current user: public

If you have questions about the server, please let us know.

Query: HGC01179 gi|162738527|dbj|BAAZ01025469.1|2.0 TMP01658;, from HGM_OVER

Results of FFAS03 search in HGM_OVER
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150
# Score Template Links and tools%idFirst VVVSILFQKARKVLNNERGEANYFSTVVFIFIAVLLLAFIIDLFSIISTKQELDHAADQMVKQIQLSGGVNGETDELFEFLSSQIEGAENISYSIDATYTSPRPSGMTNAIQLGTPFFITIEGDAKLGGFWNFDLVNITVVARGSGVSEHYWKLast
1 -86.600HGC01179 gi|162738527|dbj|BAAZ01025469.1|2.0 TMP01658;  ali  100  1VVVSILFQKARKVLNNERGEANYFSTVVFIFIAVLLLAFIIDLFSIISTKQELDHAADQMVKQIQLSGGVNGETDELFEFLSSQIEGAENISYSIDATYTSPRPSGMTNAIQLGTPFFITIEGDAKLGGFWNFDLVNITVVARGSGVSEHYWK 153
2 -5.690HGC00711 gi|162743779|dbj|BAAZ01020484.1|1.0 TMP00907;  ali follow..  15  26.............LSDERGAGTVLVVGV-IAVLLAAALGVSGLIQAQAAAGRSRAAA-------DLAALGGATALSSIVAPGDPCEAASRVARANGAEVTTCSVTGEDVVVEVSVEARV.................................. 123
3 -4.880HGC00690 gi|162868815|dbj|BABB01001192.1|3.0 TMP00870;  ali follow..  20  102...........................IFVGCIAVALAEILHTFPIIYKRMKLRAGLGIIVISMAIGKALGA................................................................................. 146
4 -4.880PB048631 gi|160885545|ref|ZP_02066548.1| hypothetical protein BACOVA_03545 [Bacteroides ovatus ATCC 8483]gi|156109167|gb|EDO10912.1| hypothetical protein BACOVA_03545 [Bacteroides ovatus ATCC 8483]  ali follow..  13  1.............MKIK-----FLSFIASFFMVSFVITSCLD------DDNNIEYSPDATIHAFALDTAGLGSYKFTIDQLSREIYNEDSLPVHADTIIGNDSVININDSIDLREPLTIKVWSTEALAGINQTKEYTIKVNVHQHDPDSLRWN 152
5 -3.200PB045072 _Gut.Meta.Jp.0111663_ gi|163310555|dbj|BABD01000145.1||3 (+ 1662:2028~0 complete)  ali follow..  16  1.......................MRKLGFTLVAALAFSVSAFA----AGKWDGTINKAKLTKYLQLSSQQNEQVASICDYFQEQM.................................................................... 67
6 -2.800HGC00962 gi|162759780|dbj|BAAZ01005693.1|3.0 TMP01305;  ali follow..  15  92.ALQGVLEGTLGVFGERLGRLLL-KLAVEHNMTNHLLGGDMDM-----TRDEYSKMRGSSVREVATHGTIS.................................................................................. 156
7 -2.800PB044863 Q5LB69_BACFN/1-105 PB044863; Pfam-B_44863;  ali follow..  10  44.VLEKLKLNIRSLIASQEEDSDLLDLCIDVIYHNNMKAFGLQQLIKLYLTWLSKQEAEE.............................................................................................. 102
8 -2.770PB000795 Q74Z21_ASHGO/1-280 PB000795; Pfam-B_795;  ali follow..  15  201......LQKADLVWPNWQARALYIDFWMLGDAAREL-----------WQKHRARELGNLVMNMFDPESTVDKCRKFLQKEFFDKYTDDPKV.............................................................. 280
9 -2.730PB011051 Q8A0P0_BACTN/1-227 PB011051; Pfam-B_11051;  ali follow..  22  1.......................MKTVFNIVLVLCAAALIYICYSSIMGPINFEKAKKE-IRKAQQEGMYTEHFDTLIDFVKNQ..................................................................... 77
10 -2.710PB002104 Q72PH8_LEPIC/1-220 PB002104; Pfam-B_2104;  ali follow..  13  10......FSKIRSRSCPFMQQNKFRKAIVAILMPMILVVSFGNCFGKFAIVKKVYEVNDGFNIGSGLLAKFIKTL............................................................................... 77

FFAS is supported by the NIH grant R01-GM087218-01
1 4 2 6 4 9   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Robinson-Rechavi M, Godzik A. Structural Genomics of Thermotoga maritima Proteins Shows that Contact Order Is a Major Determinant of Protein Thermostability. Structure (Camb). 2005 Jun;13(6):857-60.