current user: public

If you have questions about the server, please let us know.

Query: PB009671 Q5LCM2_BACFN/1-111 PB009671; Pfam-B_9671;, from HGM_OVER

Results of FFAS03 search in HGM_OVER
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110
# Score Template Links and tools%idFirst MKKVLVALTMVMGMGSAVAFAQEPVKLPAMEQNQQTSQDKFTKITVKELPQVVKSTLSKDYEGTIVKEAFVAEKENGKVYKIIVTAIKEDQSTEEITVLLNEKGEPVNEKDLast
1 -54.000PB009671 Q5LCM2_BACFN/1-111 PB009671; Pfam-B_9671;  ali  100  1MKKVLVALTMVMGMGSAVAFAQEPVKLPAMEQNQQTSQDKFTKITVKELPQVVKSTLSKDYEGTIVKEAFVAEKENGKVYKIIVTAIKEDQSTEEITVLLNEKGEPVNEKD 111
2 -21.200HGC00683 gi|163310582|dbj|BABD01000118.1|4.0 TMP00861;  ali follow..  12  1MKTLKITFVMLMTALFLVLPSCS----------------KDDVNVTLTPSEEVVNAFQQKYPDVKNVKWEILVGA----YEAEFIYSGTYSDKVEAQAYITQGGKWVRSE. 98
3 -9.900HGC01056 gi|162659434|dbj|BAAX01000171.1|2.0 TMP01455;  ali follow..  13  1MKKLLLAMIAVAALISFAACDHNETYADQRDRELDSINANEAEFEKRFEARKAGDKAVKLTDTDPNNNEYVLFESNGIYMQVI--CGDYIAKGKTQNVLCRFTEYCLANRA 122
4 -8.520PB042013 A7V626_BACUN/1-162 PB042013; Pfam-B_42013;  ali follow..  1MKRNYFFTMLAAVLLAVAGANAQESAEFRPAELAGIWQLCHYVSEIPDVPGILKPS-DGRIVNFTMIPGKDAIITGYGTYQQEKNIHLPMLDHKDNILEFEIGDDGV.... 124
5 -7.430PB029229 gi|150007903|ref|YP_001302646.1| hypothetical protein BDI_1263 [Parabacteroides distasonis ATCC 8503]gi|149936327|gb|ABR43024.1| conserved hypothetical protein [Parabacteroides distasonis ATCC 8503]  ali follow..  1MKTGIRVTVYALLAMILFSCEHKELCFHHPHMVTLRVDFDWKNAP-QADPEGMCVYFYPEEGESPIRFDFAGKDGGSVRYRILCYNNDTES.................... 95
6 -7.310PB083081 gi|160890648|ref|ZP_02071651.1| hypothetical protein BACUNI_03093 [Bacteroides uniformis ATCC 8492]gi|156859647|gb|EDO53078.1| hypothetical protein BACUNI_03093 [Bacteroides uniformis ATCC 8492]  ali follow..  1MKKTIFYSLFSALFMLTSCSMFEIDNYEEPS-------------------ETIWGEVVDEATGKRVL-----TDQGSEGIRVRLELSWGDNVQHNPDFYCMMDGTF..... 83
7 -6.960PB004718 Q5LIA4_BACFN/1-189 PB004718; Pfam-B_4718;  ali follow..  10  1MKVSILLLLMIATALPSFGGNGNGNGTDSLQATRYVTRATMYGVGYTNVFDTYLSPQE--YKGIEFR............................................ 67
8 -6.600PB045072 _Gut.Meta.Jp.0111663_ gi|163310555|dbj|BABD01000145.1||3 (+ 1662:2028~0 complete)  ali follow..  1MRKLGFTLVAALAFSVSAFANNANDTINVAGKWDGTINKAKKYLQLSSQQNEQVASICDYF.................................................. 63
9 -6.540PB015266 gi|154494998|ref|ZP_02034003.1| hypothetical protein PARMER_04044 [Parabacteroides merdae ATCC 43184]gi|154085548|gb|EDN84593.1| hypothetical protein PARMER_04044 [Parabacteroides merdae ATCC 43184]  ali follow..  12  1MKRIVSMMVIFTLLLGGMTHVQAQTSKAAXXXXXXXXXXXXXXXRLAK--NNAMQAITNR-----VLEANSVQPLNGRVYYVNSNTNFVSLNDGQAMVQIASNSP...... 109
10 -6.190PB021443 Q5LG43_BACFN/1-226 PB021443; Pfam-B_21443;  ali follow..  13  1MKTMKFILACVLLLSPLLCQAQKNLFNK----------NDMKGVSSVYISKAMMELNPEHLNSVQVLSTHDNKVREEMAKDIR-LLMKQKSTVSGSEVYVNRKGSKVKE.. 121

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 4 7 0   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Li W, Wooley JC, Godzik A. Probing metagenomics by rapid cluster analysis of very large datasets. PLoS ONE. 2008;3(10):e3375. Epub 2008 Oct 10.