current user: public

If you have questions about the server, please let us know.

Query: HGC00933 gi|162753228|dbj|BAAZ01012194.1|2.0 TMP01261;, from HGM_OVER

Results of FFAS03 search in HGM_OVER
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170
# Score Template Links and tools%idFirst MSTWSGIRNKLENDYLCPALRGHIQYFATSYSKSADHEGRAAIRMDGVEVLRSNYYTYFENVWTKFHHLRSTTLKDCDSAKEAIDRSHAYALEQGTFDQKAFYEAFGIFDNQSIEKSLVSKNPLVRILALLDRRLGKRRLLALEESMEQELDWVRAFYVIRMQAEGLMEKELast
1 -99.600HGC00933 gi|162753228|dbj|BAAZ01012194.1|2.0 TMP01261;  ali  100  1MSTWSGIRNKLENDYLCPALRGHIQYFATSYSKSADHEGRAAIRMDGVEVLRSNYYTYFENVWTKFHHLRSTTLKDCDSAKEAIDRSHAYALEQGTFDQKAFYEAFGIFDNQSIEKSLVSKNPLVRILALLDRRLGKRRLLALEESMEQELDWVRAFYVIRMQAEGLMEKE 171
2 -4.620PB000821 Q82P27_STRAW/1-209 PB000821; Pfam-B_821;  ali follow..  14  70............................................................................................................IARRGDGQVVQLSRLLHLVASSVD---GSRDIETIAHRVSGRADNVRYLIEQKLDPLGVTVPE 135
3 -3.670PB047496 gi|150008556|ref|YP_001303299.1| hypothetical protein BDI_1942 [Parabacteroides distasonis ATCC 8503]gi|149936980|gb|ABR43677.1| conserved hypothetical protein [Parabacteroides distasonis ATCC 8503]  ali follow..  11  54QGTWMNALKNVAGSLAATEAEKKMK---EYCAKVGIVEGVFNYVFNSDSTFTS--------------ALKRGSLKGTYSVSPEDKTVTLRYTVGNKKLTVSTLTAHVVLSGNELT-LLFNADKLLKFLSTVSSISSNTTLKAINKLASEYDGMMLGF.............. 203
4 -3.410PB012771 _Gut.Meta.Jp.0094636_ gi|162817068|dbj|BABA01027641.1||1 (+ 249:636~0 complete)  ali follow..  21  59...................................................................................................................VRLIWADELAALLESVQREC-EEREAVLVREMAEAEAWVQRMEMICGRVEEVVCEE 125
5 -2.900HGC00164 gi|163636082|dbj|BABG01000191.1|4.0 TMP00833;  ali follow..  13  99......................................................................................................................EEITPLDRLCYVGKRGMGALEFEPSSPINGMNESSVLHIEELTELAKSVFTDR 151
6 -2.510PB011130 gi|88806557|ref|ZP_01122074.1| hypothetical protein RB2501_00756 [Robiginitalea biformata HTCC2501]gi|88783389|gb|EAR14561.1| hypothetical protein RB2501_00756 [Robiginitalea biformata HTCC2501]  ali follow..  13  19....................................................................................................NAYQKLLRYLE-AVKRSFAGTAGSDEIIADIEARIAELFYEKMENE......................... 63
7 -2.410PB202086 Q8G498_BIFLO/2-200 PB202086; Pfam-B_202086;  ali follow..  12  69................CVTAADTVRNNANEYNALLNGDAADAAAVKAEQVKDSKTV---------------------ESLGKELKASAPEYEGCVAENAQGLDAAAVK-LNEQADWYETHEKSLSKAVRAVVESKAAKRLDDAKTNLTAKLDEASKLLA---DSDGKVADN 198
8 -2.330PB038151 Q8A4A5_BACTN/1-178 PB038151; Pfam-B_38151;  ali follow..  14  1................................................................................................MATQAIDATIFASSHPDIAKRTSISGLLISCVMLL---IGILSFASTFELEDKSSTV.................. 54
9 -2.240PB012991 Q2RHT0_MOOTA/1-175 PB012991; Pfam-B_12991;  ali follow..  17  12.SRWDSLWPFL---FYCNFLKGVFLLRIAVVDGQGGGIGKHITARLRQEL......................................................................................................................... 58
10 -2.150HGC00803 gi|163280588|dbj|BABD01030100.1|2.0 TMP01051;  ali follow..  57.............................................................................................................IQETLDEAVCGINDLQEEFDENDSEI-----TVARDCIGVTVAYILEWFGIPIDIEEAIRER 114

FFAS is supported by the NIH grant R01-GM087218-01
1 3 9 5 6 0   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Ye Y, Godzik A. Comparative analysis of protein domain organization. Genome Res. 2004 Mar;14(3):343-53.