current user: public

If you have questions about the server, please let us know.

Query: PB006101 JCVI_PEP_1096697844517 /source_dna_id=JCVI_ORF_1096697844516 /offset=0 /translation_table=11 /length=371 /full_length=371, from HGM_OVER

Results of FFAS03 search in HGM_OVER
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .
# Score Template Links and tools%idFirst YLISFSFLLYSCDEKPKSGITNPSFLPNASGENNEMLIVMDSTKFKGKIGRELVDIYSSYISGLPQPEPRYDLRYIKPRKFNSILKHAKNIVVAFSLEGNSLDSEILRRNFNSESLDKIQSDSSLFYFVRRNQYARGQVVLYLFSENDDDLYSKIKRNRNSILKFFDDELKKRVDTEIFRKVENNLMDKIFTDHNIKIKIPYGYDLAKSINEENSNFFWLRQLDLEYDKNIFLYYEDYSNSELKNFYDVFNSSDINIKPIRAYISKKYLRDSEKSKIFMDIQDVFPIQSNKINFKGNLAIESRGLWKLSDISAGGPFLSKIIYDSKLKRVYYLEGYVYAPGLKKRGLMQEISSILMTFELast
1 -122.000PB006101 JCVI_PEP_1096697844517 /source_dna_id=JCVI_ORF_1096697844516 /offset=0 /translation_table=11 /length=371 /full_length=371  ali  100  1YLISFSFLLYSCDEKPKSGITNPSFLPNASGENNEMLIVMDSTKFKGKIGRELVDIYSSYISGLPQPEPRYDLRYIKPRKFNSILKHAKNIVVAFSLEGNSLDSEILRRNFNSESLDKIQSDSSLFYFVRRNQYARGQVVLYLFSENDDDLYSKIKRNRNSILKFFDDELKKRVDTEIFRKVENNLMDKIFTDHNIKIKIPYGYDLAKSINEENSNFFWLRQLDLEYDKNIFLYYEDYSNSELKNFYDVFNSSDINIKPIRAYISKKYLRDSEKSKIFMDIQDVFPIQSNKINFKGNLAIESRGLWKLSDISAGGPFLSKIIYDSKLKRVYYLEGYVYAPGLKKRGLMQEISSILMTFE 359
2 -6.400PB029229 gi|150007903|ref|YP_001302646.1| hypothetical protein BDI_1263 [Parabacteroides distasonis ATCC 8503]gi|149936327|gb|ABR43024.1| conserved hypothetical protein [Parabacteroides distasonis ATCC 8503]  ali follow..  9VYALLAMILFSCEHKE---------LCFHHPHMVTLRVDFDWKNAPQADPEGMCVYFGKDGGSVEIKEGRYRILCYNNDTESLLFRGMEGFDTHEGYTRDGNVFESIYGNGAHYAPPAKGSEDERVVICPDMMWGSCARNVEITELGLSYECISFADKDKVEWIESSEHVITLYPAELICTYTYEVREYMTQACGSLSSMAPSMLFANEELDRECVTVPFETELHLESSKM................................................................................................................................ 249
3 -5.690HGC01024 gi|162869036|dbj|BABB01000971.1|4.0 TMP01399;  ali follow..  10VWLLGAAFMVGCGKQ----------VPENIIQPDRMEILYDYHLSISMGNN---LSYSDNYQKEAYKNYVFEKHHITEAEFDSSMVWYTR-ELASLYKKLGERFRSEKKHMQELLALRENKPAVSLPGDTVDVWYDRKLYWLTDVPLANKVTFEIPADS........................................................................................................................................................................................................ 158
4 -5.520PB019279 Q5LE73_BACFN/1-147 PB019279; Pfam-B_19279;  ali follow..  11  13LLAVAMINLTSCEIEIDDFYDDDNIGGSYYNKSLDLC----SRPWADTFYDADGNYCYQEL------------------NFYLDRHGEDYIRVEYPNGRYSESVYSFTWNWEDRSQYSLRMVGPGDVSYLDDVWIRGNVL........................................................................................................................................................................................................................... 131
