current user: public

If you have questions about the server, please let us know.

Query: PB000821 Q82P27_STRAW/1-209 PB000821; Pfam-B_821;, from HGM_OVER

Results of FFAS03 search in HGM_OVER
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .
# Score Template Links and tools%idFirst MTLLGDKTASPYDTGTPVPGPGGMAVTYEQVATGGLPVAGLERPVVPRLSAGLKLHGEYQGSGFTEPKYIARRGDGQVVQLSRLLHLVASSVDGSRDIETIAHRVSGRFGREVSADNVRYLIEQKLDPLGVTVPEGREEEDISAPRSDLLLALKGHRVIFNERRVATIAGALAWLHRPVVVLAVLAGIAVLDVWLFAFFGAITPVLEVLLast
1 -95.900PB000821 Q82P27_STRAW/1-209 PB000821; Pfam-B_821;  ali  100  1MTLLGDKTASPYDTGTPVPGPGGMAVTYEQVATGGLPVAGLERPVVPRLSAGLKLHGEYQGSGFTEPKYIARRGDGQVVQLSRLLHLVASSVDGSRDIETIAHRVSGRFGREVSADNVRYLIEQKLDPLGVTVPEGREEEDISAPRSDLLLALKGHRVIFNERRVATIAGALAWLHRPVVVLAVLAGIAVLDVWLFAFFGAITPVLEVL 209
2 -7.730PB027778 Q5LHJ0_BACFN/1-110 PB027778; Pfam-B_27778;  ali follow..  10  1................................................................................MGLEDDFLLNDADDEKTIEFIRNYLPQELKEKFSEDELYYFLDEYYSESGILDVQPDADGYVDIDLEQVVEFIVKEAEYDPEDILFVVQGEMEYG.................................. 104
3 -7.270PB002770 Q744K2_MYCPA/1-559 PB002770; Pfam-B_2770;  ali follow..  13  1MTMQGDAQCVRGNRNT-AAAQPSPWTARPFGDRLVGWDTYRRLDLLPYLSADTQSLSSFDRSGGDFDISTGNKNGTGGCLAPGGAGCVIAEDHGAGEVDSI............................................................................................................ 127
4 -4.750PB062763 Q9F6U5_BACTN/1-245 PB062763; Pfam-B_62763;  ali follow..  13  64.DIIGKSRFRMAPTRTTAAISTQEAAISEKGIELSEEEATFDDGNTETASRPTQVPEDKLDETFTSISPEELEASGSAFE-MRHAGKVMTELDGT----ELYSRITERLTDEPMSERLAKAMAVFVDTVNTTVAQPKTKVFVVLDN............................................................... 236
5 -4.620HGC00933 gi|162753228|dbj|BAAZ01012194.1|2.0 TMP01261;  ali follow..  14  109.....................................................................FDNQSIEKSLVSKNPLVRILALLDGKRRLLALEESMEQE------LDWVRAFYVIRMQAEGLMEKE.......................................................................... 171
6 -4.540PB003564 gi|46242789|gb|AAS83494.1| TraD [Bacteroides fragilis]  ali follow..  16  64.DIIGKSRFKMASTRTTAAIPTQEAATSEKGIELSEEEATFDDGNTETVSRPTQVPEDKLDETFTSIPPSELEASGSSFE-MRHAGKVMTELDGT----ELFTRITERLTDEAMSERLAKAMAVFVDTVNMTVTQQKEKVFVIP................................................................. 234
7 -3.860PB011130 gi|88806557|ref|ZP_01122074.1| hypothetical protein RB2501_00756 [Robiginitalea biformata HTCC2501]gi|88783389|gb|EAR14561.1| hypothetical protein RB2501_00756 [Robiginitalea biformata HTCC2501]  ali follow..  13  10..........................................................................ANMLFHIDENAYQKLLRFAGTAGSDEIIADIEARIAE-ITQKEVDAVIAIMGQPEDYQVDEDIFEDVPPGTGSA............................................................. 102
8 -3.780PB044380 A7LRP7_BACOV/1-223 PB044380; Pfam-B_44380;  ali follow..  10  59.GIMGSTCFVYLDEDAGKSVAPYMSQPLETAADFIGEEEDVAEEEVECKPAVDAVSRVVTPDDLDNAGNVLFKLNDA--EKSLRAALTLHTIRETDLFEIFSSQVENK-------NVIDSLMGKYLDGNGNPLSVRKTKSVVPVS................................................................ 217
9 -3.590PB033130 gi|160880323|ref|YP_001559291.1| transglutaminase domain protein [Clostridium phytofermentans ISDg]gi|160428989|gb|ABX42552.1| transglutaminase domain protein [Clostridium phytofermentans ISDg]  ali follow..  85............EVEAPKDSVKYQFNLTREQQATNRSKLREAKLLRENRIE--SYYDEALAENVPDAKEILHLAKGNFMEINQDRLALLKTLKVKDYKDVTASVLEDHLKVRESSYKYRPVYKDNIAHEDSIVYKESIEFNDSCVYNDSIAYFAMEYIVCPRIYLEELTA....................................... 256
10 -3.020PB046158 _JGI.0336690_ 2004028347 [Human Gut Community Subject 8]  ali follow..  69.........................................................................................KKPHGKQTIKQLNAQGVQLSNIKITDENIKSF-DRVARKYGI.............................................................................. 109

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 6 1 8   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Friedberg I. and Godzik A Connecting the Protein Structure Universe by Using Sparse Recurring Fragments. Structure (Camb.) (2005) Aug;13(8):1213-24