current user: public

If you have questions about the server, please let us know.

Query: HGC00485 gi|163636056|dbj|BABG01000217.1|3.0 TMP00523;, from HGM_OVER

Results of FFAS03 search in HGM_OVER
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .
# Score Template Links and tools%idFirst MIMNPNILNKNPLMFFDRAVNAQRSQLLTVMADAVSECRTAADQAAELNETGQVGLLRLAEVWSAIRAKEGMGGLILEGTEAKILSDVVAQFYAYLSGCMFNDPVGMAIYAELHYMMSSLMLGEWFELast
1 -106.000HGC00485 gi|163636056|dbj|BABG01000217.1|3.0 TMP00523;  ali  100  1MIMNPNILNKNPLMFFDRAVNAQRSQLLTVMADAVSECRTAADQAAELNETGQVGLLRLAEVWSAIRAKEGMGGLILEGTEAKILSDVVAQFYAYLSGCMFNDPVGMAIYAELHYMMSSLMLGEWFE 127
2 -5.440PB008806 Q5L9W8_BACFN/1-127 PB008806; Pfam-B_8806;  ali follow..  15  4.......................................................MYILVKIPSFISYGNLQTATMIIGTPLSIAESYVHKNMG-SITQIRIKPTDKN---KLFLNINHINVSDWFK 78
3 -4.750HGC00672 gi|162843654|dbj|BABA01001055.1|4.0 TMP00845;  ali follow..  14  52ITLTKGFAGDSTSIFINDSLLVNRTMTEEPFILEVKRFAEQSALMIVNNATEKLSLFELSEQGGEYRFEKEGEEVKPTGAGIKKLSKECCQTLSTFIL............................. 149
4 -4.540PB012823 Q5LCS8_BACFN/1-272 PB012823; Pfam-B_12823;  ali follow..  1...............MHKIKQMIKYIATLLLTVLFVACNNGKGQQPSEENEDPKAKEILQGIWL............................................................... 49
5 -3.210PB042013 A7V626_BACUN/1-162 PB042013; Pfam-B_42013;  ali follow..  15  2.....................KRNYFFTMLAAVLLAVAGANAQESAEFRPAELAGIWQLCH.................................................................. 41
6 -3.120HGC00579 gi|163284429|dbj|BABD01026259.1|2.0 TMP00679;  ali follow..  25  130...................VNETSRMLLVKVTYGMDFGRKRKTAAKRINEDTDTGILK..................................................................... 169
7 -2.760PB038151 Q8A4A5_BACTN/1-178 PB038151; Pfam-B_38151;  ali follow..  85...TGSIAKERSIFFDLKHMDKLTDLVNSGSFSADSKIKSEASGNIRMSADNKFAAVQLFQ-FVPYTYQPVTAVHYFTNDAAAAVAAFLTK.................................... 175
8 -2.540PB044822 Q89ZL7_BACTN/1-147 PB044822; Pfam-B_44822;  ali follow..  13  21..................................................................................KYVCGCDQTAVTDIHLQPDQTSGQLTIYNDDDEELANVMIEEWAT 65
9 -1.930PB004588 Q64QH1_BACFR/1-389 PB004588; Pfam-B_4588;  ali follow..  11  6.AVNEKISYTINMDTQKKHNLSGTIILVSCFLLLAGACDNSDRIETETQANG........................................................................... 56
10 -1.910PB202086 Q8G498_BIFLO/2-200 PB202086; Pfam-B_202086;  ali follow..  21  63...............................AEAKEACVTAADTVRNNANEYNALLNGDAADAAAVKAEQ-----VKDSKTVESLGKELKA.................................... 117

FFAS is supported by the NIH grant R01-GM087218-01
1 4 3 0 4 3   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Zhang Y, Stec B, Godzik A. Between order and disorder in protein structures: analysis of "dual personality" fragments in proteins. Structure. 2007 Sep;15(9):1141-7.