current user: public

If you have questions about the server, please let us know.

Query: HGC00267 gi|163310129|dbj|BABD01000566.1|6.0 TMP00066;, from HGM_OVER

Results of FFAS03 search in HGM_OVER
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160
# Score Template Links and tools%idFirst MDEKEVSEMQEEMMTVLVVEPMKAPYVKHIPNELEDLQQAVGGDIEMTYPFDDEVGILLNGNGKFEGLPLNRALYDDHGQVYDAIAGTFLVVGLTEDDFTSLTPEQIEKFKEKYQSPEIFTLFNGELHVMKMPPEEEKEQKESRKNDAKQKNPAKKKNRSGDARLast
1 -71.100HGC00267 gi|163310129|dbj|BABD01000566.1|6.0 TMP00066;  ali  100  1MDEKEVSEMQEEMMTVLVVEPMKAPYVKHIPNELEDLQQAVGGDIEMTYPFDDEVGILLNGNGKFEGLPLNRALYDDHGQVYDAIAGTFLVVGLTEDDFTSLTPEQIEKFKEKYQSPEIFTLFNGELHVMKMPPEEEKEQKESRKNDAKQKNPAKKKNRSGDAR 164
2 -3.950PB029229 gi|150007903|ref|YP_001302646.1| hypothetical protein BDI_1263 [Parabacteroides distasonis ATCC 8503]gi|149936327|gb|ABR43024.1| conserved hypothetical protein [Parabacteroides distasonis ATCC 8503]  ali follow..  10  169.ADKDKVEWIESSEHVITLYPAELICTYTYEEYMTQACGSLSS-------MAPSMLF---ANEELDRECVTVPFETELHLESSKMTGKFYTFGHHEENARP............................................................... 265
3 -3.070PB202086 Q8G498_BIFLO/2-200 PB202086; Pfam-B_202086;  ali follow..  16  142.EQADWYETHEKSLSKAVRAVVESKAAKRLDDAKTNLTAKL----------DEASKLLADSDGKVAD................................................................................................. 197
4 -2.730PB012991 Q2RHT0_MOOTA/1-175 PB012991; Pfam-B_12991;  ali follow..  15  29........KGVFLLRIAVVDGQGGGIGKHI---TARLRQELPPEVEILALGTNAAATVAMIKAGANEGATGERAIIYNAPRVEAITGSLAII-LADAMLGELTPAMAAAIAA.................................................... 128
5 -2.630HGC00690 gi|162868815|dbj|BABB01001192.1|3.0 TMP00870;  ali follow..  11  1........MFEYILREIFLSVIAFLAGAGVSAGVFAFVLVIG--VPRILRCSRIENIILIENVMICGVVAGNISSNMPKVPVSNICGNIIIAGLCVGIFVGCIAVALAEILHTF.................................................. 118
6 -2.380PB071107 _Gut.Meta.Jp.0066071_ gi|162701604|dbj|BAAY01026246.1||2 (+ 344:749~0 complete)  ali follow..  16  21...............AVETEEGSVVRIFPLTEEIENVE--LPGAIV...................................................................................................................... 50
7 -2.380PB048276 _Gut.Meta.Jp.0112258_ gi|163310311|dbj|BABD01000385.1||2 (- 258:885~0 complete)  ali follow..  11  14IDVAYLNFVINDLRKYFEPLLGRSLQTVDLALFTMYL--AMDAGLKGSDNDVQVLLVYDKQSGKLEHCLPSDLKNELDGVAFKASLGEFSF--------MAAPSEGFVSRGDLYLDLLQIVLNAAEVKKLIVVPFNEEYGKEVENVLRECALENAGHKEEAKD. 166
8 -2.000PB003645 Q65HI2_BACLD/1-230 PB003645; Pfam-B_3645;  ali follow..  12  94.SIQDYEQEYENQLKDILETIIGVEDV-SIVVNVDATSLKIGGKRTVSEMSSDEEIVIIKNGDKETPVVVQ--------TKKPDIRGVLVVA--QGVDNVQIKKTIIEAVTRVLDVPS.............................................. 217
9 -1.870PB047496 gi|150008556|ref|YP_001303299.1| hypothetical protein BDI_1942 [Parabacteroides distasonis ATCC 8503]gi|149936980|gb|ABR43677.1| conserved hypothetical protein [Parabacteroides distasonis ATCC 8503]  ali follow..  71................ALKNVAGSLAATEAEKKMKEYCAKVG-------IVEGVFNYVFNSDSTFT.................................................................................................. 113
10 -1.800HGC00683 gi|163310582|dbj|BABD01000118.1|4.0 TMP00861;  ali follow..  11  129...............................DDVKLFDWSDRNDYFYVEFDEPDSELLINFDGTL................................................................................................... 162

FFAS is supported by the NIH grant R01-GM087218-01
1 3 7 7 9 2   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Sikora S, Godzik A. Combination of multiple alignment analysis and surface mapping paves a way for a detailed pathway reconstruction--the case of VHL (von Hippel-Lindau) protein and angiogenesis regulatory pathway. Protein Sci. 2004 Mar;13(3):786-96. Epub 2004 Feb 06.