current user: public

If you have questions about the server, please let us know.

Query: PB003645 Q65HI2_BACLD/1-230 PB003645; Pfam-B_3645;, from HGM_OVER

Results of FFAS03 search in HGM_OVER
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230
# Score Template Links and tools%idFirst MNKRTWIEKLIGHLLPKDEKDGKKLTKYHYFLLLFVLGVSFMLVSQIFSSEPSQEPAADQPAASQKATSESTVQSGEGEKEVFKPASDDKPKESIQDYEQEYENQLKDILETIIGVEDVSIVVNVDATSLKIFEKNRKTQETSTNETDKQGGKRTVSEMSSDEEIVIIKNGDKETPVVVQTKKPDIRGVLVVAQGVDNVQIKKTIIEAVTRVLDVPSHRVAVAPKKMKEDLast
1 -73.800PB003645 Q65HI2_BACLD/1-230 PB003645; Pfam-B_3645;  ali  100  1MNKRTWIEKLIGHLLPKDEKDGKKLTKYHYFLLLFVLGVSFMLVSQIFSSEPSQEPAADQPAASQKATSESTVQSGEGEKEVFKPASDDKPKESIQDYEQEYENQLKDILETIIGVEDVSIVVNVDATSLKIFEKNRKTQETSTNETDKQGGKRTVSEMSSDEEIVIIKNGDKETPVVVQTKKPDIRGVLVVAQGVDNVQIKKTIIEAVTRVLDVPSHRVAVAPKKMKED 230
2 -3.850PB006791 A6TXD6_9CLOT/1-181 PB006791; Pfam-B_6791;  ali follow..  38...................................................................................................SNLKDKYKRLVK---GTDGKNIESVLMQHIEKVEEAQVEVEKVHKRLDIINNRMSFCIQKVGMVRYNAFADMGSDLSYSYALLDENNNGMIIVKDGKSNYSLSVEELQALQRAKENTIDTLELQGFRSKKE 180
3 -3.800PB021443 Q5LG43_BACFN/1-226 PB021443; Pfam-B_21443;  ali follow..  12  55......................................................................................................DLYIGKVAEHLNSV--------------QVLSTHDNKVREEMAKD-----IRSLVQSSKYELLMKQKSTVSGSEVYVNRKGSKVKELIMVMNGASSLKF-------VYMEGDMTTDDIKKLMLYQSTS 156
4 -3.370PB022815 A4DEQ0_LISMO/1-452 PB022815; Pfam-B_22815;  ali follow..  11  317...............................................................................VIAHDNAVKLLYQMKHEVEEQQYKVRFEKIKDLEKTIDNYAFIV---KQASDLLTEGKALSH---------GGSNYIKQHIEGKTTIVRDKQDLEKSLYTLEYK---NGQIYQLRGKHNCDPTKDVQMAANK---AKLLKSKTKVLQN... 452
5 -3.200HGC01213 gi|163579070|dbj|BABE01006032.1|2.0 TMP01709;  ali follow..  74............................................................LGRGIGAVNSMIHHDEVYAISRDATPAPKKVSNVKDCSASDVTLQLSAASQSVPVGGSLDFTATIVHEGSGNYLVDGSDSGRVLTITSGQETIYKSDVCPADSRLLLMAKGDKDV....................................................... 188
6 -3.010PB064361 Q64PJ4_BACFR/1-580 PB064361; Pfam-B_64361;  ali follow..  13  125....................................................................TADISLTGQDNTGNKFPYVLKGVSSKQYSYKENVQLNLEHQLVK--------FRVKLNGDVPNLSDAKVFFYGYPTCKNEYG----TVIPQGDKTYLATRKVGDYYTAMLAPDTKTSNNFVKIEVYG................................... 239
7 -2.620PB002770 Q744K2_MYCPA/1-559 PB002770; Pfam-B_2770;  ali follow..  19.......................PLAARLFPAMFALLMLVIAGTGSAAAQPSPWTARPFGDRLVGWDTSADTQSLQLSSFDRSGGDFDISTGNKNGTGGCLAPGGAGCVIAEDHGAGEVSIWLTRDGGNLRVELDGQTVLDTPVQSLVDGQLGAPFVWPLVANAGESPGGDYIKVPM------PYRRSMRISVES................................... 201
8 -2.390PB044380 A7LRP7_BACOV/1-223 PB044380; Pfam-B_44380;  ali follow..  12  46..................................................................................................ELENVLSEPGGESGIMGSTCFVYLDEDAGKSVAPYMSQPLETAADFIGEEEDVAEEEVECKLPLEEMRMLKEEQEELDGTYPAVDAVSRVV-VLFKLNDADKDEEKSLRAALTLHTIRETDL.......... 176
9 -2.250PB031792 gi|154174791|ref|YP_001409041.1| flavodoxin family protein [Campylobacter curvus 525.92]gi|112804021|gb|EAU01365.1| flavodoxin family protein [Campylobacter curvus 525.92]  ali follow..  4.................................................................................................DKGGPEAHFKRYIKEHVKGKKTGLFITLGADPAGEHGESMLKVGRE----------------------------------LLNEGGNEILAEFI-CQGAIDPKVIEEMKEMAAK................... 82
10 -2.210PB062763 Q9F6U5_BACTN/1-245 PB062763; Pfam-B_62763;  ali follow..  1...........................MTKVFLIVSVACNVWFLLMLLSLGTKSEKQDTLHSEASDEDADIIGKSRFRMAPTRTTAAISTQEAAISEKGIELSEEEATFDDGNTETASRPTQVPEDKLDETFTSISPEELEYGEDEPEDDEPGKAFEDIDMAVRTIKKDSPSEAEMRHAGKVMTELDGTELITERLTDEPMSERLAKAMAVFVD................ 217

FFAS is supported by the NIH grant R01-GM087218-01
1 3 9 2 2 3   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Slabinski L, Jaroszewski L, Rodrigues AP, Rychlewski L, Wilson IA, Lesley SA, Godzik A. The challenge of protein structure determination--lessons from structuralgenomics. Protein Sci. 2007 Nov;16(11):2472-82.