current user: public

If you have questions about the server, please let us know.

Query: HGC00522 gi|163636101|dbj|BABG01000172.1|3.0 TMP00580;, from HGM_OVER

Results of FFAS03 search in HGM_OVER
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200
# Score Template Links and tools%idFirst LQTNYKRQRMNIFDIAKQNQEKAWQVIKNTNIIQIWEDAGAKINLVGSLRTGLLMKHRDIDFHIYSSPLNLTDSFQAMARLAENPSIKRIECANLLHTAEACIEWHAWYQNEENELWQMDMIHIREGSRYDGYFEKVAQRISEIMTDEIRETILRLKYETPETEKIIGVEYYQAVIRDGVRDYSGFKEWRKQHPVTGVVEWMPLast
1 -100.000HGC00522 gi|163636101|dbj|BABG01000172.1|3.0 TMP00580;  ali  100  1LQTNYKRQRMNIFDIAKQNQEKAWQVIKNTNIIQIWEDAGAKINLVGSLRTGLLMKHRDIDFHIYSSPLNLTDSFQAMARLAENPSIKRIECANLLHTAEACIEWHAWYQNEENELWQMDMIHIREGSRYDGYFEKVAQRISEIMTDEIRETILRLKYETPETEKIIGVEYYQAVIRDGVRDYSGFKEWRKQHPVTGVVEWMP 203
2 -4.710PB001823 Q5L7Q9_BACFN/1-326 PB001823; Pfam-B_1823;  ali follow..  11  115.NGDYDYNDLIIVKNTASNHAYQHPTETWQTIEIQPIALG------STKTIKLGCILSDGSTHMISDDVRTDLFGGRQGFINTVNDNDPIRYKLASTN----IKNYAMPKKEKTSAAWVAWFIEVDGKRMYAASSDIDYKSYDMVNKENMPYGLAVSNGNGTSYPQEKNSLFET--------YPGFSDWINGKVSS--GSF.. 297
3 -4.390PB002776 gi|157737147|ref|YP_001489830.1| hypothetical protein Abu_0901 [Arcobacter butzleri RM4018]gi|157699001|gb|ABV67161.1| hypothetical protein Abu_0901 [Arcobacter butzleri RM4018]  ali follow..  13  290................................................................................................................KTKDWTYEIVLNRLMDYEIKEEDRKLK-FGIKTPQNKKDEIIEIIINKCHENNILDFEFYQAFYCKEVNIINDLIKKAKQNKLDLNIEFL. 402
4 -3.620PB053138 Q73Q90_TREDE/1-298 PB053138; Pfam-B_53138;  ali follow..  11  167.TSKKMLTREDILNCTLPKEMRFLHYAVNIRFFNIQGTNDMLVDSLGMSTLFLP------DVQYHFHDLNPNDVVNHAYNVLSYIYDNDNPIED............................................................................................................. 253
5 -3.330PB007011 gi|160888195|ref|ZP_02069198.1| hypothetical protein BACUNI_00603 [Bacteroides uniformis ATCC 8492]gi|156862330|gb|EDO55761.1| hypothetical protein BACUNI_00603 [Bacteroides uniformis ATCC 8492]  ali follow..  56.EEKPSMADRGLYKNKKKRVKGKKDKLQPEVQGQPPLSWIRLSRKKLNEGVDEAWAVFDKD-----EHPARKDAFEEAEKLIDDKKV-NIAFSS------------------------FEYYLL-EYLYHPFHATECGERIDGKKVNYNCMTEKSKENACHGEKCINSQSTFPLILKAGIINAKRLRIESNSKENCPIYDRNP 248
6 -3.270HGC00789 gi|163310627|dbj|BABD01000073.1|7.0 TMP01036;  ali follow..  1....MAVSAPPILKTLKTKDMIAKTILQQIGGKRFTAMTGSRDFIDMGNGLRMSLA................................................................................................................................................... 52
7 -2.720PB015879 Q5LJ14_BACFN/120-411 PB015879; Pfam-B_15879;  ali follow..  84.........LDCYKVGPTLGGGTTALMAGDTIVYPYCYATQEILDNGPLRFTVKLVYNPLVVK------DSTIIETRIITLDAGSYCNKTVVSYTNLKETMPLAVGIVLHEPDGAIVDPT--AFPTLVKEAKAVLFPEKEKKELRGGADGHVLAISEYEPGADFTYYWGAAWS---KADIKDSAAWNAYMADFAQK....... 285
8 -2.690PB008694 Q9F6U1_BACTN/1-190 PB008694; Pfam-B_8694;  ali follow..  17................................................................................................................KRRKWRFTVWRRSWAATSKPPSGNLPKSIKNEFINEKRKMRMNLPKVKMLQVSKCLIGLAVMMLQSCDVADNLRDMLCGN--------WE. 106
9 -2.660PB048631 gi|160885545|ref|ZP_02066548.1| hypothetical protein BACOVA_03545 [Bacteroides ovatus ATCC 8483]gi|156109167|gb|EDO10912.1| hypothetical protein BACOVA_03545 [Bacteroides ovatus ATCC 8483]  ali follow..  10  15....VSFVITSCLDDDNNIEYSPDATIHAFALDTAIDQLSREIYNEDSLPVHADTIIDKILIKTLTTASGVVTMKDKSGNDSVININDSIDLREPLTTKEYTIKVNVHQHDPDSLRWN-KILTYSVVEGKNLKVYQNSNY--SNWTAAGTNTTGDLTSTLPNSILPLNGIIL-ATANNKVYESTDGVAWTISDKFSG...... 247
10 -2.610PB028090 gi|167758043|ref|ZP_02430170.1| hypothetical protein CLOSCI_00381 [Clostridium scindens ATCC 35704]gi|167663940|gb|EDS08070.1| hypothetical protein CLOSCI_00381 [Clostridium scindens ATCC 35704]  ali follow..  12  2....................................................LFQIYGENAGWQLLGWLLVFAGLILANELARRTKVGGIFCFLIVPAALTVYFIAIYVGAANGAEWALN-----NPTYVHMNSWFHYAKLYAATAGCIGFMMLKYKWKIGKTN-IVAINILIAVVSD......................... 129

FFAS is supported by the NIH grant R01-GM087218-01
1 4 1 5 6 8   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Li W, Jaroszewski L, Godzik A. Sequence clustering strategies improve remote homology recognitions while reducing search times. Protein Eng. 2002 Aug;15(8):643-9.