current user: public

If you have questions about the server, please let us know.

Query: HGC00267 gi|163310129|dbj|BABD01000566.1|6.0 TMP00066;, from HGM_OVER

Results of FFAS03 search in H.sapiens
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160
# Score Template Links and tools%idFirst MDEKEVSEMQEEMMTVLVVEPMKAPYVKHIPNELEDLQQAVGGDIEMTYPFDDEVGILLNGNGKFEGLPLNRALYDDHGQVYDAIAGTFLVVGLTEDDFTSLTPEQIEKFKEKYQSPEIFTLFNGELHVMKMPPEEEKEQKESRKNDAKQKNPAKKKNRSGDARLast
1 -6.170sp|P49915|GUAA_HUMAN GMP synthase [glutamine-hydrolyzing] OS=Homo sapiens GN=GMPS PE=1 SV=1  ali   16  57.LETPAFAIKEQGFRAIIISGGIGKPVLGICYGMQMMNKVFGGTVHKKSVREDGVFSVDNTCSLFRGLQKEEVVLLTHGDSVDKVADGFKVVARSGNIVAGIANESKKLYGAQF-HPEVGLTENGKVILKNFLYDIAGCSGTFTVQNRELECIREIKERVGTSK 238
2 -6.040sp|Q92750|TAF4B_HUMAN Transcription initiation factor TFIID subunit 4B OS=Homo sapiens GN=TAF4B PE=1 SV=2  ali   13  254.TMLENVKKCKNFLAMLIKLACSGSQSPEMGQNVKKLEQLLDAKIEA..................................................................................................................... 300
3 -5.940sp|P00387|NB5R3_HUMAN(removed signalp:1-33) NADH-cytochrome b5 reductase 3 OS=Homo sapiens GN=CYB5R3 PE=1 SV=3  ali follow..  12  163.......KDPDDHTVCHLLFANQTEKDILLRPELEELRNKHSARFKLWYTLDRAPEAWDYGQGFVNEEMIRDHLPPPEEEPLVLMCGPPPMIQYA--DHVGHPTERCFVF...................................................... 268
4 -5.890sp|Q9Y3I1|FBX7_HUMAN F-box only protein 7 OS=Homo sapiens GN=FBXO7 PE=1 SV=1  ali follow..  14  1.............MR-LRVRLLKRTWPLEVPETLGHLRSHLRQSLLCTYSSNTRFTITLNYKDPLTG--------EETLASYGIVSGDLICLILQDDIPAPNIPSSTDSEHSSLQNNEQPSLATSSNQTSMQDEQPSDSFQGQAAQSGVWNDDSMLGPSQNFE. 147
5 -5.760sp|Q6BCY4|NB5R2_HUMAN NADH-cytochrome b5 reductase 2 OS=Homo sapiens GN=CYB5R2 PE=1 SV=1  ali follow..  171.......KDPSDRTRMSLIFANQTEEDILVRKELEEIARTHPDQFNLWYTLDRPPIGWKYSSGFVTADMIKEHLPPPAKSTLILVCGPPPLIQTAAHPNLGYTQDMIFTY...................................................... 276
6 -5.720sp|Q9UHQ9|NB5R1_HUMAN(removed signalp:1-26) NADH-cytochrome b5 reductase 1 OS=Homo sapiens GN=CYB5R1 PE=1 SV=1  ali follow..  12  174.......KVPEDPTQCFLLFANQTEKDIILREDLEELQARYPNRFKLWFTLDHPPKDWAYSKGFVTADMIREHLPAPGDDVLVLLCGPPPMVQLA--DKLGYSQKMRFTY...................................................... 279
7 -5.500sp|Q8NHY0|B4GN2_HUMAN Beta-1,4 N-acetylgalactosaminyltransferase 2 OS=Homo sapiens GN=B4GALNT2 PE=2 SV=2  ali follow..  310LYDPGPERKLRNLVTIATKTFLRPHK---LMIMLRSIREYY-----------PDLTVIVADDSEYYTMPFGKGWFAGRNLAISQVTTKYVLW---DDDFLFNEETKIEVLVDVLEKTEL............................................. 423
8 -5.380sp|Q7Z3T8|ZFY16_HUMAN Zinc finger FYVE domain-containing protein 16 OS=Homo sapiens GN=ZFYVE16 PE=1 SV=3  ali   11  29LVDLRNYQYTLHNIDQLLIHMEMGKSCIKIPKKYSDVMKVLNSSNEHVISIADSHLVCIQNDGIY-----ETQANSATGHPRKVTGASFVVFNVEDGLMVQITPETMNGLRLALREQKDFK........................................... 167
9 -5.190sp|O75594|PGRP1_HUMAN(removed signalp:1-21) Peptidoglycan recognition protein 1 OS=Homo sapiens GN=PGLYRP1 PE=1 SV=1  ali follow..  11  21.LASECAQHLSLPLRYVVVSHTAGSSCNTPASCQQQARNVQHYHMKTLGWCDVGYNFLIGEDGLVEGRGWNFTGAHSGHLWNPMSIGISFM---GNYMDRVPTPQAIRAAQGLLA................................................. 132
10 -5.180sp|Q92620|PRP16_HUMAN Pre-mRNA-splicing factor ATP-dependent RNA helicase PRP16 OS=Homo sapiens GN=DHX38 PE=1 SV=2  ali   1..................IMVQQRMSLASCGTDWDIVRKCIAAYFHQAAKLKGIGEYVNIRTGMPCHLHPTSSLFGMGYTPDYIVYHELVMTTKE-QCVTAVDGEWLAELGPMF-----YSVKQAGKSRQENRRRAKEEASAMEEEMALAEEQLRARRQEQEKR 143

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 5 5 2   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Lesley SA, Kuhn P, Godzik A., Deacon AM, Mathews I, Kreusch A, Spraggon G, Klock HE, McMullan D, Shin T, Vincent J, Robb A, Brinen LS, Miller MD, McPhillips TM, Miller MA, Scheibe D, Canaves JM, Guda C, Jaroszewski L, Selby TL, Elsliger MA, Wooley J, Taylor SS, Hodgson KO, Wilson IA, Schultz PG, Stevens RC. Structural genomics of the Thermotoga maritima proteome implemented in a high-throughput structure determination pipeline. Proc Natl Acad Sci U S A. 2002 Sep 3;99(18):11664-9. Epub 2002 Aug 22.