current user: public

If you have questions about the server, please let us know.

Query: PB005346 A0R807_PELPD/1-258 PB005346; Pfam-B_5346;, from HGM_OVER

Results of FFAS03 search in HGM_OVER
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .
# Score Template Links and tools%idFirst MTDSLFWAIDIKNQFHHNWMGMSQINQTTSGNFYSHRNITDQVLENFTDALDCLTAHLMLECSEVLAGVKPANLISIVNRTRPCGRNLYLLWQQHHTDLAQRLNNLNFMVLQSRQQSLLLLCYDHVRLEHHLSHPGIRTLLHKAGYKDDADCEGMLLELRSRIGGNNSFPHEIGLFIGYPAKDVAAFMGLVRLPFTCQRLWKIYGNPARSLALAEQYRCCRNKMGAILARGTSKTLEIDRSDHPFFCQTDENDYQYLPLast
1 -111.000PB005346 A0R807_PELPD/1-258 PB005346; Pfam-B_5346;  ali  100  1MTDSLFWAIDIKNQFHHNWMGMSQINQTTSGNFYSHRNITDQVLENFTDALDCLTAHLMLECSEVLAGVKPANLISIVNRTRPCGRNLYLLWQQHHTDLAQRLNNLNFMVLQSRQQSLLLLCYDHVRLEHHLSHPGIRTLLHKAGYKDDADCEGMLLELRSRIGGNNSFPHEIGLFIGYPAKDVAAFMGLVRLPFTCQRLWKIYGNPARSLALAEQYRCCRNKMGAILARGTSKTLEIDRSDHPFFCQTDENDYQYLP 258
2 -3.810PB001823 Q5L7Q9_BACFN/1-326 PB001823; Pfam-B_1823;  ali follow..  110FEDT--QNGDYDNDLIIHV-KNTASNHAYQHPTETWQTIEIQPIALGSTKTIKLGCILSDGSTHMISDDVRTDLFGGRQGFINTVNDNDPIRYKLASTNIKNYAMPKKEKTSAAWVAWFIEVDGKRMAASSDIDYKSYDMVNKENMPYGLAVSNGNGTFS--------YPQENSLFETYP--GFSDWINGKVSSIG----FGIIGEDGKSHKIWDYLD........................................ 325
3 -3.600PB000790 _Gut.Meta.Jp.0111831_ gi|163310496|dbj|BABD01000203.1||3 (- 2591:4589~0 complete)  ali follow..  10  232.WESYFLLAEAAEY---GWISNITPKEAYELGIRSSFEYF-GVSEYADQYINSTTRNRLGTSVAFDDTVEPTSEVMTYRDGYTNTDQIQEVVYNYPTASKTLYGKAMNDHLTKIITQKYIAQMPYQVLEIWND-------HRRLGLPFSDMVNVLKKDSWKNGQQWDFYPQRM-----YPTTLDKAVELLGGSDVIITPLW......................................................... 436
4 -3.540PB009534 gi|153852721|ref|ZP_01994158.1| hypothetical protein DORLON_00140 [Dorea longicatena DSM 13814]gi|149754363|gb|EDM64294.1| hypothetical protein DORLON_00140 [Dorea longicatena DSM 13814]  ali follow..  10  1.SDDIYIKADRNIEVAKKSVTLGDVLKIECVNPAMLARIRSTHLLTFHHPDNKRERRVVMSVLKVIQKIH-EIYPEASVENIGETDFIVTYEEQDGKGGVIHVAKIVMVVMISFFGAAFSTM----------------------AFNNDVGVTKMFGQIYELLTGTKEFMYCIGIIIG-----ILTFFNHFGKK-------RLSVDPTPMEVEMRLYENDIQTTL................................. 196
5 -3.090PB044572 Q8A533_BACTN/1-343 PB044572; Pfam-B_44572;  ali follow..  12  117.VDSV-WVKLAHTQEEQGWIRETELKESFVPTDS------SQAIHFFSDTHASYFMIILFVGVYLFRAFRRKQLQLVYFNDIDSVYPLFLC-------LLMAFSATVYESMQVFVPDTWEHFYFNPTLSPFKVPFILSVFLLSIWLFLIVAL-AVLDDLFRQLTPAAAVFYLLGLYIGYLF............................................................................. 301
6 -2.480PB031792 gi|154174791|ref|YP_001409041.1| flavodoxin family protein [Campylobacter curvus 525.92]gi|112804021|gb|EAU01365.1| flavodoxin family protein [Campylobacter curvus 525.92]  ali follow..  15  13............................................................................................................................KRYIKEHVKGKKTGLFITLGADPAGEHGESMLKVGRELLNEGGN----LAEFIGAIDPKVIEEMK..................................................................... 77
7 -2.480PB128892 A6TNK2_9CLOT/1-174 PB128892; Pfam-B_128892;  ali follow..  15  14......................................................................................................................LVLLYIFDRVQFPLANIQLTQFIMENDIMNYFMLQQFIGELKES................................................................................................ 57
8 -2.330PB012823 Q5LCS8_BACFN/1-272 PB012823; Pfam-B_12823;  ali follow..  63..DTIYYSDAQSAPVYFKILKDTLYTYGKDVTHYQIDKQSEYSFSEDPNDTLAFSFKSVEIIPTYTEVTKKDSVVMFDGVRYRAYVYINPSQMKVVKTTYSEDGISMDNIYYDNVMHICVYEGKKSLYAKDITKQMFVDVIPTDFLQQAILSDMNFIGIDRK---------HYQALVCIPESPV.......................................................................... 251
9 -2.310PB023890 Q7MUU3_PORGI/1-263 PB023890; Pfam-B_23890;  ali follow..  11  17....LLFACPIKKEFIGRTAKSLSLALAIFSGCIFGSVLPAWSQEIVAGELERCFLAMPESVLPIVTMEERNDLCRASLESSLGGTVTFLLNRNFIRIQTSTVGEVFMRILPFSDSSSVICVWKPLKTDRFWQQPRIEDFFLPHTDRQSYAYQAIYASLTPSYMQVSLSEESDTLSIRQTVTETLAFLSPEPLVYR----WQ........................................................ 255
10 -2.300PB045813 Q5LF03_BACFN/1-275 PB045813; Pfam-B_45813;  ali follow..  22......WSEFEDGEFYNPEHWTGNFRISAYKEDAAAPGGMNYGKDSVRQELKENPSASLVKVG-VTGIDNVAFECSFTVPKGEHVDEAEKIISSLEIRKDGQKYPAEIIPIRLSEIYQV----AYEWVTDTVKTQLKKDFQGL---------EEDLQKIQDVIDSGVLSPKKFGIAIC--ANEVEGM-------------WMTLVDGNREVPVLR........................................... 240

FFAS is supported by the NIH grant R01-GM087218-01
1 3 8 7 1 9   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Luz JG, Hassig CA, Pickle C, Godzik A., Meyer BJ, Wilson IA. XOL-1, primary determinant of sexual fate in C. elegans, is a GHMP kinase family member and a structural prototype for a class of developmental regulators. Genes Dev. 2003 Apr 15;17(8):977-90. Epub 2003 Apr 02.