current user: public

If you have questions about the server, please let us know.

Query: PB001404 Q2S5L8_SALRD/1-256 PB001404; Pfam-B_1404;, from HGM_OVER

Results of FFAS03 search in HGM_OVER
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .
# Score Template Links and tools%idFirst MHRSISGSDCGPTPTSSTLPLTPYTPAMPFLTRSRIARVASLLSAGVLALVLLSCDGVGDFGDTNEDPTTANDPNPDLEFTTLQLGVSGSRFDMWRTNLIYTMPIVQHIANPGFYAGNFNQYVGAWSASFFDTRYGGGPNGSNFLRTVTNAETLISELEGKPRQVNRLAATRIMRVLTFQRLTDVYGDVPYFDAGKGALEGEFTPHYTRQDSIYMDLHDELRAAVDQFDASQPTFGGADLFFNGSIEQWKRFANSLLast
1 -126.000PB001404 Q2S5L8_SALRD/1-256 PB001404; Pfam-B_1404;  ali  100  1MHRSISGSDCGPTPTSSTLPLTPYTPAMPFLTRSRIARVASLLSAGVLALVLLSCDGVGDFGDTNEDPTTANDPNPDLEFTTLQLGVSGSRFDMWRTNLIYTMPIVQHIANPGFYAGNFNQYVGAWSASFFDTRYGGGPNGSNFLRTVTNAETLISELEGKPRQVNRLAATRIMRVLTFQRLTDVYGDVPYFDAGKGALEGEFTPHYTRQDSIYMDLHDELRAAVDQFDASQPTFGGADLFFNGSIEQWKRFANSL 256
2 -24.300HGC00024 gi|162813637|dbj|BABA01031072.1|2.0 TMP01508;  ali follow..  13  1...............................MKNIYNTLGMTKACLCALAVSLVTTGCSDL--LDKEPPSAISDGSFWTGEGDAMLALTGCYRFQTGWSHDDFATPQGLLYLDFAGGNGTE-TNSNLRWYWGNAYTQIAKYNTFLENITDCP-------EESKKEQWSAEVKCLRAYFFLNLAFYYTDVPMPLKTLSVDEANSISQ-TPQTEVYSQVEKDLKTAIDLLPVH----------YLRGIWRLPGGG... 217
3 -9.730PB000790 _Gut.Meta.Jp.0111831_ gi|163310496|dbj|BABD01000203.1||3 (- 2591:4589~0 complete)  ali follow..  2..........................................................................................................................................................MRYAMRLSVVDPATARSEFSAAAEGLNVITTQDEIFAVPE---------NNGWDNLTGVFTRSFDDQVLSSTVANLLTNLGGVKVADMYPRLASNVKPANYL 94
4 -7.410PB004588 Q64QH1_BACFR/1-389 PB004588; Pfam-B_4588;  ali follow..  2.........C-----TTNAVNEKISYTINMDTQKKHNLSGTIILVSCFLLLAGACDNSDRIETETQANGVLLNFNASTIDATTTETRSFVPIEGFAKNEYIFGMSVTKDNASRGEIFEGSRNLKATMSRP---------------SGDAPWNWEFSNNASGTVVTPRGPEGKPLRVIAYY---------PAIAGTENFTDGIPFDFTQTNNPQQKEILYNTNTSYTIPSSGGSDKVTIPLKFQHAYSW........ 211
5 -6.100HGC01056 gi|162659434|dbj|BAAX01000171.1|2.0 TMP01455;  ali follow..  10  1...................................MKKLLLAMIAVAALISFAACDHNETYADQRDRELDSIN....................................................................................................................................................................................... 38
6 -5.850PB048631 gi|160885545|ref|ZP_02066548.1| hypothetical protein BACOVA_03545 [Bacteroides ovatus ATCC 8483]gi|156109167|gb|EDO10912.1| hypothetical protein BACOVA_03545 [Bacteroides ovatus ATCC 8483]  ali follow..  1...................................MKIKFLSFIASFFMVSFVITSCLDDDNNITIDQLSREIYNEDSLPVHADTIIDKILIKTLTTASGVVTMKDKSGNDSVININDSIDLREPLT-----KVWSTEALAGISPNQTKEYTIKVNVHQHDPDSLRWNHVGKMQDEIIGEQKTIEFNNKILTYSVVEGKNLKVYQNSNYSNNTTGDLTSTLPNSILPLNGIILATANNKVYESTDGVAWTISDKF. 245
7 -5.620PB050904 Q64SA2_BACFR/1-230 PB050904; Pfam-B_50904;  ali follow..  10  1...................................MKSRIISLGLVASLVCLLPQVAEAQI--AASNPLEWTALAEGNELINGQIEKQIKGQTQTALLQNSIATEFNQIHK-----EKQYNSYLKTASGYASSLKACTHLYNDGVRIFLTLGKLGKAIQNNPQGIVASMNMNNLYIETATELVSVFTLL--DAVAKGSNENMLTGA--ERSKTLWALNDQLSDFSRKLHTAGMLDRDNGEAARMALSHWHRAAALV 230
8 -5.160HGC01024 gi|162869036|dbj|BABB01000971.1|4.0 TMP01399;  ali follow..  1..................................MMRRKNITWVWLLGAAFMVGCG-----------KQVPENIIQPDRMENILYDYH--------------------------------------------------------------SISMGNNLSYSDNYQKEAYKNYVFEKHHIT-------EAEFDSSMV----------YEELASLYKKLGERFRSEKKHMQELLAL...................... 116
9 -4.940PB021443 Q5LG43_BACFN/1-226 PB021443; Pfam-B_21443;  ali follow..  1...................................MKTMKFILACVLLLSPLLCQAQKNLFNKYNDMKGVSSVYISKAMM-ELNPNLFMKDLYIGKVAEHLNSVQVLSTHDNKVREEMAKDIRSLVQSSKYELLMKQKSTVSGSEVYVNRKGSKVKELIMVMNGASSLKFVYMEGDMTTDDIKKLMLYQSTSQNFIISGDLFIDTNYKEELSTLNDKLKRIDQGLKNMN........................... 225
10 -4.310PB002794 gi|86143885|ref|ZP_01062253.1| hypothetical protein MED217_03525 [Flavobacterium sp. MED217]gi|85829592|gb|EAQ48055.1| hypothetical protein MED217_03525 [Leeuwenhoekiella blandensis MED217]  ali follow..  10  263...................................................................................................................................................................................SLMTETLARV-FSKAKQAY--RILSLKYPEKSGFFADQIRAIEKLQEN............................. 313

FFAS is supported by the NIH grant R01-GM087218-01
1 3 7 8 0 7   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Sasin JM, Godzik A, Bujnicki JM. SURF'S UP! - protein classification by surface comparisons. J Biosci. 2007 Jan;32(1):97-100.