current user: public

If you have questions about the server, please let us know.

Query: PB007147 Q11UU2_CYTH3/1-245 PB007147; Pfam-B_7147;, from HGM_OVER

Results of FFAS03 search in HGM_OVER
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .
# Score Template Links and tools%idFirst MTLIKGEPGKGIVLKEYGKNIQKIVDWILTIEDREQRTRYANTCVELMRQLNPGVRDTEEHTTKLWDHLFIMSNFKLDVDTPYPMPDIAVLGRKPERVPYNHNKLKYKHYGKNINLLIEQAILKEDGAEKEDAIIYLGRLMKRLYSTWNKENVDDEVIVEHLSELSKNNLQIDIARVKQEKLFDTIGGATADSRIPSSPSSSGGYSRAGGSSNRRSNSNGGGGYSNNNGNSTSRYQQNQNKPRRRLast
1 -99.100PB007147 Q11UU2_CYTH3/1-245 PB007147; Pfam-B_7147;  ali  100  1MTLIKGEPGKGIVLKEYGKNIQKIVDWILTIEDREQRTRYANTCVELMRQLNPGVRDTEEHTTKLWDHLFIMSNFKLDVDTPYPMPDIAVLGRKPERVPYNHNKLKYKHYGKNINLLIEQAILKEDGAEKEDAIIYLGRLMKRLYSTWNKENVDDEVIVEHLSELSKNNLQIDIARVKQEKLFDTIGGATADSRIPSSPSSSGGYSRAGGSSNRRSNSNGGGGYSNNNGNSTSRYQQNQNKPRRR 245
2 -4.000PB002776 gi|157737147|ref|YP_001489830.1| hypothetical protein Abu_0901 [Arcobacter butzleri RM4018]gi|157699001|gb|ABV67161.1| hypothetical protein Abu_0901 [Arcobacter butzleri RM4018]  ali follow..  12  226.EVNYNGNFEEINFFESLGKIPQPLVESFYIDENKNKSILFDKVLNNQEEWRKLFWDK--TKTKDWT-------YEKEYRIVLNRLMDYEIKEEDRKLKYDFNCLKGVIFGIKT-----------PQNKKDEIIEIIINKCH-------ENNILDFEFYQAFYCKESKNIQHK........................................................................ 376
3 -3.690HGC00593 gi|162858151|dbj|BABB01011554.1|1.0 TMP00709;  ali follow..  10  1..MDMTDNNDDVLVKKF------FSENRIDVPDDGFSRRVMRRLPDRTRRIS-----------RLWTAVCVVIGLLIFF...................................................................................................................................................................... 60
4 -3.670PB092941 Q45777_BACTN/1-139 PB092941; Pfam-B_92941;  ali follow..  15  19...........CVMEEFDALLSNIIDSTLGPRTKTFGYQYSEIFRSLMCVYFCGGSCVEDISTHLMSHLSFHPVLRS----CSADTILRAIKELTVPNITYTSSVSGKSYDFNMADRMNELL........................................................................................................................... 125
5 -3.130HGC00690 gi|162868815|dbj|BABB01001192.1|3.0 TMP00870;  ali follow..  6....................LREIFLSVIAFLAGAGVSAGVFAFVLVIGVVPRILRCSRIENIILIENVMICGVVAGNISSVLDTAYNLGFANMPKPVSNICGNIIIAIYGLCVGIFVG-------------IAVALAEILHTFPIIYKRMKLRAGLGI--VISMAIGKA........................................................................... 143
6 -2.960PB001934 Q6PSL5_CHLRE/821-1150 PB001934; Pfam-B_1934;  ali follow..  11  66IPMDAETPGGRLLRPQA-QVMEEAIRHSVRLDLDAARGKLGPEACEMERQRFDGVIAMMERNDG-----LVVTDSQAIDVVHPWTLDRSSGRPLVPITTFSIAMAYQQNGG-RLDPFVEGLEALETLQDGDRVL--ISEACNHNRITSACNDIGMVQIPNKLEALGGKKLQIE........................................................................ 237
7 -2.830HGC00993 gi|163626727|dbj|BABG01009540.1|1.0 TMP01352;  ali follow..  13  39....YSSHQEELARLKRIRKLHQKVATLITESALSDEEYGSDGREDFSRGVTKHPGDNRGFYHGV------ESERGL-MDYFYPEDTRTMFLRKEEQMLQHDKK............................................................................................................................................. 134
8 -2.370PB001404 Q2S5L8_SALRD/1-256 PB001404; Pfam-B_1404;  ali follow..  135....YGGGPNGSNFLRTVTNAETLISELEGKPRQVNRLAATRILTDVYGDV-PYFDAGKTRQDSIYMDLH-------ELRAAVDQFDASQPTFGGADLFFNGSIEQWKRFANSL................................................................................................................................... 256
9 -2.310PB009510 _JGI.0345302_ 2004041369 [Human Gut Community Subject 8]  ali follow..  6............VTPGFYDKSYVGKWMFQVMG--LEYDKALKLAEELPEQFFP---ETATWGLCWHEIKWGL-----------PVQENLSYQERRQAI-DYHSPMTPYIMERYLENATGFTVHIADCHDAGPLKYKPPHPNVFKAFFNGDGTLDSKKVRKLIDKLKESHTTY......................................................................... 152
10 -2.290PB007733 A3U921_9FLAO/1-209 PB007733; Pfam-B_7733;  ali follow..  60..LRRKTRKVWPYAKLASERLSELNARLASIKSKSERRKYTKIV-YIEEQFAAELKKLTRTEGQILVKL---------IHRQTGVTTFQLIKNLRSGWRAFWYDTTAGLFDIELKSEYNPVNNREDFLIEDILQRSFQR.......................................................................................................... 188

FFAS is supported by the NIH grant R01-GM087218-01
1 3 7 5 6 4   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Robinson-Rechavi M, Godzik A. Structural Genomics of Thermotoga maritima Proteins Shows that Contact Order Is a Major Determinant of Protein Thermostability. Structure (Camb). 2005 Jun;13(6):857-60.