current user: public

If you have questions about the server, please let us know.

Query: PB004996 Q5NNS6_ZYMMO/1-150 PB004996; Pfam-B_4996;, from HGM_OVER

Results of FFAS03 search in HGM_OVER
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150
# Score Template Links and tools%idFirst MANLDVLFERLSRSSFRRRFRLGVQEQQYLANKGMETILEHGKDFIAQRLAPAEIPNDGKQTPCKGHPVFLAQHATGTCCRGCIEKWHRIEAGKSLSQEEQAYILDVIAHWLDLQKEVPPKKTKAATLNLPKKRKSKAEDVQGSLFPEIELast
1 -95.800PB004996 Q5NNS6_ZYMMO/1-150 PB004996; Pfam-B_4996;  ali  100  1MANLDVLFERLSRSSFRRRFRLGVQEQQYLANKGMETILEHGKDFIAQRLAPAEIPNDGKQTPCKGHPVFLAQHATGTCCRGCIEKWHRIEAGKSLSQEEQAYILDVIAHWLDLQKEVPPKKTKAATLNLPKKRKSKAEDVQGSLFPEIE 150
2 -3.360HGC00921 gi|162841401|dbj|BABA01003308.1|3.0 TMP01242;  ali follow..  18  197.NQVEAKFQDVSPNEKR---------LEKCRDYGLIIIIGPEKNRIRRFFKICLSIHI---------PIFF-RYGTCPCCR-CDAYLYA............................................................. 273
3 -3.020HGC00991 gi|163600283|dbj|BABF01000984.1|3.0 TMP01348;  ali follow..  17  4.........................................................DTKLINLKLWGYITMKKMIAYCCEKCDAYIATINDNQELRKKTAK................................................ 51
4 -2.200PB045072 _Gut.Meta.Jp.0111663_ gi|163310555|dbj|BABD01000145.1||3 (+ 1662:2028~0 complete)  ali follow..  10  41........................................................................................KLTKYLQLSSQQNEQVASICDYF-QEQMKVANSSKKNSDQKVRNAVYGNLKLMKNTLTEK.. 99
5 -2.110PB064361 Q64PJ4_BACFR/1-580 PB064361; Pfam-B_64361;  ali follow..  76....EVIGVKIGTDGAVGSYTLDSDGKPTTSTSNIPAYWQSTASQTVYGWYPDISLTGQDNTGNKFPYVLKGVSSKQYSYKE-LNLEHQLVK--KLNGDVPNLSDAKVFFYGYPTCKNEYGTVIPQGDKTYLATRKVGDYYTAMLAPD.. 225
6 -1.890HGC00993 gi|163626727|dbj|BABG01009540.1|1.0 TMP01352;  ali follow..  22...VAGVIKLIASAADSLAFY-SSHQEELARLKRIRKLHQKVATLITESALSDEEYGSDGREDFS--------RGVTKHPGDNRGFYHGVSPGSERGLMDYFYPEDTRTMFLRKEEQMLQHDKKNNKTSSTNKKQ............... 145
7 -1.840PB042013 A7V626_BACUN/1-162 PB042013; Pfam-B_42013;  ali follow..  13  59.......FKVLSDDGRIVNFTMIPGKDAIITGYGTYQQLTDNSYKESIEKNIHLPMLDHKDNIIGDDGVMYLKYFIAK--TWFHETWKRVGMPAKFPED................................................... 160
8 -1.830HGC00485 gi|163636056|dbj|BABG01000217.1|3.0 TMP00523;  ali follow..  11  36.................SECRTAADQAAELNETGQVGLLRLAEVWSAIRAKE-----GMGGLILEGTEAKILSDVVAQFYAYLSGCMFNDPVGMAI--AELHYMMSSLMEWFE..................................... 127
9 -1.830PB078508 A6TV41_9CLOT/1-155 PB078508; Pfam-B_78508;  ali follow..  14  108......................................................................................................FHQAIKIRFSEYYRERDFEKSSLRKQIKDLTEKNVIESTNAKEHSEIE 155
10 -1.780PB027778 Q5LHJ0_BACFN/1-110 PB027778; Pfam-B_27778;  ali follow..  27  31.............................................................................................EKFSEDELYYFLDLIDEYYSES................................... 52

FFAS is supported by the NIH grant R01-GM087218-01
1 4 0 1 8 1   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Li W, Wooley JC, Godzik A. Probing metagenomics by rapid cluster analysis of very large datasets. PLoS ONE. 2008;3(10):e3375. Epub 2008 Oct 10.