current user: public

If you have questions about the server, please let us know.

Query: HGC00509 gi|162658693|dbj|BAAX01000912.1|3.0 TMP00561;, from HGM_OVER

Results of FFAS03 search in HGM_OVER
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .
# Score Template Links and tools%idFirst MIYLHARGLFHVLLLICNRELLLIGKRKDEDDMAKSTKTYEERIRALEKKEQESIEATKKLIAQRKELEKRKKAEESKKRTHRLCQIGGAVESVLGCPIEEEDLPKLIGFLKRQETNGKFFSKAMQKELVTDMEEVLast
1 -95.900HGC00509 gi|162658693|dbj|BAAX01000912.1|3.0 TMP00561;  ali  100  1MIYLHARGLFHVLLLICNRELLLIGKRKDEDDMAKSTKTYEERIRALEKKEQESIEATKKLIAQRKELEKRKKAEESKKRTHRLCQIGGAVESVLGCPIEEEDLPKLIGFLKRQETNGKFFSKAMQKELVTDMEEV 136
2 -10.300HGC00311 gi|163635536|dbj|BABG01000737.1|2.0 TMP00178;  ali follow..  21  1................................MAKPKN--LEQLRAEKEQVETQLAQEQHKLKRLENRKKYLEKGERQKRTHRLCNLGGTIESLA-KDLTRTEMTELMEYIFSLPEVQRAVRHMAIT......... 95
3 -4.680PB000520 Q9RVX4_DEIRA/1-194 PB000520; Pfam-B_520;  ali follow..  13  42AVLISGAGT--LIMSTSTRVGRATDRVRGLTSRFKQLVSAEGQNEPLAREEKRLIIRQLPRLSRRTRFLMR................................................................. 110
4 -3.960HGC00993 gi|163626727|dbj|BABG01009540.1|1.0 TMP01352;  ali follow..  17  9...FAMMGLTFVIGFFVAGVIKLIASAADSLAFYSSHQEELARLKRIRKLHQKVATLITESALSDEEYGSDGREDFSRGVTKHPGDNRGFYHGV-----PGESERGLMDYFYPEDTRTMFLRKEEQ.......... 127
5 -3.530PB012771 _Gut.Meta.Jp.0094636_ gi|162817068|dbj|BABA01027641.1||1 (+ 249:636~0 complete)  ali follow..  17  64....................................ADELAALLESVQRECEEREAVLVREMAEAEGVNEEMKGNEQMAWVQRMEMICGRVEEVVCEEI..................................... 126
6 -3.450PB000795 Q74Z21_ASHGO/1-280 PB000795; Pfam-B_795;  ali follow..  213.....ARALYIDFWMLGDAAREL---PDNSWQKHRARELGNLVMNMFDPEDVSTVDKCRKFLQKEFFDKYTDDPK............................................................. 279
7 -3.280PB003142 Q8DVS6_STRMU/1-162 PB003142; Pfam-B_3142;  ali follow..  22  106..........................NKSKKQSAVSTKAQAEMQKLHEALKKEKKSQSKEKRQALKQYKYQLKQEKRHQK........................................................ 159
8 -2.990PB012108 A3U600_9FLAO/1-189 PB012108; Pfam-B_12108;  ali follow..  27  4............LLLI---EYNSITKRFLSGNIENSIFVNQQNAMAKKEKKQLKKRLLHKY---RMVILNEDTFEE............................................................ 61
9 -2.740PB005684 gi|160884252|ref|ZP_02065255.1| hypothetical protein BACOVA_02230 [Bacteroides ovatus ATCC 8483]gi|156109991|gb|EDO11736.1| hypothetical protein BACOVA_02230 [Bacteroides ovatus ATCC 8483]  ali follow..  11  110........LQCFVV----------ASGKGILSYIRLLEPIHDEIRKEVTIQMKAYKKEKAEYDAMGKERTKKEAPQMPPNRMFLISGNNTGTGILQN-ICEAEADTLSTAIGSDHGH-DTLRKAFDHD........ 232
10 -2.710PB046158 _JGI.0336690_ 2004028347 [Human Gut Community Subject 8]  ali follow..  19  129.........................KAKDVDVMTAAFREYAGVELKKKQVKKPSVRKKLQKSVERKAKHRQRVKQRQKSRGQ...................................................... 185

FFAS is supported by the NIH grant R01-GM087218-01
1 4 2 6 4 9   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Robinson-Rechavi M, Godzik A. Structural Genomics of Thermotoga maritima Proteins Shows that Contact Order Is a Major Determinant of Protein Thermostability. Structure (Camb). 2005 Jun;13(6):857-60.