current user: public

If you have questions about the server, please let us know.

Query: PB002794 gi|86143885|ref|ZP_01062253.1| hypothetical protein MED217_03525 [Flavobacterium sp. MED217]gi|85829592|gb|EAQ48055.1| hypothetical protein MED217_03525 [Leeuwenhoekiella blandensis MED217], from HGM_OVER

Results of FFAS03 search in H.sapiens
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310
# Score Template Links and tools%idFirst MNTETLTYLLEHPDKITSEETTQLRTVVEEFPFFQAARALHLKGLKNEDSFLYNTYLKKTAAHTQDRTVLFDFITSEIFNQTAISAQIKAQEDHLRNMPVHEFVDVSSEMEAEELQKANRVLDPEFFVRKEASEETQPEEQLQLGKPLDFNKAETHSFSEWLKLTAFNKIDRSKEVKETISASASDKTEASSENTIIEETASETPLELETTIPSIEVDQDPERARRLELIDKFIESNPKIKVSTPDSNFKKPNLEDRFQPSDSLMTETLARVYVEQKNFSKAKQAYRILSLKYPEKSGFFADQIRAIEKLQENLast
1 -12.500sp|Q12797|ASPH_HUMAN Aspartyl/asparaginyl beta-hydroxylase OS=Homo sapiens GN=ASPH PE=1 SV=3  ali   13  1.........................................................................IQSLLHEMVHAEHVEGEDLQQEDGPTGEPQQEDDEFLMATDVDDRFETLEPEVSHEETEHSYHVEETVSQDCNQDMEEMMSEQENPDSSEPVVEDERLHHDTDDVTYQVYEEQAVYEPLENEGIEITEVTAPPEDNPVEDSQVIVEEVSIFPVEEQQEVPPETNRKTDDPEQKAKVKKKKPKLLNKFDKTIKAEDAAEKLRKRGKIEEAVNAFKELVRKYPQSNEVLRGAIETYQEVAS. 260
2 -12.300sp|Q9Y5T4|DJC15_HUMAN DnaJ homolog subfamily C member 15 OS=Homo sapiens GN=DNAJC15 PE=1 SV=2  ali follow..  16  89....................................................................................................................................................................................................................................................................EQKMSRREAGLILVSPSAGKAKITAHRRVMILHPDKSPYVAAKINELETTTKH 150
3 -11.300sp|Q49AM3|TTC31_HUMAN Tetratricopeptide repeat protein 31 OS=Homo sapiens GN=TTC31 PE=2 SV=3  ali follow..  10  1M--APIPKTVGRPLEVAEDIVDFLRRLVESDP--QGLHRIHVDGSGRLQLWHHDYLLEGLGTYCGLRK--FLYPPQESEPCPQSPSASATFPSVSDSLLQVAMPQKLLVTEEEANRLAEELVAEEERMKQKAEKKRLKKKRQKERKRQERLEQYCGEPKASTTSDGDESPPSSPGNPVQGQCGEEEDSLDLSSTFVSLALRKVGDWPLSARREKGLNQEPQGRGLALQKMGQEEESPPREERPQQSPKVQASPGLLAAALQQSQELAKLGTSFAQNGFYHEAVVLFTQALKLNPQDHRLFGNRLGQPAWALAD 361
4 -10.400sp|A8MVZ4|TTC3L_HUMAN Putative tetratricopeptide repeat protein 3-like OS=Homo sapiens GN=TTC3L PE=5 SV=2  ali follow..  10  196...........................................................................................................................................................................................................................................TKIVMEDCNLLEELKTQSCMDCIEQGELM--KMKGNEEFSKERFDIAIIYYTRAIEYRPENHLLYGNR.......... 261
5 -9.840sp|P53804|TTC3_HUMAN E3 ubiquitin-protein ligase TTC3 OS=Homo sapiens GN=TTC3 PE=1 SV=2  ali   10  214...................................................................................................................................................................................................................................................NLLEELKTQSCMDCIEEGELMKMK--GNEEFSKERFDIAIIYYTRAIEYRPENYLLYGNRTGQFRNALGD 287
6 -9.770sp|Q9H9A5|CNOTA_HUMAN CCR4-NOT transcription complex subunit 10 OS=Homo sapiens GN=CNOT10 PE=1 SV=1  ali   12  2...........................................................................................................................................................................................................................................AADKPADQGAEKHEGTGQSSGITDQEKELSTN--AFQAFTSGNYDACLQHLACLQDINKDDYKFFKSNQTTTDNLRQT 86
7 -9.750sp|Q8N5D0|WDTC1_HUMAN WD and tetratricopeptide repeats protein 1 OS=Homo sapiens GN=WDTC1 PE=1 SV=2  ali   11  181..........................................................................................................................................................................................................................................GVSNGLHLHSNGFRLPESRGHVSPQVELPPYLERVANEAFACQQWTQAIQLYSKAVQRAPHNAMLYGNRAAAYMKR... 259
