current user: public

If you have questions about the server, please let us know.

Query: HGC00579 gi|163284429|dbj|BABD01026259.1|2.0 TMP00679;, from HGM_OVER

Results of FFAS03 search in HGM_OVER
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170
# Score Template Links and tools%idFirst NQDSWQKWNAEYEFRYQLMHGLISLRAALGMDYCDSRAADYHHTHCNLYAVVNAQAAYKCMALTFNLRTHRPTLYGETLALGEDLHDIALTYFKKRFSLTLAMNNPFMDNYRIGCENWNRRAGNTSYQYVNETSRMLLVKVTYGMDFGRKRKTAAKRIQNEDTDTGILKGNKLast
1 -86.900HGC00579 gi|163284429|dbj|BABD01026259.1|2.0 TMP00679;  ali  100  1NQDSWQKWNAEYEFRYQLMHGLISLRAALGMDYCDSRAADYHHTHCNLYAVVNAQAAYKCMALTFNLRTHRPTLYGETLALGEDLHDIALTYFKKRFSLTLAMNNPFMDNYRIGCENWNRRAGNTSYQYVNETSRMLLVKVTYGMDFGRKRKTAAKRIQNEDTDTGILKGNK 172
2 -4.540PB012954 Q5LF97_BACFN/1-383 PB012954; Pfam-B_12954;  ali follow..  20  341..................................................................................................................................RNGGRHFLYKLKNKLLTAEEVFRSRKQQETEDEADKILR... 380
3 -4.370PB004718 Q5LIA4_BACFN/1-189 PB004718; Pfam-B_4718;  ali follow..  81..........................................................GNVSVQNFFQANLAYTHNRVDNNNTFAGLVNWNYITDNFKLLAGGMGDFNGGFVYNLRNTNNPASARAYINL-----DASGMAIWHTKIKNYPLALRYQVN------GV..... 189
4 -3.560PB019827 gi|67919427|ref|ZP_00513005.1| conserved hypothetical protein [Chlorobium limicola DSM 245]gi|67782966|gb|EAM42367.1| conserved hypothetical protein [Chlorobium limicola DSM 245]  ali follow..  10......EYQLFKKVNLLLAVRDYAEGYYSPFAGAFAERGDGGSNERGVYLGIDAALS-SKVSVGAYFRFPKLDSKDYPYPSSGYDTRFFLDWKSRAVTWTLQLQHKEKEVALKQCPDGAGSCDEEEELYAPLGKVTDRVRLDCDIDALRKLTLRTRYLAGDESCYGWL.... 183
5 -3.310PB001232 gi|126647001|ref|ZP_01719511.1| hypothetical protein ALPR1_19713 [Algoriphagus sp. PR1]gi|126577049|gb|EAZ81297.1| hypothetical protein ALPR1_19713 [Algoriphagus sp. PR1]  ali follow..  335..SNKFYGKVDFRWSTTKPISGHTFGIEGGKYIYQFNGGDPINEQVNAFYSLLFRQNYMKL-----YEQEFAKIYWAHRVNYGFTYRGNLTYANRHQLFNNINYSWYNKEGREYTPNQPENVETDDQAFADHDILKLNASIEWRPGVKYGIRNGRKYPITSNSPLIKLSYNK 499
6 -3.120HGC00485 gi|163636056|dbj|BABG01000217.1|3.0 TMP00523;  ali follow..  25  20.................................................................................................................................VNAQRSQLLTVMADAVSECRTAADQAAEL-NETGQVGLLR... 58
7 -2.950HGC00965 gi|163282470|dbj|BABD01028218.1|2.0 TMP01310;  ali follow..  12  34...........................................................................................................................................GMRYLITPGKRSVPDPDGGEEAKKEEAILTV.. 64
8 -2.840PB078508 A6TV41_9CLOT/1-155 PB078508; Pfam-B_78508;  ali follow..  13  64........................................................................................QPYQTGTSYKVTRMAYNLWNGYVEEGTESLTTPSSLFACEYAAEFHQAIKIRFSYYRERDFEKSSLRKQIKDLTEKNVIESTN. 147
9 -2.450HGC00672 gi|162843654|dbj|BABA01001055.1|4.0 TMP00845;  ali follow..  50...................................................................................YTITLTKGFAGDSTSIFINDSLLVNRTMTEEPFILEVKRFAEQSALMIVNNATEKLSLFELSEQGGEYRFEKEGEEVKPTGAGIKKLSK 138
10 -2.300PB009534 gi|153852721|ref|ZP_01994158.1| hypothetical protein DORLON_00140 [Dorea longicatena DSM 13814]gi|149754363|gb|EDM64294.1| hypothetical protein DORLON_00140 [Dorea longicatena DSM 13814]  ali follow..  142..................................................................................................................................TKSNGFTILEFMYCIGIIKRLSVDPTPMEENDIQTTLVETYS 201

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 6 1 8   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Plewczynski D, Tkacz A, Godzik A., Rychlewski L. A support vector machine approach to the identification of phosphorylation sites. Cell Mol Biol Lett. 2005;10(1):73-89.