current user: public

If you have questions about the server, please let us know.

Query: PB006154 _JGI.0331794_ 2004021056 [Human Gut Community Subject 7], from HGM_OVER

Results of FFAS03 search in HGM_OVER
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150
# Score Template Links and tools%idFirst ASYISVPRDLTKVKSKVMFNLTKRQLICFGMAVLIGVPSFFLMKTVMKTNTAVMGMMVIMMPFFFLAMYEKNGQPLEVILEHMIQAIFQRPKIRPYVTDNYYAALLRQAKAEKEVEEIVRLSQKEKSGEKNIHNAGGVKQSRPDGSKGNRKKRPLast
1 -88.600PB006154 _JGI.0331794_ 2004021056 [Human Gut Community Subject 7]  ali  100  1ASYISVPRDLTKVKSKVMFNLTKRQLICFGMAVLIGVPSFFLMKTVMKTNTAVMGMMVIMMPFFFLAMYEKNGQPLEVILEHMIQAIFQRPKIRPYVTDNYYAALLRQAKAEKEVEEIVRLSQKEKSGEKNIHNAGGVKQSRPDGSKGNRKKRP 154
2 -19.100PB006205 Q3F123_BACTI/1-181 PB006205; Pfam-B_6205;  ali follow..  11  18...MNYMRRQYEIMGRLPRAVTWRALGYFAAVEAGLVAFRFLFGDMIDQVWLMYYGVIPLFLVWGADKYKTDGKSLFSFVRSWITFRLRKHQSSRLVKKHVFYGHVCVQHDVKDLPIVHSFSEEENDIHAYDVTFLPQKEEVEYVEKDEQTTIK 180
3 -6.770PB010473 Q8A4J5_BACTN/121-234 PB010473; Pfam-B_10473;  ali follow..  9AMEYEINKGAGNLEFK---GLKSQYLFIFAGGLVAVLLVVVILYIAGVNQWICIPFGLLSGSLLVWLTFRLNARYGEHGLMKLLSGK-RHPRYLIHRRRLFRLLTKRRK............................................. 114
4 -6.490PB038151 Q8A4A5_BACTN/1-178 PB038151; Pfam-B_38151;  ali follow..  17  9TIFASSHPDIAK--------TSISGLLISCVMLLIGILSFASTFELEDKSSTVSMALMVFGTGLFLL----------------IFRLFWKSKEVVYVPTGSIAKERSIFFDLKHMDKLTDLVNSGSFSADSKIKSEASGNIRMDVILSADNK.. 138
5 -5.270PB003142 Q8DVS6_STRMU/1-162 PB003142; Pfam-B_3142;  ali follow..  16  96........................................................................................MNPKRMQRVLNKSKKQSAVSTKAQAEMQKLHEALKKEKKSQSKEKRQALKQYKYQLKQEKRHQKR. 160
6 -5.240HGC00429 gi|162734516|dbj|BAAZ01029480.1|1.0 TMP00411;  ali follow..  191.........................................................................................DFGSYVVKEYVTPDQLAVRVRSIERQEAARAHKEAKRQPPIAEQLKAAQREAQGHRGPELPKRSP 255
7 -5.000PB001708 Q3IRP6_NATPD/1-505 PB001708; Pfam-B_1708;  ali follow..  11  1.MNEGIPEQLIRRLSDA-----SRLVPLALLAVVAAVIYVWLIYRVAYSPSLLILVGTTVVAGIALVFWPRMGEDPLEIVVAALVLSVAYSIPAGMAEERSLAQDATADAEAVTDFPTVNEENPRIVPEAVANVQTKGSVSYRQHELGASD... 162
8 -4.530PB036876 Q56VH6_BACFR/1-141 PB036876; Pfam-B_36876;  ali follow..  57............................................................................DGEIYGQAVHYYDENEIEVGKPIQCQVAVNHVVELTAEEKAEARQNAIRQYQDEEVRRLQNRNKPRTATKATVQEV.. 132
9 -4.170HGC00518 gi|162728471|dbj|BAAY01000490.1|2.0 TMP00574;  ali follow..  14  58.KTLSIPGWLNDAAES---HINFSSVLQKGLKSELGMI.................................................................................................................... 92
10 -4.000HGC00915 gi|162810474|dbj|BABA01034235.1|2.0 TMP01234;  ali follow..  17  27...FKVPEGFENLTSEVMGKLPEKELLYMAAMFIGAALIIRVA............................................................................................................... 85

FFAS is supported by the NIH grant R01-GM087218-01
1 4 2 6 4 9   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Robinson-Rechavi M, Godzik A. Structural Genomics of Thermotoga maritima Proteins Shows that Contact Order Is a Major Determinant of Protein Thermostability. Structure (Camb). 2005 Jun;13(6):857-60.