current user: public

If you have questions about the server, please let us know.

Query: PB034883 _HOMD.0130261_ bfor_c_1_4664 Tannerella forsythia ATCC 43037 [1809083 - 1810348] ORF, from HGM_OVER

Results of FFAS03 search in H.sapiens
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .
# Score Template Links and tools%idFirst MRKELHNTKVTVRLRKSAYRNEWYLYIESYPVYTAGKSEPQRVREYLNRIVTTVVWDKTRTARTTSSSKSYKPKRDLNGVIQCKSEVDQEACIYADEVRKLRQREYDNADLYSDADTAQAEQKERLQQNFIGYFREAMYKRHKNSSTSILVNWKRAMDFLKMYAGENLPFFKIDNAFAEEYKRFLLTAPLast
1 -6.550sp|Q2KHR3|QSER1_HUMAN Glutamine and serine-rich protein 1 OS=Homo sapiens GN=QSER1 PE=1 SV=3  ali   13  218..............................................................................................................................................SESCHDGYQHQEKMRQKIKEVEEKQ---PEVKTGFIASFLDFLKSGP 261
2 -6.430sp|Q96ST3|SIN3A_HUMAN Paired amphipathic helix protein Sin3a OS=Homo sapiens GN=SIN3A PE=1 SV=2  ali   10  127..................................................................................................................................LSYLDQVKLQFGSQ------QVYNDFLDIMKEFKSQSIDTPGVHPDLIMGFNTFL---P 187
3 -6.210sp|Q3KNS1|PTHD3_HUMAN Patched domain-containing protein 3 OS=Homo sapiens GN=PTCHD3 PE=1 SV=2  ali   28...................................................................................................................DLRNLASDDSYITPYFNVEENYFSDVTKKVDYWDKDVRQKLENCTKIFEKNVYVDKNLTEFWLDAYVQYLKGN. 108
4 -6.190sp|Q5XPI4|RN123_HUMAN E3 ubiquitin-protein ligase RNF123 OS=Homo sapiens GN=RNF123 PE=1 SV=1  ali   11  3..................................................IPTTWWPHCSSREGKESTEMKEETAEERLRRRAYERGCQRLRKRIEVVE-----ELQVQILKLLLDNKDDNGGEASRYIFLTKFRKFLQENASGRGN-MVCFLHRLISALRYFYNGKVDYFDLQR--LGGLLSHLRKT. 165
5 -5.960sp|O75182|SIN3B_HUMAN Paired amphipathic helix protein Sin3b OS=Homo sapiens GN=SIN3B PE=1 SV=2  ali   42...............................................................................................................................EDALTYLDQVKIRFGSD------ATYNGFLEIMKEFKSQSIDTPGVHPDLIVGFNAFL---P 105
6 -5.850sp|Q92530|PSMF1_HUMAN Proteasome inhibitor PI31 subunit OS=Homo sapiens GN=PSMF1 PE=1 SV=2  ali follow..  1....MAGLEVLFASAAPATCRQDALVCFLHWEVVTLGVGDQPGPNDKKSELLPAGWNNNKDLYVLRYEYKDGSRKLLVKAITVESSMILNVLEYGSQ--QVADLTLNLDDYIDAEHLGDFHRTYKNSEELRSRIVSGIITPIHEQWEKANVSSPH.................................. 155
7 -5.770sp|Q9NZD4|AHSP_HUMAN Alpha-hemoglobin-stabilizing protein OS=Homo sapiens GN=AHSP PE=1 SV=1  ali follow..  22  48.................................................................................................................................YINYYRQQVTGEPQERD-----------KALQELRQE---LNTLANPFLAKYRDFLKSH. 92
8 -5.690sp|Q86Y26|NUT_HUMAN Protein NUT OS=Homo sapiens GN=NUT PE=1 SV=2  ali   65..RQWQRYKALARRHLSQSPDTEALSCFLIPVLRSLARLKPTMTLEEGLPLAVQEWEHTSNFDRMIFYEMAERFMEFEAEEMQIQNTQLMNGSQGLSPATPLKLDPLGPLASEVCQQPVYIPKKAASKEYVDIMEWLVEEEGQQQEEEGMYPDPGLLSYINELCSQKVFVSKVEAVIHPQFLADLLSP. 292
9 -5.610sp|Q96ST3|SIN3A_HUMAN Paired amphipathic helix protein Sin3a OS=Homo sapiens GN=SIN3A PE=1 SV=2  ali   14  149.........................................................................................................................NQPVEFNHAINYVNKIKNRFQGQPD-----IYKAFLEILHTYQKEQRNAKEAQEDLLSEFGQFL.... 230
10 -5.580sp|Q15256|PTPRR_HUMAN(removed signalp:1-23) Receptor-type tyrosine-protein phosphatase R OS=Homo sapiens GN=PTPRR PE=1 SV=2  ali   13  239.........................................................................................................................................IPRHGTKNRYKTILPNPLSRVCLRPKNVTDSLSTYINANYIRGYKAFIATGP 295

FFAS is supported by the NIH grant R01-GM087218-01
1 4 0 5 8 1   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Friedberg I. and Godzik A Connecting the Protein Structure Universe by Using Sparse Recurring Fragments. Structure (Camb.) (2005) Aug;13(8):1213-24