current user: public

If you have questions about the server, please let us know.

Query: PB002589 gi|91201099|emb|CAJ74158.1| hypothetical protein [Candidatus Kuenenia stuttgartiensis], from HGM_OVER

Results of FFAS03 search in HGM_OVER
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380    .  390    .  400    .  410    .  420    .  430    .  440    .  450    .  460    .  470
# Score Template Links and tools%idFirst IKEELVRCIWFGQHIEKKNLRTDDGLRLEILSPGWWNNEEGPDFKHAEFFLEGKGLIRGSVEIHVFASDWIHHKHENQKTYDAVCLHVVMWNDLKGRCVKNFSGKVIPQITLSLYLEAELDEIIETIDVGSYIGNKQVIPGYCNLEMRKQKITQQWIGGFLDYAGDERILQKAKKYEKWIENKPFERVLYEAIMESLGYKNNKKPFLMLASLVTAETIQSFVPEYTPAQEKKIIAQSLLLGMAGLLPLNEEETKRFDDETIQYFDRIFSTWQGIKPKIHQTPLTRESWSYTGIRPANFPDRRIVAIANILSEHLDNGLFRYILRIFQKRDDTKKNTRGFKSFVNEFLSPFLETHDAYWSYRYTPGGKKLNKPQKLLGKERTSNIFVNVIIPVMLVYARKHNDKALEERLHYIYRNYTPHPSTSVTKFMGTRIFGTSMVSNKVIHSARRQQGLYQLFKDFCENDTISCNKCALast
1 -128.000PB002589 gi|91201099|emb|CAJ74158.1| hypothetical protein [Candidatus Kuenenia stuttgartiensis]  ali  100  1IKEELVRCIWFGQHIEKKNLRTDDGLRLEILSPGWWNNEEGPDFKHAEFFLEGKGLIRGSVEIHVFASDWIHHKHENQKTYDAVCLHVVMWNDLKGRCVKNFSGKVIPQITLSLYLEAELDEIIETIDVGSYIGNKQVIPGYCNLEMRKQKITQQWIGGFLDYAGDERILQKAKKYEKWIENKPFERVLYEAIMESLGYKNNKKPFLMLASLVTAETIQSFVPEYTPAQEKKIIAQSLLLGMAGLLPLNEEETKRFDDETIQYFDRIFSTWQGIKPKIHQTPLTRESWSYTGIRPANFPDRRIVAIANILSEHLDNGLFRYILRIFQKRDDTKKNTRGFKSFVNEFLSPFLETHDAYWSYRYTPGGKKLNKPQKLLGKERTSNIFVNVIIPVMLVYARKHNDKALEERLHYIYRNYTPHPSTSVTKFMGTRIFGTSMVSNKVIHSARRQQGLYQLFKDFCENDTISCNKCA 471
2 -2.690PB083081 gi|160890648|ref|ZP_02071651.1| hypothetical protein BACUNI_03093 [Bacteroides uniformis ATCC 8492]gi|156859647|gb|EDO53078.1| hypothetical protein BACUNI_03093 [Bacteroides uniformis ATCC 8492]  ali follow..  13  51....................QGSEGIRVRLTELSWGDNVQHN--PDFYCMMDGTKIFKGEYNVRIDGPF-----------IPLVRENTDGTLLHDGSVNTEISGTTKVKFEVQPFLNVE................................................................................................................................................................................................................................................................................................................................................................ 140
3 -2.470HGC00374 gi|162831834|dbj|BABA01012875.1|1.0 TMP00304;  ali follow..  4........................................EVHYFDELIRASEKRVYRKVKEIFALSVDYDSKSQVAQSFFKSV-LEYAATGHTAPELIAKRADASKDNMGLTSFKGVKVRRGDVTVAKNYMTHEE-------STLNLIVNMYLDYAELQAKGHIPMHMADWESKLGDFLRFNGRE------VLENFGTVKREVAEKLALEQYEYDTHRRALEAADDVDELTADVKRL......................................................................................................................................................................................................................................... 198
4 -2.420PB042013 A7V626_BACUN/1-162 PB042013; Pfam-B_42013;  ali follow..  11  29.RPAELAGIWQVSEIPDVPGILKPSNTFKVLSDGTYQQLTDNSYKESIEKNIHLPMLDHKLEFEIGDDGWKR--GMPAKFPEDLV.................................................................................................................................................................................................................................................................................................................................................................................................. 162
