current user: public

If you have questions about the server, please let us know.

Query: HGC00683 gi|163310582|dbj|BABD01000118.1|4.0 TMP00861;, from HGM_OVER

Results of FFAS03 search in HGM_OVER
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160
2 -21.200PB009671 Q5LCM2_BACFN/1-111 PB009671; Pfam-B_9671;  ali follow..  12  1MKKVLVALTMVMGMGSAVAFAQEKFTKITVKELPQVVKSTLSKDYEGTIVKEAFVAEKEYKIIVTAIKEDQ--------STEEITVLLNEKGEPVNEK................................................................. 110
3 -10.300PB015266 gi|154494998|ref|ZP_02034003.1| hypothetical protein PARMER_04044 [Parabacteroides merdae ATCC 43184]gi|154085548|gb|EDN84593.1| hypothetical protein PARMER_04044 [Parabacteroides merdae ATCC 43184]  ali follow..  10  1MKRIVSMMVIFTLLLGGMTHVQAQTSKAAXXX--XXXXXXXXXXXXRLAKDAVMGEEAFNNAMQAITNRSFVLEANSVQPLNGRVYYVNSNTNFVSLNDGQAMVQIASNSPYPGPNGLGGITVQG-SASNVQVKQENNGNVYLSMSVQGITVNLVLYSGTN.. 162
7 -9.340PB048631 gi|160885545|ref|ZP_02066548.1| hypothetical protein BACOVA_03545 [Bacteroides ovatus ATCC 8483]gi|156109167|gb|EDO10912.1| hypothetical protein BACOVA_03545 [Bacteroides ovatus ATCC 8483]  ali follow..  15  1MKIKFLSFIASFFMVSFVITSCLDDDNNIEYSPDATI-HAFALDTAGLGSYKFTIDQLSREI---YNEDSLPVHADTIIDKILIKTLTTASGVVTMKDKSGNDSVI---------NINDSIDLREPLTIKVWSTESPNQTKEYTIKVN-----HQHDPDSLRW 151
9 -8.300PB083081 gi|160890648|ref|ZP_02071651.1| hypothetical protein BACUNI_03093 [Bacteroides uniformis ATCC 8492]gi|156859647|gb|EDO53078.1| hypothetical protein BACUNI_03093 [Bacteroides uniformis ATCC 8492]  ali follow..  10  1MKKTIFYSLFSALFMLTSCSMFEIDNEEPSETIWGEVVDE-----ATGKRVLTDQGSEGIRVRLTELS---------DNVQHNPDFYCMMDGTFQNTK---------------KGEYNVRIDGPFIPLVRENTDGTLLHDGSVNTEISGTTK........... 128

FFAS is supported by the NIH grant R01-GM087218-01
1 4 3 0 4 3   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Zhang Y, Stec B, Godzik A. Between order and disorder in protein structures: analysis of "dual personality" fragments in proteins. Structure. 2007 Sep;15(9):1141-7.