current user: public

If you have questions about the server, please let us know.

Query: HGC00690 gi|162868815|dbj|BABB01001192.1|3.0 TMP00870;, from HGM_OVER

Results of FFAS03 search in HGM_OVER
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .
# Score Template Links and tools%idFirst MFEYILREIFLSVIAFLAGAGVSAGVFAFVLVIGVVPRILRCSRIENIILIENVMICGVVAGNISSVLDTAYNLGFANMPKVPVSNICGNIIIAIYGLCVGIFVGCIAVALAEILHTFPIIYKRMKLRAGLGIIVISMAIGKALGALYYFLTGFVATSLast
1 -85.100HGC00690 gi|162868815|dbj|BABB01001192.1|3.0 TMP00870;  ali  100  1MFEYILREIFLSVIAFLAGAGVSAGVFAFVLVIGVVPRILRCSRIENIILIENVMICGVVAGNISSVLDTAYNLGFANMPKVPVSNICGNIIIAIYGLCVGIFVGCIAVALAEILHTFPIIYKRMKLRAGLGIIVISMAIGKALGALYYFLTGFVATS 158
2 -4.890HGC01179 gi|162738527|dbj|BAAZ01025469.1|2.0 TMP01658;  ali follow..  20  28.....................................................................................................VFIFIAVLLLAFIIDLFSIISTKQELDHAADQMVKQIQLSGGVNG............ 72
3 -4.120HGC00993 gi|163626727|dbj|BABG01009540.1|1.0 TMP01352;  ali follow..  16  1MFSLLLSTFAMMGLTFVIGFFVAGVIKLIASAADSLAELARLKRIRKLHQKVATLITESALSDEEYGSDGR-----------DFSRGVTKHPGDNRGFYHGVSPGESERGLMDYF--YPEDTRTMFLRK............................. 124
4 -3.440PB009534 gi|153852721|ref|ZP_01994158.1| hypothetical protein DORLON_00140 [Dorea longicatena DSM 13814]gi|149754363|gb|EDM64294.1| hypothetical protein DORLON_00140 [Dorea longicatena DSM 13814]  ali follow..  15  58............................VMSVLKVIQKIHEIYPEASVENIGETDFI------------VTYEEQDGKGGVIHVAKIVMVVMISFFGAAFSTMAFNNDVGVTKMFGQIYELLT--TKSNGFTILEFMYCIGIIIGILTFF........ 166
5 -3.230PB027498 Q7MTK6_PORGI/1-146 PB027498; Pfam-B_27498;  ali follow..  7...................LIIGVLVLGLVAALTEIRHSHKRRAAEAKGESLPEEPVRVVPPGCCGMHITCEKDSLLTAVSKSIVYYDDEELDRYAGVLPEEYNTEAVEEFEEILSTLSLQMRQIQMPISIKEQALFIV................... 136
6 -3.130PB007147 Q11UU2_CYTH3/1-245 PB007147; Pfam-B_7147;  ali follow..  21.....IQKIVDWILTIEDREQRTRYANTCVELMRQLNPGVRDTEEHTTKLWDHLFIMSNFKLDVDTPYPMPDIAVLGRKPE-RVPYNHNKLKYKHYGKNINLLIE-AIIYLGRLMKRLYSTWNKENVDDEVIV-LSELSKNNL............... 170
7 -2.860PB038401 Q8RFH0_FUSNN/1-210 PB038401; Pfam-B_38401;  ali follow..  10  91..................GFNVDAGLACICDK-KLHDLYCEFDEKFVKENPDGNAYDDYFADLFKKSYEDNPKYQRDGGDWINWTIPGTDYHLPIFGFGDGAYPGNVCQLIVELIDI......................................... 198
8 -2.850PB012386 gi|82541244|ref|XP_724876.1| blood-stage membrane protein Ag-1 [Plasmodium yoelii yoelii str. 17XNL]gi|23479680|gb|EAA16441.1| blood-stage membrane protein Ag-1 [Plasmodium yoelii yoelii]  ali follow..  10  3..IYIFNDSTNIPIGTVFSFVSKYDYICNKAVQDISEDLIKIELNQNVSINKIFNILKA................................................................................................... 59
9 -2.750HGC00991 gi|163600283|dbj|BABF01000984.1|3.0 TMP01348;  ali follow..  11  1................................MQVDTKLINLKLWGYITMKKMIAYCGLDCEKCDAYIATINDNQELRKKTAKLWAELNNAPILPEHINCQ---GCRVDGIKTVFCDNMCGIRQCALEKGV........................... 96
10 -2.640HGC00267 gi|163310129|dbj|BABD01000566.1|6.0 TMP00066;  ali follow..  11  9MQEEMMTVLVVEPMKAPYVKHIPNELEDLQQAVG-IEMTYPFDDEVGILLNGNGKFEGLPLNRALY-----------DDHGQVYDAIAGTFLVV--GLTEDDFTSLTPEQIEKFKEKY........................................ 114

FFAS is supported by the NIH grant R01-GM087218-01
1 3 9 2 2 3   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Slabinski L, Jaroszewski L, Rodrigues AP, Rychlewski L, Wilson IA, Lesley SA, Godzik A. The challenge of protein structure determination--lessons from structuralgenomics. Protein Sci. 2007 Nov;16(11):2472-82.