiens GN=WDR11 PE=1 SV=1  ali   45LAKVRLNPEECADVLRRWVDHLCSPQVNQKSKALLVLLSLGCFFSVAETLHSMRYFDRAALFVGAFEVTEDTEKLITAIYADYARSLKNLGFKQGGAAGKDLLNELESPKEEPIEE..... 174
6 -6.180sp|P15382|KCNE1_HUMAN Potassium voltage-gated channel subfamily E member 1 OS=Homo sapiens GN=KCNE1 PE=1 SV=1  ali follow..  14  1......................................MILSNTTAVTPFL-WQETVQQGGNMSGLARRSPRSSDGKLEALYVLMVLGFFGFFTLGIMLSYIRSKKLEHSNDPFNVYIES. 84
7 -6.120sp|Q9C005|DPY30_HUMAN Protein dpy-30 homolog OS=Homo sapiens GN=DPY30 PE=1 SV=1  ali follow..  16  47............................................................................DLQSLPTRAYLDQTVVP---ILLQGLAVLAKERPPNPIESYL... 88
8 -5.840sp|Q03167|TGBR3_HUMAN(removed signalp:1-20) Transforming growth factor beta receptor type 3 OS=Homo sapiens GN=TGFBR3 PE=1 SV=3  ali   16  83....................TIDIRPSQEDLEVVKNLILILKCKKSVNWVIKSFDVKGSLKIIAPNSIGFGKESERSMTMTKSIR--------DIPSTQGNLVKWALDNGYSPITSYTM.. 174
9 -5.760sp|Q96M32|KAD7_HUMAN Putative adenylate kinase 7 OS=Homo sapiens GN=AK7 PE=2 SV=3  ali   16  216....................................................................KREERELLEAQSIPLRNYLMTYVMP---TLIQGLNECCNVRPEDPV-DFLAE. 263
10 -5.540sp|Q5BJE1|CR034_HUMAN Uncharacterized protein C18orf34 OS=Homo sapiens GN=C18orf34 PE=1 SV=3  ali   11  113YMQEKKDCEERIFEEDQRFRVLLAVRQKTLQDTQKIIADSLEENLRLAQEYQFNIYDKQLSLDTSIRDKKQLCQLQRRMHTLWQEHFKLVVLFSQMRLAN-FQTDSQESLMQHILGFFQTL 258

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 6 2 9   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Plewczynski D, Tkacz A, Godzik A., Rychlewski L. A support vector machine approach to the identification of phosphorylation sites. Cell Mol Biol Lett. 2005;10(1):73-89.