current user: public

If you have questions about the server, please let us know.

Query: PB009510 _JGI.0345302_ 2004041369 [Human Gut Community Subject 8], from HGM_OVER

Results of FFAS03 search in HGM_OVER
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .
# Score Template Links and tools%idFirst KMLSYVTPGFYDKSYVGKWMFQVMGLEYDKALKLAEELPEQFFPETATWGLCWHEIKWGLPVQENLSYQERRQAIYEKRDYHSPMTPYIMERYLENATGFTVHIADCHDAGPLKYKPPHPNVFKAFFNGDGTLDSKKVRKLIDKLKESHTTYFVNDYSMFEIVFSEKFMVSNIGLLFKIPFWKARRFDGSELWDGSHLMDAAIEYEMRLGVKYKEGEFRIAETLDIERMTARAKVPLSEKMHIEKQTVSAKAFNWQSLFFDGSVPMDGNLLMNYCRADNKTTANIKIPVASISESYGNATCTVKRNLAYFDGSLKMNGSRLLNSLNRKELast
1 -116.000PB009510 _JGI.0345302_ 2004041369 [Human Gut Community Subject 8]  ali  100  1KMLSYVTPGFYDKSYVGKWMFQVMGLEYDKALKLAEELPEQFFPETATWGLCWHEIKWGLPVQENLSYQERRQAIYEKRDYHSPMTPYIMERYLENATGFTVHIADCHDAGPLKYKPPHPNVFKAFFNGDGTLDSKKVRKLIDKLKESHTTYFVNDYSMFEIVFSEKFMVSNIGLLFKIPFWKARRFDGSELWDGSHLMDAAIEYEMRLGVKYKEGEFRIAETLDIERMTARAKVPLSEKMHIEKQTVSAKAFNWQSLFFDGSVPMDGNLLMNYCRADNKTTANIKIPVASISESYGNATCTVKRNLAYFDGSLKMNGSRLLNSLNRKE 329
2 -3.780PB006101 JCVI_PEP_1096697844517 /source_dna_id=JCVI_ORF_1096697844516 /offset=0 /translation_table=11 /length=371 /full_length=371  ali follow..  23...PSFLPNASGENNEMLIVMDS-----TKFKGKIGRELVDIYSSYIS-GLPQPEPRYDLPRKFNSILKHAKNIVVAFSLEGNSLDSEILRRNFNSESLDKIQ----SDSSLFYFVRRNQYARGQVVLYLFSENDDDLYSKIKRNRNSILKFFDDELKKRVDTEIFRKVENNLMDKIFTDHNIKIKIPYGYDLAKSINEENSNFFWLRQLDLEYDKNIFLYYEDYSNSELKNFYDVFNSSDINIKPIRAYISKKYLRDSEKSKIFMDIQDVFPIQSNKINFKGNLAIESRGLWKLSDISA-SKLKRVYYLEGYVYAPGLKKRGLMQEIS 352
3 -3.110PB000520 Q9RVX4_DEIRA/1-194 PB000520; Pfam-B_520;  ali follow..  35.LAAMITPAVL---SGAGTLIMSTSTRVGRATDRVRGLTSRFLVSAEGQNEPLAREEKRLIIRQLPRLSRRTRFLMRALQAFYTSVALLVLTSILLGLD...................................................................................................................................................................................................................................... 132
4 -2.860PB042013 A7V626_BACUN/1-162 PB042013; Pfam-B_42013;  ali follow..  33...................................................................................................................................................................................................................................................................LAGIWQLCHYVSEIPDVPGILKPSNTFKVLSDDGRIVNFTMIPGKDAIITGYGTYQQLTDNSYKESIEKN 102
5 -2.840PB128892 A6TNK2_9CLOT/1-174 PB128892; Pfam-B_128892;  ali follow..  11  15.VLLYIFDRVLANIQLTQFIMENDIMNYFMLQQFIGELKESSFIMEQEKD----GQLFMITDQGKKTLTYFISRIPEEKRLKIDHLLNIKKEEFVRNTEIKGEYEKLTDNEYLVVIEQGTPIFNLKLSVGNVKQAKDMCEKWRS......................................................................................................................................................................................... 160
6 -2.490PB014998 gi|86133284|ref|ZP_01051866.1| hypothetical protein MED152_01230 [Tenacibaculum sp. MED152]gi|85820147|gb|EAQ41294.1| hypothetical protein MED152_01230 [Polaribacter dokdonensis MED152]  ali follow..  21..RQRVANIVLENKELFEPLLEVTFQVDEPISVKAAWVLEWICTHHQLSWMIPHLTFF-LKNLTFDSAIRPCAKICEHLEFKSKLKNEHIQEIIETGFDW---LITPQKIAVRAYTMNTLYLFGLENDWVHPELKHLIETKIIHESKG..................................................................................................................................................................................... 175
7 -2.380HGC00803 gi|163280588|dbj|BABD01030100.1|2.0 TMP01051;  ali follow..  16  18.....LLDEMYQDDYYPAFLVDKVKDELQKVIDLLES---QETLDEAVCGINDLQEEF--DENDSEIETVARDCIGVT-----------VAYILEWF-GIPIDIEE............................................................................................................................................................................................................................... 109
8 -2.290PB007147 Q11UU2_CYTH3/1-245 PB007147; Pfam-B_7147;  ali follow..  13.....VLKEYGKNIQKIVDWILTIEEQRTRYANTCVELMRQLNPDTEEHTTKLWDHLFIMPMPDIAVLGRKPERV----YNHNKLKYKHYGKNINLLIEQAILKEDGAEKEDAIIYLGRLMKRLYSTWNKENVDDEVIVEHLSELSKNNLQI................................................................................................................................................................................. 172
9 -2.210PB006791 A6TXD6_9CLOT/1-181 PB006791; Pfam-B_6791;  ali follow..  56..IESVLMQHIEKVEEAQVEVEKVHKRLDIINNRMSFCIQKV-------GMVRYNAFADMGSDLSYSLDENNNGMIITGIYGRSETVTYAKPVKDGKSNYSLSVEE............................................................................................................................................................................................................................... 155
10 -2.160HGC00789 gi|163310627|dbj|BABD01000073.1|7.0 TMP01036;  ali follow..  1..MAVSAPPILKTLKTKDMIAKTILQQIGGKR-RMSLARNKTSANRLDIIYDEGADLYNMRFYRRTFSKKTFECKTKDIAVHEGIYFDMLEEMFTMVTGLYTRF................................................................................................................................................................................................................................. 118

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 4 7 0   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Li W, Wooley JC, Godzik A. Probing metagenomics by rapid cluster analysis of very large datasets. PLoS ONE. 2008;3(10):e3375. Epub 2008 Oct 10.