current user: public

If you have questions about the server, please let us know.

Query: PB008806 Q5L9W8_BACFN/1-127 PB008806; Pfam-B_8806;, from HGM_OVER

Results of FFAS03 search in HGM_OVER
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .
# Score Template Links and tools%idFirst MNNMYILVKIPSFISYGNLQTATMIIGTPLSIAESYVHKNMGEILQQTMSITQIRIKPTDKNKLFLNINHINVSDWFKEQLNKLNQSVRMKQRQKIVRVQSSNDSILLDFSKKVKFNAALNLAFCIFLast
1 -90.100PB008806 Q5L9W8_BACFN/1-127 PB008806; Pfam-B_8806;  ali  100  1MNNMYILVKIPSFISYGNLQTATMIIGTPLSIAESYVHKNMGEILQQTMSITQIRIKPTDKNKLFLNINHINVSDWFKEQLNKLNQSVRMKQRQKIVRVQSSNDSILLDFSKKVKFNAALNLAFCIF 127
2 -5.440HGC00485 gi|163636056|dbj|BABG01000217.1|3.0 TMP00523;  ali follow..  15  56...LLRLAEVWSAIRAKEGMGGLILEGTEAKILSDVVAQFYA-------LSGCMFNDPVGMAELHYMMSSLMLGEWFE................................................. 127
3 -4.350PB006101 JCVI_PEP_1096697844517 /source_dna_id=JCVI_ORF_1096697844516 /offset=0 /translation_table=11 /length=371 /full_length=371  ali follow..  107...............................LRRNFNSESLDKIQSDSSLFYFVRRNQYARGQVVLYLNDDDLYSKIKRNRNSILKFFDDELKKRVDTEIFRKVENNLMDKIFTDHNIKIKI..... 200
4 -3.630PB044822 Q89ZL7_BACTN/1-147 PB044822; Pfam-B_44822;  ali follow..  13  37...........................................QPDQTSGQLTIYNDDDE------ELANVMIEEWATYDGDDFMENVKPNLKSTLCRMKDAGDFDKVTILKPYSF........... 103
5 -3.170PB064361 Q64PJ4_BACFR/1-580 PB064361; Pfam-B_64361;  ali follow..  41.............LTFTAMQGEVVATPQTRVSDYDDTDGKHKSKWDGGEVIGVKIGTDGAVGSYTLDSDGQTVYGWY--------NTADISLTGQDNTGNKFPYVLKGVSSKQYSYKENVQLNL... 162
6 -2.880PB027498 Q7MTK6_PORGI/1-146 PB027498; Pfam-B_27498;  ali follow..  72..................................VYYDDEELDRYAGVLPEEYNTEAVEEFEEILSTLQEEEVPSWIRS................................................ 116
7 -2.790PB128892 A6TNK2_9CLOT/1-174 PB128892; Pfam-B_128892;  ali follow..  36...................................IMENDIMNYFMLQQFIGELKEEKDTGQLFMITDQGKKTLTYFISRIPEEKRLKIDHLLNIKKEEFVRNTEIKGEYEKLTDNEYLVKLSV... 131
8 -2.560PB038401 Q8RFH0_FUSNN/1-210 PB038401; Pfam-B_38401;  ali follow..  12  2............DIGPCSIPTGEFLVGDPLVYLGSKYEKEYFQKIPTGEFRTEICVVKASDGDVRLKFNDNEISYF---------EEAMKGIEDLKDINEGDFFGFNVDAGLACICDKKLHDLY... 110
9 -2.390HGC00106 gi|162841414|dbj|BABA01003295.1|1.0 TMP01000;  ali follow..  14  41...................................................................................ITGYSGLDPELDISNVQAPGVEYRDTYPTTRSFTFGVNIGF... 81
10 -2.270HGC00150 gi|162733542|dbj|BAAZ01030454.1|1.0 TMP01074;  ali follow..  15..........IDELGLSAQAARNLYAGKDLTYILEQYNDTVAAGYAAQNQLYTTISEAGEQAARDIAHLRTSVYQADLVTIENQFMLAVKEVKKEIGNDFAAMQSMTAEAAKRM............. 144

FFAS is supported by the NIH grant R01-GM087218-01
1 3 9 2 2 3   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Slabinski L, Jaroszewski L, Rodrigues AP, Rychlewski L, Wilson IA, Lesley SA, Godzik A. The challenge of protein structure determination--lessons from structuralgenomics. Protein Sci. 2007 Nov;16(11):2472-82.