current user: public

If you have questions about the server, please let us know.

Query: PB062763 Q9F6U5_BACTN/1-245 PB062763; Pfam-B_62763;, from HGM_OVER

Results of FFAS03 search in H.sapiens
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .
# Score Template Links and tools%idFirst MTKVFLIVSVACNVWFLLMLLSDRITETKFVRFLKGAAGLWRSLGTKSEKQDTLHSEASDEDADIIGKSRFRMAPTRTTAAISTQEAAISEKGIELSEEEATFDDGNTETASRPTQVPEDKLDETFTSISPEELEYGEDEPEDDEPGKGQASGSAFEDIDMAVRTIKKDSPSEAEMRHAGKVMTELDGTELYSRITERLTDEPMSERLAKAMAVFVDTVNTTVAQPKTKVFVVLDNIEEFEIRNNLast
1 -8.810sp|Q9H6L5|F134B_HUMAN Protein FAM134B OS=Homo sapiens GN=FAM134B PE=2 SV=1  ali follow..  214IPGVILSYLLLLCAFLCPLFKCNDIGQKIYSKIKSVLLKLDFGIGEYINQKKRERSEADKEKSHKDDSELDFSALCPKISLTVAAKELSVSDTDVSEVSWTDNGTFNLSEGYTPQTDTSDDLDRPSEEVFSRDLSDFPSLENGMGTNDEDELSLGLPTELKRKKEQLDSGHRPSKETQSAAGLTLPLNSDQTFHLMSNLAGDVITAAVTAAIKDQLEGVQQALSQAAPEEDTDTEEGDDFELLD. 459
2 -7.640sp|Q86VR2|F134C_HUMAN Protein FAM134C OS=Homo sapiens GN=FAM134C PE=1 SV=1  ali follow..  13  187VPGLLLSYLMLVTVMMWPLAVYHRLWDRAYVRLKPALQRL-YMMSKQRERQLRRRALHPERAMDNHSDSEEELAAFCPQLDDSTVARELAITDSEHSDAEVSCTDNGTFNLSRGQTPLTEGSEDLDGHSDPEESNMDPAGLDDEDDTSIGMPSLMYRSPPGAEEPQAPPASRDEAALPELLLGALPVGSNLTSNLASLVSQGMIQLALSGASQPGPSGAPAQRATRGFLRSPSSDLDTDAEGDDF 447
3 -7.360sp|Q5T200|ZC3HD_HUMAN Zinc finger CCCH domain-containing protein 13 OS=Homo sapiens GN=ZC3H13 PE=1 SV=1  ali   36.........................................SVKRCEAKLEGEHERDLESTSRDSLALDKERMDKDLGSVQGFEETNKSERTESLEGDDESKLDDAHSLGSGAGEGYEPISDDELDEILAGDAEKREDQQDEEKMPDPLDVIDVDWSGLMPKHPKEPREPGAALLKFTPGAVMLRV--------ISKKLAGSELFAKVKETCQRLLEKPKDA....................... 209
4 -7.180sp|Q8WXG9|GPR98_HUMAN G-protein coupled receptor 98 OS=Homo sapiens GN=GPR98 PE=1 SV=1  ali   11  140....IFNSLQGLYVFMVYFILHNQM------------CCPMKASYTVEMNGHPGPSTAFFTPGSGMPPAGGEISKSTQNLIGAMEEVPPDWERASFQQGSQASPDLKPSPQNGATFPSSGGYGQGSLIADEESQE--------------------FDDLIFALKTGAGLSVSDNESGQGSQEGGTLTDSQIVEL-----------RRI..................................... 300
5 -7.150sp|Q5TF39|NAGT1_HUMAN Sodium-dependent glucose transporter 1 OS=Homo sapiens GN=NAGLT1 PE=2 SV=1  ali follow..  11  411.........................................................................PLDRQRKEDRKSEDQKALLSSSGLNEYEEENEEEDAEKWNEMDFEMIETNDTMRHSIIETSRSSLTEPTAEVYNQYPSNALVFESSPFNTGSAHVKHLPETRT----------KGTNV...................................................... 518
6 -7.000sp|Q8TC90|CL012_HUMAN Uncharacterized protein C12orf12 OS=Homo sapiens GN=C12orf12 PE=2 SV=1  ali follow..  257.........................................PSLAFSPNPEENQSLAPLLVEEEEEKKNDDEEEYDQEVCDAKEASEEEEEVEDEEEEVEDEEEEEVEEAEYVEEGEEELEEEELEEEEEVLEENEQRGEEFHLPLEMPLSIFVEAEEKRENFISCTFLNPEQIIPKVPQESLFMAQDFN....................................................... 405
7 -6.920sp|O76024|WFS1_HUMAN Wolframin OS=Homo sapiens GN=WFS1 PE=1 SV=2  ali   11  2......................................................................................................................................................RRGITSENEREVRQLSSETDLERAVRKAALVMYWKLNPKK-----KKQVAVAELLENVGQVNEHDGGAQPGPVPKSLQKQRRMLER......... 82
8 -6.900sp|Q9Y6I9|TX264_HUMAN(removed signalp:1-25) Testis-expressed sequence 264 protein OS=Homo sapiens GN=TEX264 PE=1 SV=1  ali follow..  11  171..............................................................................KETEWKWRGLVEAIDTQVDGTGADTMSDTSSVSLEVSPGSRETSAATLSPGASSRGWDDGDTRSEHSYSESGASGSSFEELDLEGEGPLGESRLDPGTEPLG................................................................. 272
9 -6.800sp|Q9UK97|FBX9_HUMAN F-box only protein 9 OS=Homo sapiens GN=FBXO9 PE=2 SV=1  ali follow..  12  3.................................................................................DIIWVFPPQAEAEEDCHSDTVRADDDEENESPAETDLQAQLQM-FRAQWMFELAPGVSSSNLENRPCRAARGSLQKTSAD-----TKGKQEQAKEEKARELFLKAVEEEQNGALYEAIKFYRRAMQLVPDIEFKITYTRSPDGDGVGNSYIEDND......... 151
10 -6.590sp|Q7Z6Z7|HUWE1_HUMAN E3 ubiquitin-protein ligase HUWE1 OS=Homo sapiens GN=HUWE1 PE=1 SV=3  ali   11  41....................................................................STTTTTAASTTPTPPTAPTPVTSAPALVAATAISTIVVAASTTVTTPTTATTTVSISPTTKGSKSPAKVSDGGSSSTDFKMVSSGLTENQLQLSVEVLTSHSCSEEGLEDAANVLLQLSRG-VLKLLLNGARGYTLCKQIGTLLAELREYNLEQQRRAQCETLSPDGLPEE...... 219

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 6 1 8   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Friedberg I. and Godzik A Connecting the Protein Structure Universe by Using Sparse Recurring Fragments. Structure (Camb.) (2005) Aug;13(8):1213-24