current user: public

If you have questions about the server, please let us know.

Query: HGC00044 gi|162658718|dbj|BAAX01000887.1|1.0 TMP00920;, from HGM_OVER

Results of FFAS03 search in HGM_OVER
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360
# Score Template Links and tools%idFirst YRYYETRYADCVNGVGNAASPVGAYASSTEWNYDNEVAYGFGYGLSYTTFTQEIQGQPEISVNIDSETGAPQAYATFNVKVTNTGKVPGKTSVQIYGQAPYTEGGLEKVAIQLLNFEKSSELAPGASEIVSVKVDLQYIASYDMEHDNGDGTTGTYVLDPGTYYFAAGNGAHDALNNILVLQGADESKMVGTGSAAAAVAQEITEDLISRTAFSVSKTGEKISNQIPYADWNYYQPGEVTYLTRADWAGTFPKTYDQMTLTSEKLISDLNGNYYTIATDDDTSDIKWGENSNLMFYQMFGLDFDDPKWDELLDKMTLEEAQYLATYGGPSIPGVESIGTVETYMTENAGNGVAVNLNASKLast
1 -115.000HGC00044 gi|162658718|dbj|BAAX01000887.1|1.0 TMP00920;  ali  100  1YRYYETRYADCVNGVGNAASPVGAYASSTEWNYDNEVAYGFGYGLSYTTFTQEIQGQPEISVNIDSETGAPQAYATFNVKVTNTGKVPGKTSVQIYGQAPYTEGGLEKVAIQLLNFEKSSELAPGASEIVSVKVDLQYIASYDMEHDNGDGTTGTYVLDPGTYYFAAGNGAHDALNNILVLQGADESKMVGTGSAAAAVAQEITEDLISRTAFSVSKTGEKISNQIPYADWNYYQPGEVTYLTRADWAGTFPKTYDQMTLTSEKLISDLNGNYYTIATDDDTSDIKWGENSNLMFYQMFGLDFDDPKWDELLDKMTLEEAQYLATYGGPSIPGVESIGTVETYMTENAGNGVAVNLNASK 360
2 -9.730HGC01213 gi|163579070|dbj|BABE01006032.1|2.0 TMP01709;  ali follow..  10  118............................................................QLSAASQSVPVGGSLDFTATIVHEGSGNSDSGRVLTITSGQET-----KSDVCPADSRLLLMAKGDKDVQKVTWNTNANATLAKCTDESGWAK----VNAGTYVAQLSLKDHPKVKSDPVTFT................................................................................................................................................................................. 238
3 -4.750PB040621 Q8A865_BACTN/1-132 PB040621; Pfam-B_40621;  ali follow..  13  24...............................KGHSKTVYAFGIAASFTDTVVYFTDIQILD----------------SAKVSKEGFLTHRD----Y-------------SYQLKNYVEDNGLQQNSTCMIYFSENRKKLEKEATKILSKYKRNRNTTVTTDKFHFI.................................................................................................................................................................................................. 129
4 -4.630PB017610 Q11T14_CYTH3/22-188 PB017610; Pfam-B_17610;  ali follow..  33............................................LRAENLEVILVKDITHHTHAHDPHKSSYKILHVNFMLSSDPSVTGYKSVMMRLIDPAGGGLFNLNGKETPYTFKVSTKLDGQPLKIDFLYNHPK-------------------FRHGLHIIELYVDGLKI.......................................................................................................................................................................................... 160
5 -4.360PB015879 Q5LJ14_BACFN/120-411 PB015879; Pfam-B_15879;  ali follow..  4.....................ENDLTAFRAYGPALQETGERAFGYDWTKYNTTEPVVEANPDMKAKIAELGKTDPKAAQELYRSVSY-GLDCYKV--GPTLGGGTTGDTIVYPYCYATQEILDNGPLRFT-VKLV---YNPLVVKGDSTIIETRIITLDAGSYCNKTVVSYTNLKETMPLAVG................................................................................................................................................................................. 175
6 -4.050PB012991 Q2RHT0_MOOTA/1-175 PB012991; Pfam-B_12991;  ali follow..  13  5.....................EEVRTGWSRWDS----LWPF---LFYCNFLKGVFLLRRQELPPEVEILALGTNAAATVAMIKAGANEGATGERAIIYNAPRVEAITGSLAIILADAMLGELTPAMAAAIAASPARKFL............................................................................................................................................................................................................................. 135
7 -3.630PB023890 Q7MUU3_PORGI/1-263 PB023890; Pfam-B_23890;  ali follow..  11  1................................MDPPVCSPWGFGCYLLLFACPIIFASIMKKEFIGRTAKSSGCIFGSVLPAWSQEIVAGELERCFLAMPESRNDLCRRAGHLSGFTHTASLESSLGGTVTFLLNRNFIRI--QTSTVGEVFMRILPFSDSSSVICVVTTVLHPVADSRID................................................................................................................................................................................... 165
8 -3.480PB003564 gi|46242789|gb|AAS83494.1| TraD [Bacteroides fragilis]  ali follow..  149.......................................KQASGSSFEDIDMAVHTIWKESPSDEEM----RHAGKVMTELDGT------ELFTRITER-LTDEAMSERLAKAMAVFVDTVNMTVTQQKEKVFVIPDNIEEFDFR....................................................................................................................................................................................................................... 243
9 -3.290PB009233 Q7MX23_PORGI/1-175 PB009233; Pfam-B_9233;  ali follow..  30..............YRKDERILYRQVPHGRWQKRDVLDYEI-------------------------LIPDYTRSYSLELLIRHDNRYEYRDL--LAYEVSVGERLIFADSVDLTLADKPQQWNGKGVAKQQNRFRLPISARFP---------------YSGLYKIELKHNMRVPTLSGITEVGIRLTEGRDSPPPSIL.................................................................................................................................................................. 172
10 -2.900PB012954 Q5LF97_BACFN/1-383 PB012954; Pfam-B_12954;  ali follow..  11  251.................................................................GNIFIDGDVLLLRMTLTNRTQIG--DFMRFYIQDAKIRKKTAVQQLEQNTFDYPEEIPAHESRTFTVAMNKFTIP-----------DKKRLIIENGGRHFLYKLKNKSLLTAEEVF................................................................................................................................................................................... 363

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 5 5 1   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Lesley SA, Kuhn P, Godzik A., Deacon AM, Mathews I, Kreusch A, Spraggon G, Klock HE, McMullan D, Shin T, Vincent J, Robb A, Brinen LS, Miller MD, McPhillips TM, Miller MA, Scheibe D, Canaves JM, Guda C, Jaroszewski L, Selby TL, Elsliger MA, Wooley J, Taylor SS, Hodgson KO, Wilson IA, Schultz PG, Stevens RC. Structural genomics of the Thermotoga maritima proteome implemented in a high-throughput structure determination pipeline. Proc Natl Acad Sci U S A. 2002 Sep 3;99(18):11664-9. Epub 2002 Aug 22.