current user: public

If you have questions about the server, please let us know.

Query: HGC00991 gi|163600283|dbj|BABF01000984.1|3.0 TMP01348;, from HGM_OVER

Results of FFAS03 search in HGM_OVER
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .
# Score Template Links and tools%idFirst MQVDTKLINLKLWGYITMKKMIAYCGLDCEKCDAYIATINDNQELRKKTAKLWAELNNAPILPEHINCQGCRVDGIKTVFCDNMCGIRQCALEKGVATCGDCLDLERCPTVGEILENNPSALKNLKGLast
1 -54.700HGC00991 gi|163600283|dbj|BABF01000984.1|3.0 TMP01348;  ali  100  1MQVDTKLINLKLWGYITMKKMIAYCGLDCEKCDAYIATINDNQELRKKTAKLWAELNNAPILPEHINCQGCRVDGIKTVFCDNMCGIRQCALEKGVATCGDCLDLERCPTVGEILENNPSALKNLKG 127
2 -5.330PB001030 Q6D4H5_ERWCT/1-146 PB001030; Pfam-B_1030;  ali follow..  11  37...................................................................STQYND---------AIKRLERCHFGEDKPACKHCPIH--C................... 70
3 -3.450HGC01056 gi|162659434|dbj|BAAX01000171.1|2.0 TMP01455;  ali follow..  17........................................................................................................FAACDHNETYADQRDRELDSINA 39
4 -3.440PB001572 gi|163816107|ref|ZP_02207475.1| hypothetical protein COPEUT_02291 [Coprococcus eutactus ATCC 27759]gi|158448527|gb|EDP25522.1| hypothetical protein COPEUT_02291 [Coprococcus eutactus ATCC 27759]  ali follow..  130..........................LIAADCTAYAYASFHEKFIKGHVT-----------------LIGCPKLDSVDYS-----KLTEIIRRNDIQSVTIVREVPCCGGLEMAAKKALQDSGK... 207
5 -3.340PB018258 Q7MT99_PORGI/1-157 PB018258; Pfam-B_18258;  ali follow..  20  16.............................................................................................YEFAVCADCPKREQCLRASAYDGVLARGLQKITV 52
6 -3.020PB004996 Q5NNS6_ZYMMO/1-150 PB004996; Pfam-B_4996;  ali follow..  17  58...DGKQTPCKGHPVFLAQHATGTC---CRGCIEKWHRIEAGKSLSQEEQA............................................................................ 102
7 -2.750HGC00690 gi|162868815|dbj|BABB01001192.1|3.0 TMP00870;  ali follow..  11  33IGVVPRILRCSRIENIILIENVMICGVVAGNISSVLDTAYNLGFANMPKVPVSNICGNIIIAIYGLCVGGCIAVALAEILHTFPIIYKRMKLRAGL............................... 131
8 -2.540HGC00711 gi|162743779|dbj|BAAZ01020484.1|1.0 TMP00907;  ali follow..  11  66.............................................................AAADLAALGGATALSSIVAPGDPCEAASRVARANGAEVTTCS........................ 107
9 -2.450PB027498 Q7MTK6_PORGI/1-146 PB027498; Pfam-B_27498;  ali follow..  16  5....................LILIIGVLVLGLVAALTEIRHSHKRRAAEAKG----ESLPEEPVRVVPPGC-------------CGMHICEKDSLLTAVSKSIVYYDDEELDRYAGVLPEEYNTEAV 95
10 -2.450PB004588 Q64QH1_BACFR/1-389 PB004588; Pfam-B_4588;  ali follow..  10  11ISYTINMDTQKKHNLSGTIILVSCFLLLAGACDNSDRIETETQANGVLL.............................................................................. 59

FFAS is supported by the NIH grant R01-GM087218-01
1 4 0 2 4 8   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Li W, Pio F, Pawlowski K, Godzik A. Saturated BLAST: an automated multiple intermediate sequence search used to detect distant homology. Bioinformatics. 2000 Dec;16(12):1105-10.