current user: public

If you have questions about the server, please let us know.

Query: PB009661 _Gut.Meta.Jp.0000785_ gi|162567239|dbj|BAAU01000237.1||2 (- 3549:4008~0 complete), from HGM_OVER

Results of FFAS03 search in HGM_OVER
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100
# Score Template Links and tools%idFirst WSVREGELLDEAVDFCRKRGLEFYAVNSNMPEEEADMSALRSRKVSADMYIDDRNLGGLPDWGVIYEMVHNRWSYNRYLNEIHDFERSQKVSWWKRLINKKLast
1 -68.000PB009661 _Gut.Meta.Jp.0000785_ gi|162567239|dbj|BAAU01000237.1||2 (- 3549:4008~0 complete)  ali  100  1WSVREGELLDEAVDFCRKRGLEFYAVNSNMPEEEADMSALRSRKVSADMYIDDRNLGGLPDWGVIYEMVHNRWSYNRYLNEIHDFERSQKVSWWKRLINKK 101
2 -3.000PB007843 JCVI_PEP_1096682172521 /source_dna_id=JCVI_ORF_1096682172520 /offset=0 /translation_table=11 /length=152 /full_length=152  ali follow..  17  44......SLLSEINIYGLEKEVPLQEVLTMIHTKEEGKQCSVKPKSPADVYPSD--IKKIIQWYNILAEKVPQVFKAETAEEESQEEVAVKEE......... 144
3 -2.940PB046158 _JGI.0336690_ 2004028347 [Human Gut Community Subject 8]  ali follow..  93....TDENIKSFDRVARKYGIDYSLKKEV-----------GADPPKYLVFFKAKDV------DVMTAAFREYAGVELKKKQVKKPSVRKKLQKSVERKAKH 172
4 -2.890PB017610 Q11T14_CYTH3/22-188 PB017610; Pfam-B_17610;  ali follow..  10  115..........KETPYTFKVSTKLDGQPLKIDFLYNHPKHFRHGLHIIELYVDGLKIG............................................ 161
5 -2.620PB034883 _HOMD.0130261_ bfor_c_1_4664 Tannerella forsythia ATCC 43037 [1809083 - 1810348] ORF  ali follow..  11  149.ILVNWKRAMDFLKMYAGENLPFFKIDNAFAEEYKRF................................................................ 184
6 -2.570PB000119 Q6KIT1_MYCMO/1-381 PB000119; Pfam-B_119;  ali follow..  10  264WFLQSKMELTDTATVIIINNTAYVNINKNSVKH-NNFAVNYLKSEENNWYLTGRDF............................................. 318
7 -2.280PB076697 gi|160881556|ref|YP_001560524.1| hypothetical protein Cphy_3432 [Clostridium phytofermentans ISDg]gi|160430222|gb|ABX43785.1| conserved hypothetical protein [Clostridium phytofermentans ISDg]  ali follow..  14  139......KNFTVLDKYLKSVGTKLLYVNNQLPYGLKDYPNKNADKLLEGLYIDDTTEAAFFAYQYMLDYMEKNYEFQYNKQTYNGANYNQVQSFIGSLANR. 272
8 -2.230HGC00672 gi|162843654|dbj|BABA01001055.1|4.0 TMP00845;  ali follow..  10  41...AENRNFIETYTITLTKGFAGDSTS-NDSLLVNRTMTEEPFILEVKRFAEQSALMIVNNATEKLSLFELSEQGGEYRFEKEGEEVKPTGAGIKKLSKE. 139
9 -2.090PB001404 Q2S5L8_SALRD/1-256 PB001404; Pfam-B_1404;  ali follow..  11  206.............HYTRQDSI-YMDLHDELRAAVDQFDASQPTFGGADLFFN----GSIEQWKRFANSL................................ 256
10 -1.920HGC00965 gi|163282470|dbj|BABD01028218.1|2.0 TMP01310;  ali follow..  76..........................TDPALRRREIFPMTEEGRTAVAQYLNDAYNAEPERWSAHPSILDCEPWTPPAPEPDAETQ............... 135

FFAS is supported by the NIH grant R01-GM087218-01
1 4 2 6 4 9   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Robinson-Rechavi M, Godzik A. Structural Genomics of Thermotoga maritima Proteins Shows that Contact Order Is a Major Determinant of Protein Thermostability. Structure (Camb). 2005 Jun;13(6):857-60.