current user: public

If you have questions about the server, please let us know.

Query: HGC00921 gi|162841401|dbj|BABA01003308.1|3.0 TMP01242;, from HGM_OVER

Results of FFAS03 search in HGM_OVER
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270
# Score Template Links and tools%idFirst MPYRLLPNTDQARIRALKTAVVKGDMCDVYDLPVSLKTLGEARIFLSKFETAHSYYVHCYGEQSRNSKKHQANVKTARLYISHFIQVLNLAVIRMEIKESHKALYGLPVDNFSVPDLSSEASLAEWGQKIIEGERKRTSQGGIPIYNPTIAKVKVHYDIFMEGYEKQKSLQSLTNRSLEQLASMRVQADRLILDIWNQVEAKFQDVSPNEKRLEKCRDYGLIIIIGPEKNRIRRFFKICLSIHIPIFFWKSLQKITFRYGTCPCCRCDAYLYALast
1 -124.000HGC00921 gi|162841401|dbj|BABA01003308.1|3.0 TMP01242;  ali  100  1MPYRLLPNTDQARIRALKTAVVKGDMCDVYDLPVSLKTLGEARIFLSKFETAHSYYVHCYGEQSRNSKKHQANVKTARLYISHFIQVLNLAVIRMEIKESHKALYGLPVDNFSVPDLSSEASLAEWGQKIIEGERKRTSQGGIPIYNPTIAKVKVHYDIFMEGYEKQKSLQSLTNRSLEQLASMRVQADRLILDIWNQVEAKFQDVSPNEKRLEKCRDYGLIIIIGPEKNRIRRFFKICLSIHIPIFFWKSLQKITFRYGTCPCCRCDAYLYA 273
2 -3.880HGC00166 gi|163579340|dbj|BABE01005762.1|1.0 TMP00473;  ali follow..  110.......IGGGDEARLNRIYINRIPTRKHNGILLTTPARTLLDCAVFPFPQALPIYDSALRKSLTTIEEVQSLMIQSVCDEVSVTKLLKYANPLSENGGESLMRGQITELSFGSSCWQCSS........................................................................................................................................................ 223
3 -3.470PB078508 A6TV41_9CLOT/1-155 PB078508; Pfam-B_78508;  ali follow..  7.............................................................NSEAHELFYKEMLARTNQTDVYYKAFFYCMGICETTRKHIEDLFDFKEGGIMPEHLGTSYKVTRMAYNLWNGYVEEGTE-ACEYAAEFHQAIKIRFSEYYRERDFEKSSLRKQIKDLTE----KNVIESTNAKEHSEIE......................................................................... 155
4 -3.360PB004996 Q5NNS6_ZYMMO/1-150 PB004996; Pfam-B_4996;  ali follow..  18  2....................................................................................................................................................................................................ANLDVLFERLSRSSFRQQYLANKGMETILEHGKDFIAQRLAPAEIPNDPVFL---------QHATGTCCRCIEKWH. 88
5 -3.190PB050904 Q64SA2_BACFR/1-230 PB050904; Pfam-B_50904;  ali follow..  1................MKSRIISLGLVASLVCLLPQVAEAQIAASNPLEWTALAEGNELINGQIEKQIKGQTQTALLQNSIATEFNQIH--------KWEKQYNSYLKTASGYASSLKACTHLYNDGVRIFLGKLGKAIQNNPQGIVASMNMNNLYIETATELVSVFTLLNDAVAKGSNENMLTGAERSKTLWALNDQLSDFSRKLHLLYLSIRYYTFNDV-WNNVTAGMLDRDNGEAARMA---LSHWHRAAA................... 228
6 -2.700PB001030 Q6D4H5_ERWCT/1-146 PB001030; Pfam-B_1030;  ali follow..  1......................................................................................................................................................................................................MTHMARKPLGKYRQREIRTVGLMIALYEKRHPE-TDASTQYNDL---------FSYAIKRLERCHCKHCPIHCYQ 72
7 -2.620HGC00374 gi|162831834|dbj|BABA01012875.1|1.0 TMP00304;  ali follow..  8................................................FDELLERIRDIRASEKRVYRKVKEIFALSVDYDSKSQVAQSFKSVQNKLEYAATGHTAPELIAKRADASKDNMGLTSFKGVKVRRGDVTVAK--NYMTHEEISTLNLIVNMYLDYAELQ-----AKGHIPMHMADWESKLGDFLRFNGREVLENFGTVKREVAEKLALEQY--QYDTHRRALEAADDVDELTAD-------KRLKR................... 200
8 -2.380PB004588 Q64QH1_BACFR/1-389 PB004588; Pfam-B_4588;  ali follow..  10  149..IAYYPAIAGTENFTDGIPFDFTQTNNPQQKEI-----------------------YNTNTSYTIPSSGGSDKVTIPLKFQHAYSWISIKVTKSV-DKGSHKLSGVSIDNLSGGWIKNKGKI-----NPATGMAMQGAIQGPIGEVRTAEVLDPSGDTATPIIYDFLVPAFMDRNVKDDDLVFTLIIDG------KKEIFSLGREHLNNDGDTYGFKQGYANTYNVEFNNS--------SLNMRLLNWTS...................... 355
9 -2.290PB000119 Q6KIT1_MYCMO/1-381 PB000119; Pfam-B_119;  ali follow..  16  162............................................VAPNLVKILNKNLPNLWGEKFTFTFKEIKFKKINFFSSIFLQIVRINTIRPNPNPNPNEIFNFDLNNLPIENLQSKMELTDTATVIIINNTAYV----------NINKNSVKHNNFAVNYLKS-----------EENNWYLTGRDFPLLGLF--VEKFFKD----DVEVFSPKIPALYFVVNNSTKNIFSSVGI-LSTNNP----KLIFTFTFDNG............. 379
10 -2.230HGC00991 gi|163600283|dbj|BABF01000984.1|3.0 TMP01348;  ali follow..  15  86..........................................................................................................................................................................................................................................................GIRQCALEKGVATCGDCLDL... 105

FFAS is supported by the NIH grant R01-GM087218-01
1 3 9 5 6 1   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Rychlewski L, Zhang B, Godzik A. Functional insights from structural predictions: analysis of the Escherichia coli genome. Protein Sci. 1999 Mar;8(3):614-24.