current user: public

If you have questions about the server, please let us know.

Query: PB007843 JCVI_PEP_1096682172521 /source_dna_id=JCVI_ORF_1096682172520 /offset=0 /translation_table=11 /length=152 /full_length=152, from HGM_OVER

Results of FFAS03 search in HGM_OVER
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .
# Score Template Links and tools%idFirst LEKIISISGRPGLFEVHTQTRTGVVATSLVDGKRINANARNQVSLLSEINIYGLEKEVPLQEVLTMIHTKEEGKQCSVKPKSPADELEAYFFDVFQDYDEERVYPSDIKKIIQWYNILAEKVPQVFKAETAEEESQEEVAVKEETSSDLast
1 -84.300PB007843 JCVI_PEP_1096682172521 /source_dna_id=JCVI_ORF_1096682172520 /offset=0 /translation_table=11 /length=152 /full_length=152  ali  100  1LEKIISISGRPGLFEVHTQTRTGVVATSLVDGKRINANARNQVSLLSEINIYGLEKEVPLQEVLTMIHTKEEGKQCSVKPKSPADELEAYFFDVFQDYDEERVYPSDIKKIIQWYNILAEKVPQVFKAETAEEESQEEVAVKEETSSD 148
2 -3.990HGC00789 gi|163310627|dbj|BABD01000073.1|7.0 TMP01036;  ali follow..  1....MAVSAPPILKTLKTKDMAKTILQQIGGKRFTAMTGSRDFIDMGNLRMSLARNKTSANRLDIIYDEGADLYNMRFYRRTFSKKTFECKTKDIAVHEG--IYFDMLEEMFT................................... 109
3 -3.890HGC00993 gi|163626727|dbj|BABG01009540.1|1.0 TMP01352;  ali follow..  12  2FSLLLSTFAMMGLTFVIGFFVAGVIIASAADSLAFYSSHQEELARLKRIRKLHQKVATLITESALSDEEYGSDGREDFSRTKHPGDNRGFYHGVSPGESEDYFYPEDTRTMF----LRKEEQMLQHDKKNNKTSSTNKKQ........ 145
4 -3.760PB027778 Q5LHJ0_BACFN/1-110 PB027778; Pfam-B_27778;  ali follow..  13..................................................................................DDEKTIEFIRNYLPQELKEKFSEDELYYFLDLDEYYSESGILDVQPDADGYVDIDLEQV....... 72
5 -3.420PB040621 Q8A865_BACTN/1-132 PB040621; Pfam-B_40621;  ali follow..  22  17...........................................................................CSAFSLKKGHSKTVYAFGIAASFTDTVVYFTDIQIL..................................... 52
6 -3.180PB015954 Q6WBB3_BIFBR/1-225 PB015954; Pfam-B_15954;  ali follow..  10  119......IVG-------RADDSYFSFARTFVNNAISLDQLADAMRLGELGKQIVLISSRAFAALQFQDCEIARASTYHVLRNERDVTAREAYRRKSAEADIDGLFMRDIIR...................................... 216
7 -3.090PB001404 Q2S5L8_SALRD/1-256 PB001404; Pfam-B_1404;  ali follow..  151.........................AETLISELEGKPRQVNRLAATRIMRVLTFQGDVPYFDAGKGALEG--------EFTPHYTRQDSIYMDLHDELRADLFFNGSIEQWKRFANSL.............................. 256
8 -3.030PB009534 gi|153852721|ref|ZP_01994158.1| hypothetical protein DORLON_00140 [Dorea longicatena DSM 13814]gi|149754363|gb|EDM64294.1| hypothetical protein DORLON_00140 [Dorea longicatena DSM 13814]  ali follow..  11  62LKVIQKIHEIYPEASVENIGETDFIVTYEEQDGKGGVIHVAKIVMVAAFSTMAFNNDVGVTKMFGQIYELLTGTKSN....................................................................... 145
9 -3.000PB009661 _Gut.Meta.Jp.0000785_ gi|162567239|dbj|BAAU01000237.1||2 (- 3549:4008~0 complete)  ali follow..  17  7...........................................ELLDEAVDFCRKRGLEFYAVNSNMPEEEADMSALRSRKVSAD-----------------MYIDDLGGLPDWGVIYEMVHNRWSYNRYLNEIHDFERSQKVS.... 92
10 -2.880PB092941 Q45777_BACTN/1-139 PB092941; Pfam-B_92941;  ali follow..  11  9.EQITPFGGIFCVMEEFDALLSNIIDSTLGPRTKTFGYQYSEISCVEDISTHLMSSADTILRAIKELTVPNITYTSSVSGKSYDFNMADRMNELL..................................................... 125

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 4 7 0   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Li W, Wooley JC, Godzik A. Probing metagenomics by rapid cluster analysis of very large datasets. PLoS ONE. 2008;3(10):e3375. Epub 2008 Oct 10.