current user: public

If you have questions about the server, please let us know.

Query: HGC00024 gi|162813637|dbj|BABA01031072.1|2.0 TMP01508;, from HGM_OVER

Results of FFAS03 search in HGM_OVER
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .
# Score Template Links and tools%idFirst MKNIYNTLGMTKACLCALAVSLVTTGCSDLLDKEPPSAISDGSFWTGEGDAMLALTGCYRFQTGWSHDDFATPQGLLYLDFAGGNGTEKENFSTLMASSNTVATNSNLRWYWGNAYTQIAKYNTFLENITDCPMEESKKEQWSAEVKCLRAYFFLNLAFYYTDVPMPLKTLSVDEANSISQTPQTEVYSQVEKDLKTAIDLLPVHYLRGIWRLPGGGLast
1 -110.000HGC00024 gi|162813637|dbj|BABA01031072.1|2.0 TMP01508;  ali  100  1MKNIYNTLGMTKACLCALAVSLVTTGCSDLLDKEPPSAISDGSFWTGEGDAMLALTGCYRFQTGWSHDDFATPQGLLYLDFAGGNGTEKENFSTLMASSNTVATNSNLRWYWGNAYTQIAKYNTFLENITDCPMEESKKEQWSAEVKCLRAYFFLNLAFYYTDVPMPLKTLSVDEANSISQTPQTEVYSQVEKDLKTAIDLLPVHYLRGIWRLPGGG 217
2 -24.300PB001404 Q2S5L8_SALRD/1-256 PB001404; Pfam-B_1404;  ali follow..  13  32TRSRIARVASLLSAGVLALVLLSCDGVGDFTNEDPTTANDPNPDLEFTTLQLGVSGSRFDMWRTNLIYTMPIVQHIANPGFYAGNFNQ---------------VGAWSASFFDTRYGGGPNGSNFLRTVTNAE-GKPRQVNRLAATRIMRVLTFQRLTDVYGDVPYFDAGKGALEGEFTPHTRQDSIYMDLHDELRAAVDQFDASFNGSIEQWKRFA 253
3 -7.930HGC01024 gi|162869036|dbj|BABB01000971.1|4.0 TMP01399;  ali follow..  1......MMRRKNITWVWLLGAAFMVGCG---KQVPENIIQPDRMENILYDYHLS-------------------------------------------ISMGNNLSYSDNYQKEAYKNYV------------------FEKHHITEAEFDSSMVWY----------------------TRHTEELASLYKKLGERFRSEKKHMQELLALR........ 117
4 -6.570PB019279 Q5LE73_BACFN/1-147 PB019279; Pfam-B_19279;  ali follow..  12  1MKTLTFKY----KLFLLAVAMINLTSCEI----EIDDFYDDDNIGGSYYNKSLDLCSRPWADTFYDADGNYCYQELNF----YLDRHGEDYIRVEYPNGRYSESVYSFTWNWEDRSQYSLRMVSYLDDV........................................................................................ 124
5 -6.340HGC01056 gi|162659434|dbj|BAAX01000171.1|2.0 TMP01455;  ali follow..  20  1MKKLL-------LAMIAVAALISFAACDHYADQRDRELDSINAFLRNEN........................................................................................................................................................................ 45
6 -6.000PB064361 Q64PJ4_BACFR/1-580 PB064361; Pfam-B_64361;  ali follow..  1MK------IERLFIYCLLAGTSLLASCNS--EDMTDNPVETLSEGMYPLTFTAMQGEVVATPQTRVSDY--------------------------------DDTDGKHKSKWDG---GVKIGTDGAVGSYTLDSDGKPTTSTSNIPAYWQSTASQTVYGWY---P-NTADISLTGQDNTGNKFPYVLKENVQLNLEHQLVKFRVKLNGDVPNLSDAK 184
7 -5.730PB048631 gi|160885545|ref|ZP_02066548.1| hypothetical protein BACOVA_03545 [Bacteroides ovatus ATCC 8483]gi|156109167|gb|EDO10912.1| hypothetical protein BACOVA_03545 [Bacteroides ovatus ATCC 8483]  ali follow..  1MK-----IKFLSFIASFFMVSFVITSCLD-IDQLSREIYNEDSLVHADTIIDKILIKTLTTASG-------VVTMKDKSGNDSVININDSIDLREPLTIKVWSTEALAGISPNQTKEYTIKVNVHQHDPDSLRWNH-VGKMQDEIIGEQKTIEFLTYSVVEGKNLKVYQNSNYSNWTAAGTNTTGDLTSTLPNSILPLNGIILATANNKVYESTDGV 237
8 -5.590PB004588 Q64QH1_BACFR/1-389 PB004588; Pfam-B_4588;  ali follow..  13  18..DTQKKHNLSGTIILVSCFLLLAGACSDRIETETQANGVLLNFNASTIDATTTETRSFVPIEGFAKNEYIFGMSVTKDNASRGEIFEGSRNLKATMSRPSGDAPWNWEF--------------------SNNASGTVVTPRGPEGKPLRVIAYY---------PAIAGTENFTDGIPFDFTQTNNPQQ---KEILYNTN................. 185
9 -4.950PB011023 A7V2G7_BACUN/1-167 PB011023; Pfam-B_11023;  ali follow..  26  1MNNKRTSIFKALALCLFAAVSFTFVSCDDDMDIQ....................................................................................................................................................................................... 39
10 -4.950HGC00947 gi|162844524|dbj|BABA01000185.1|4.0 TMP01280;  ali follow..  13  1MRKLVKLILL---CLIAYPIISIVSSCSE---SMNARPMMQCYLYKIDGETERVVNDTLDSLT.......................................................................................................................................................... 61

FFAS is supported by the NIH grant R01-GM087218-01
1 3 7 8 0 7   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Sasin JM, Godzik A, Bujnicki JM. SURF'S UP! - protein classification by surface comparisons. J Biosci. 2007 Jan;32(1):97-100.