current user: public

If you have questions about the server, please let us know.

Query: HGC00579 gi|163284429|dbj|BABD01026259.1|2.0 TMP00679;, from HGM_OVER

Results of FFAS03 search in H.sapiens
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170
# Score Template Links and tools%idFirst NQDSWQKWNAEYEFRYQLMHGLISLRAALGMDYCDSRAADYHHTHCNLYAVVNAQAAYKCMALTFNLRTHRPTLYGETLALGEDLHDIALTYFKKRFSLTLAMNNPFMDNYRIGCENWNRRAGNTSYQYVNETSRMLLVKVTYGMDFGRKRKTAAKRIQNEDTDTGILKGNKLast
1 -6.940sp|P56385|ATP5I_HUMAN ATP synthase subunit e, mitochondrial OS=Homo sapiens GN=ATP5I PE=1 SV=2  ali follow..  15  17......................................................................................................................................SALFLGVAYGATRYNYLKPRAEEERRIAAEEKKKQDEL 54
2 -6.240sp|Q2M1Z3|RHG31_HUMAN Rho GTPase-activating protein 31 OS=Homo sapiens GN=ARHGAP31 PE=1 SV=2  ali   3.............................................................................................................................................KWKFNLGRSGSDSKSKLSRNGSEKATIRPAK 45
3 -5.830sp|Q9UN72|PCDA7_HUMAN(removed signalp:1-29) Protocadherin alpha-7 OS=Homo sapiens GN=PCDHA7 PE=1 SV=1  ali   17  273...............................................................................................................................................TFGKKEETKKKKKNKTQEKKEKG...... 299
4 -5.710sp|Q8N3T6|T132C_HUMAN(removed signalp:1-27) Transmembrane protein 132C OS=Homo sapiens GN=TMEM132C PE=2 SV=3  ali   10  108.......................ELRLDGNVVIWLPSRPVKQGEVVTAYVTISSNSSVDLFILRAKVKKGVNILSAQTREPRQWGVKQEVGSGGKHVTATVACQRLGPSPRNRSSSLFNEVVQMNASFSSLSGTQPITWQVEYPRKGTTDIAVSEIFVSQKDLNTAVLTGKT 272
5 -5.430sp|P58418|CLRN1_HUMAN(removed signalp:1-27) Clarin-1 OS=Homo sapiens GN=CLRN1 PE=1 SV=2  ali follow..  11  21NASGQELDKFMGEMQYGLFHGEGVRQCGLGARPFRFSFFPDLLKAIPVSIHVNV-ILFSAILIVLTMVGTAFFMYNAFGKPFETLHGPLGLYLLSFISGSCGCLVMILFASEVKIHHLSEKIANYKEGTYVYKTQSEKYTTSFWV-AGFQFPFAKSKDAETTNVAADL.... 203
6 -5.380sp|Q9Y5H7|PCDA5_HUMAN(removed signalp:1-28) Protocadherin alpha-5 OS=Homo sapiens GN=PCDHA5 PE=1 SV=1  ali   19  273...............................................................................................................................................TFGKKEETKKKKKKKKGNKTQE---KKEK 298
7 -5.340sp|Q8WXX7|AUTS2_HUMAN Autism susceptibility gene 2 protein OS=Homo sapiens GN=AUTS2 PE=1 SV=1  ali   2......................................................................................SLQGAFQPKTSNPIDVAARPGTVPHTLLQKDPRLTDPFRPMLRKPGKWCAMHVHIAWQIYHHQQKVKKQMQSDPHKLDFG...... 81
8 -5.310sp|Q9UN75|PCDAC_HUMAN(removed signalp:1-29) Protocadherin alpha-12 OS=Homo sapiens GN=PCDHA12 PE=1 SV=1  ali   31  277...............................................................................................................................................TFGKKEETKKKKKK-----------KGNK 295
9 -5.210sp|Q14C87|T132D_HUMAN(removed signalp:1-30) Transmembrane protein 132D OS=Homo sapiens GN=TMEM132D PE=2 SV=1  ali   103.......................ELRLDNSVAIHYIPKTVRKGDVLTFPVSISRNSTEDRFTLRAKVKKGVNIIGVRASSPSIWDVKERTDYTGKYAPAVIVCQKKAAGSENSADGASYEVMQIDEEPGDLPATQLVTWQVEYPGEITSDLGVSKIYVSPKDLNTAILTGKT 267
10 -5.190sp|Q8NBV8|SYT8_HUMAN Synaptotagmin-8 OS=Homo sapiens GN=SYT8 PE=2 SV=3  ali follow..  79............................................................................................KKPRDKESVGLGSA--RGTTTTHLVQPDVDGLESSPGDAQQWGCLQLSLEFDFGSQEVKGPAAQDQRFCEFPERVTGEGQ 156

FFAS is supported by the NIH grant R01-GM087218-01
1 4 5 8 9 5   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Slabinski L, Jaroszewski L, Rychlewski L, Wilson IA, Lesley SA, Godzik A. XtalPred: a web server for prediction of protein crystallizability. Bioinformatics. 2007 Dec 15;23(24):3403-5. Epub 2007 Oct 5.