current user: public

If you have questions about the server, please let us know.

Query: HGC00518 gi|162728471|dbj|BAAY01000490.1|2.0 TMP00574;, from HGM_OVER

Results of FFAS03 search in H.sapiens
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90
# Score Template Links and tools%idFirst MDEAVAMAQDAIGLMLEDCEVCPKPSLPSAIHVDTGDFIAMIPFDMEEYQKQFKPVKKTLSIPGWLNDAAESAHINFSSVLQKGLKSELGMILast
1 -6.190sp|P24386|RAE1_HUMAN Rab proteins geranylgeranyltransferase component A 1 OS=Homo sapiens GN=CHM PE=1 SV=3  ali   27  134NDNAVKQAETLFQEICPNEDFCPPPPNPEDIILDGDS....................................................... 170
2 -6.100sp|Q6PGQ7|BORA_HUMAN Protein aurora borealis OS=Homo sapiens GN=BORA PE=1 SV=2  ali follow..  17  90.KDVEDKRQKAIEEFFTKDVIVPSPWTDHE-CTNINSDSPVGKKLTIHSEKSDAACQTLLSLPVDFNRADEFADQSPGNLSSSSLRRKL... 196
3 -5.700sp|Q9Y4W2|LAS1L_HUMAN Protein LAS1 homolog OS=Homo sapiens GN=LAS1L PE=1 SV=2  ali   13  15...TCENREAVLDAFLDDGFLVPTFEQLAALQIEYEDGQTEVQRGEGTDPKSHKNVDLDVLVPKPFSQFWQPRGLHSQNFTQALLERMLSEL 106
4 -5.550sp|P26374|RAE2_HUMAN Rab proteins geranylgeranyltransferase component A 2 OS=Homo sapiens GN=CHML PE=1 SV=2  ali   29  136NEHAVKQAETLFQEIFPTEEFCPPPPNPEDIIFDGDD....................................................... 172
5 -5.310sp|Q9UKN7|MYO15_HUMAN Myosin-XV OS=Homo sapiens GN=MYO15A PE=1 SV=2  ali   21FQGIAKACEQNLQKTLRFGGRLELPSSIE----------------LRAMLAGRSSKRQLFLLPGGLERHLKIKTCTVALDVVEEICAEMAL. 95
6 -5.230sp|P51178|PLCD1_HUMAN 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase delta-1 OS=Homo sapiens GN=PLCD1 PE=1 SV=2  ali   11  27.......ARKRLNIRVISGQQLPKVNKNKNSIVDPKVTVEIHGVSRDVASRQTAVITNNGFNPWWDTEFAFEVVVPDLALIRFLVEDY.... 107
7 -5.080sp|Q9NVR5|KTU_HUMAN Protein kintoun OS=Homo sapiens GN=KTU PE=1 SV=2  ali   13  131.........HELVITIE----LPLLRSAEQAALEVTRKLLCLDS-------RKPDYRLRLSLPYPVDDGRGKAQFNKA-------RRQLVVT 195
8 -4.770sp|O00443|P3C2A_HUMAN Phosphatidylinositol-4-phosphate 3-kinase C2 domain-containing subunit alpha OS=Homo sapiens GN=PIK3C2A PE=1 SV=2  ali   21  29.EEALQMEAEALAKLQKDRQVTDNQRGFE............................................................... 56
9 -4.620sp|Q08648|SG11B_HUMAN(removed signalp:1-25) Sperm-associated antigen 11B OS=Homo sapiens GN=SPAG11B PE=2 SV=4  ali follow..  21  5........................................................HSATEALGELRERAPGQGTNGFQLLRHAVKRDL... 37
10 -4.570sp|Q9Y3V2|RWDD3_HUMAN RWD domain-containing protein 3 OS=Homo sapiens GN=RWDD3 PE=1 SV=4  ali follow..  15  1MAEPVQEELSVLAAIFCRPHEWEVLSR-----SETDGTVFRIHTKAEGFMDVDIPLELVFHLPVNYPSCLPGISINSEQLLLEQAESLLS.. 96

FFAS is supported by the NIH grant R01-GM087218-01
1 4 5 8 9 5   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Slabinski L, Jaroszewski L, Rychlewski L, Wilson IA, Lesley SA, Godzik A. XtalPred: a web server for prediction of protein crystallizability. Bioinformatics. 2007 Dec 15;23(24):3403-5. Epub 2007 Oct 5.