5 -4.690PB012823 Q5LCS8_BACFN/1-272 PB012823; Pfam-B_12823;  ali follow..  12ATLLLTVLFVACNNGKGQQPSEENAKEILQGETPLMRIIGDTIYYSDAQSAPVYFKILKDTLYTYGKDVTHYQIDKQSEYSFWFHSLADNIIKLHKSEDPNDTLAFSFKSVEIIPTYTEVTKKDSVVMFDGVRY---RAYVYINPSQMKVVKTTYSEDGISMDNIYYDNVMHICV----YEGKKSLYAKDITKQMFVDVIPTDF........................................................................................................................................................... 219
6 -4.490PB064361 Q64PJ4_BACFR/1-580 PB064361; Pfam-B_64361;  ali follow..  10CLLAGTSLLASCNSEDMTDNPVETLTPQTRVSDYDDTDGKHKSKWDG--GEVIGVKIGTDGATTSTSNIPAYWQSTASQTVYGWYPNTADI----SLTGQDNTGNKFPYVLKGVSSKQYSYKENVQLNLEHQL---VKFRVKLNGDVPNLSDAKVFFYGYPTCKNEYGTVIP-------QGDKTYLATRKVGDYYTAMLAPDT............................................................................................................................................................ 226
7 -4.340PB008806 Q5L9W8_BACFN/1-127 PB008806; Pfam-B_8806;  ali follow..  32..........................................................................................................IAESYVHKNMGEILQQTMSITQIRIKPTDKNKLFLNI---NHINVSDWFKEQLNKLNQSVRMKQRQKIVRVQSSNDSILLDFSKKVKFNAALNL............................................................................................................................................................... 122
8 -4.070PB048631 gi|160885545|ref|ZP_02066548.1| hypothetical protein BACOVA_03545 [Bacteroides ovatus ATCC 8483]gi|156109167|gb|EDO10912.1| hypothetical protein BACOVA_03545 [Bacteroides ovatus ATCC 8483]  ali follow..  11  11SFFMVSFVITSCLDDDNNIEYSPDATIHAFAGLGSYKFTIDQ------LSREIYNEDSLPVHADTIIDKILIKTLTTASGVVTMKDKSGNDSVININDSIDLREPLTIKVWSTEALAGISPNQTKEYTIKVNVWNH-GEQKTIEFNNKILTYSVVEGKNLKVYQNSNYSNWTAAGTNTTGDLTSTLPNSILPLNGI-ILATANNKVYES----TDGVAWTISDKFSGNVKTFISKIPVDTDTKIDKEFPVDNISYTTFSKGSSYYRNIIVGKHEPAIEIDINNKKVPITIAWGYDGNV-------WAKLGTKSTTAYCPAF----DNPTVIYYNELFYVFGNEFESIYVSQN....... 393
9 -3.780PB009510 _JGI.0345302_ 2004041369 [Human Gut Community Subject 8]  ali follow..  4......................SYVTPGFYDKSYVGKWMFQVDKALKLAEELPEQFFPETATGLCWHEIKWGL----PVQENLSYQERRQAIYEKRDYHSPMTPYIMERYLENATGFTVHHDAGPLKYKPPHPNVFKAFFNGDGTLDSKKVRKLIDKLKESHTTYFVNDYSMFEIVFSEKFMVSNIGLLFKIPFWKARRFDGSELWDGSHLMDAAIEYEMRLGVKYKEGEFRIAETLDIERMTARAKVPLSEKMHIEKQTVSAKAFNWQSLFFDGSVPMDGNLLMNYCRADNKTTANIKIPVASISESYGNAT-----------TVKRNLAYFDGSLKMNGSRLLNSLNRKE....... 329
10 -3.350HGC01056 gi|162659434|dbj|BAAX01000171.1|2.0 TMP01455;  ali follow..  13  9IAVAALISFAACDHNETYADQRDR---------------------LDSINAFLRNENIKVINEAEFEKRFEARKAGDKAVKLTDTDPNNNEYVLFESNG------IYMQVINDGCGDYIAKGKTQNVLCR..................................................................................................................................................................................................................................... 112

FFAS is supported by the NIH grant R01-GM087218-01
1 3 8 7 1 9   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Friedberg I. and Godzik A Connecting the Protein Structure Universe by Using Sparse Recurring Fragments. Structure (Camb.) (2005) Aug;13(8):1213-24