5 -2.300HGC00991 gi|163600283|dbj|BABF01000984.1|3.0 TMP01348;  ali follow..  25  90...........................................................................................................................................................................................................................................................................................................................................................................................................................................................................CALEKGTCGDCL 103
6 -2.280PB155142 _HOMD.0127537_ bfor_c_1_1790 Tannerella forsythia ATCC 43037 [677748 - 680894] ORF  ali follow..  17  10.................NLINPEDIESQTILKDAAATALYGSRGANGVVLITTKSGRRGKTHIAFTAE................................................................................................................................................................................................................................................................................................................................................................................................................... 60
7 -2.230PB002776 gi|157737147|ref|YP_001489830.1| hypothetical protein Abu_0901 [Arcobacter butzleri RM4018]gi|157699001|gb|ABV67161.1| hypothetical protein Abu_0901 [Arcobacter butzleri RM4018]  ali follow..  10  191.....................................................................W---GHYGQ-GHSGVCLIFETNNEGEIPFLNVYTNGNFEEINFFESLGKIPQPLVESFYIDENKNKSILFDKVLNNQEEWRKLFWDKYEKKLTKTKDWTYEKEYRIVLNRLMDYEYDFNCLKGVI--FGIKTPQNKKDEIIEIIINKCHENNILDQAFYCKESKNIQHKKLDVNIINDLIKKAKQNKLDLNIEFL............................................................................................................................................................................................................... 402
8 -2.210PB038401 Q8RFH0_FUSNN/1-210 PB038401; Pfam-B_38401;  ali follow..  10  1..............................MDIGPCSIPTGPLVYLGSKYEKEQKIPTGEFRTEICVVKASDGDCDR--AAVRLKFEEAMKGIEDLKDINEGDFFGFNV--LACICDKKLHDLYCEFDEKFVKENPDGNAYDDYFADLFKKSYEDNPKYQRDGGDWINWTIPGTDYHLPIFQSGFGDGAYPVY---LAYDKDGNV---CQLIVELIDIELAYSEIDEEDE................................................................................................................................................................................................................................................. 210
9 -2.000PB045813 Q5LF03_BACFN/1-275 PB045813; Pfam-B_45813;  ali follow..  11  1..............MIQGKKFISPGTWFSMIYPSDWSEFEDGE---GSFLFYNPEHWTGNFRISA-------KEDAAAPGGMNYGKDSVRQELKENPSASLVKVGHLECAYSKEMFEEEGIYYTSHLWVTGIDNVAFECS------TVPKGEHVDEAEKIISSLEIRKDGQKYPAEIIPIRLSE-IYQVNEAYEWVTDTVKTQLKKDFQGLEEDLQKIQDVIDSGVLSPKKKEPWLAFGIAICTILANEVEGM----------------EWMTLVDGNREVPVLRYEGSEQLIDPMKLLWSRVRA...................................................................................................................................................................... 260
10 -1.940PB001030 Q6D4H5_ERWCT/1-146 PB001030; Pfam-B_1030;  ali follow..  12...........................................................................................................................................................................................................................................................................................................................................................................................................................................................YRQREIRTVGLMIALYEKRHPETSTQYN 41

FFAS is supported by the NIH grant R01-GM087218-01
1 3 9 8 1 1   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Pawlowski K, Jaroszewski L, Bierzynski A, Godzik A. Multiple model approach--dealing with alignment ambiguities in protein modeling. Pac Symp Biocomput. 1997;:328-39.