8 -9.740sp|Q68DU8|KCD16_HUMAN BTB/POZ domain-containing protein KCTD16 OS=Homo sapiens GN=KCTD16 PE=2 SV=1  ali follow..  13  352.......................................................................................................................................................................................................................................QLIQQSEMRRKSDLLRTLTSGSRESNMSSKKKAVKEKLS-----EEELEKCIQDFLKIKIRFPERKHPWQSEL--LRK.... 425
9 -9.630sp|Q13099|IFT88_HUMAN Intraflagellar transport protein 88 homolog OS=Homo sapiens GN=IFT88 PE=1 SV=2  ali   26  68...........................................................................................................................................................................................................................................................................MVASCFRRSGNYQKALDTYKDTHRKFPEDAQEYARKLKRLEKMKE. 130
10 -9.550sp|Q9UNE7|CHIP_HUMAN E3 ubiquitin-protein ligase CHIP OS=Homo sapiens GN=STUB1 PE=1 SV=2  ali follow..  2..............................................................................................................................................................................................................................................KGKEEKEGGARLGAGGGSPEKSPSAQELKEQGNRLFVGRKYPEAAACYGRAITRNPLVAVYYTNRMQQHEQALAD 82
11 -9.320sp|Q68DK2|ZFY26_HUMAN Zinc finger FYVE domain-containing protein 26 OS=Homo sapiens GN=ZFYVE26 PE=1 SV=3  ali   15  1.............................................................................................................................................................................................EQPSRRYQPATRHPSLRRGRRTRRSQADGRDRGSNPSLESTSSELSTSTSEGSLSAMSGRNELHSRLHPHPQSSLIPESLLASCILRGNFAEAHQVLFTFNLKSSPGELMFMERYQEVIQELAQ 132
12 -9.140sp|Q9UHK0|NUFP1_HUMAN Nuclear fragile X mental retardation-interacting protein 1 OS=Homo sapiens GN=NUFIP1 PE=1 SV=2  ali follow..  11  230.........LDTPEEIAR-----REERRKNYP---TLANIERKKKLKLEKEKRGAVLTTTQYGKMKGM-----------------------SRHSQMAKIRSPGKNHKWKNDNSRQRAVTGSGSHLCDLKLEGPPEANADPLGVLINSDSESDKEEKPQHSVIPKEVTPALCSLMSSYGSLSGSESEPEETPIKTEADVLAENQVLDSSAPKSPSQDVKATVRNFSEAKSENRKKSFEKTNPKRKKDYHNYQTLFEPRTHHPYLLEMLLADIRHERNVILQCV--------RYIIKKDFFSKDV......... 495
13 -9.120sp|Q9H9A5|CNOTA_HUMAN CCR4-NOT transcription complex subunit 10 OS=Homo sapiens GN=CNOT10 PE=1 SV=1  ali   10  174...................................................................................................................................................................................................................................................ESSGKRAPQCYPSSVNSARTVMLFNLGSAYCLRSEYDKARKCLHQAASMIHPQNGNTQLALQIIKR.... 255
14 -9.060sp|P78344|IF4G2_HUMAN Eukaryotic translation initiation factor 4 gamma 2 OS=Homo sapiens GN=EIF4G2 PE=1 SV=1  ali   13  215..........................................................................................................................................................................................................................................PQLGLKTNPPLIQEKPAKTSKKPPPSKEELLTETVVTEYLNSGNANEAVNGVREM--RAPKH--FLPEMLSKLDRSDED 296
15 -9.050sp|Q9C0C9|UBE2O_HUMAN Ubiquitin-conjugating enzyme E2 O OS=Homo sapiens GN=UBE2O PE=1 SV=3  ali   25............PSVITQENLGRVKRL---------------------------GCFDHAQRQLGERCLYVFPAKVEPAKIAWECPEKNCAQGEGSMAKKVKRLLKKQVVRIMSCSPDTQCSRDHSMEDPDKKGESKTKSEAESASPEETPDGSASPVEMQDEGAEEPHEAGEQLPPFLLKEGRDDRLHSAEQDADDEAADDTDDTSSVTSSASSTTSSQSGSGTSRKKSIPLSIKNLKRKHKRKKNKITRDFKPGDRVAVEVVTTMTSADVMWQDGSVECNIRSNDLFPVHHLDNNEFCPGDF--VDKRVQS 297

FFAS is supported by the NIH grant R01-GM087218-01
1 3 7 8 0 7   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Sasin JM, Godzik A, Bujnicki JM. SURF'S UP! - protein classification by surface comparisons. J Biosci. 2007 Jan;32(1):97-100.